data_5WOW # _entry.id 5WOW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5WOW pdb_00005wow 10.2210/pdb5wow/pdb WWPDB D_1000229378 ? ? BMRB 30324 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR structure of cyclotide MCoTI-I' _pdbx_database_related.db_id 30324 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5WOW _pdbx_database_status.recvd_initial_deposition_date 2017-08-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schroeder, C.I.' 1 0000-0002-6737-6374 'Kwon, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'ACS Chem. Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1554-8937 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 2973 _citation.page_last 2980 _citation.title 'Targeted Delivery of Cyclotides via Conjugation to a Nanobody.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acschembio.8b00653 _citation.pdbx_database_id_PubMed 30248263 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kwon, S.' 1 ? primary 'Duarte, J.N.' 2 ? primary 'Li, Z.' 3 ? primary 'Ling, J.J.' 4 ? primary 'Cheneval, O.' 5 ? primary 'Durek, T.' 6 ? primary 'Schroeder, C.I.' 7 ? primary 'Craik, D.J.' 8 ? primary 'Ploegh, H.L.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Two inhibitor peptide topologies 2' _entity.formula_weight 4247.842 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GGVCPKILQRCRRDSDCPGACICRGNGYCGYPYDVPDYA _entity_poly.pdbx_seq_one_letter_code_can GGVCPKILQRCRRDSDCPGACICRGNGYCGYPYDVPDYA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 VAL n 1 4 CYS n 1 5 PRO n 1 6 LYS n 1 7 ILE n 1 8 LEU n 1 9 GLN n 1 10 ARG n 1 11 CYS n 1 12 ARG n 1 13 ARG n 1 14 ASP n 1 15 SER n 1 16 ASP n 1 17 CYS n 1 18 PRO n 1 19 GLY n 1 20 ALA n 1 21 CYS n 1 22 ILE n 1 23 CYS n 1 24 ARG n 1 25 GLY n 1 26 ASN n 1 27 GLY n 1 28 TYR n 1 29 CYS n 1 30 GLY n 1 31 TYR n 1 32 PRO n 1 33 TYR n 1 34 ASP n 1 35 VAL n 1 36 PRO n 1 37 ASP n 1 38 TYR n 1 39 ALA n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 39 _pdbx_entity_src_syn.organism_scientific 'Momordica cochinchinensis' _pdbx_entity_src_syn.organism_common_name 'Spiny bitter cucumber' _pdbx_entity_src_syn.ncbi_taxonomy_id 3674 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5WOW _struct_ref.pdbx_db_accession 5WOW _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5WOW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 39 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5WOW _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 39 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 39 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-15N HSQC' 1 isotropic 4 1 1 '2D DQF-COSY' 1 isotropic 5 1 1 '2D 1H-13C HSQC' 1 isotropic 8 2 2 '2D 1H-1H TOCSY' 1 isotropic 7 2 2 '2D 1H-13C HSQC' 1 isotropic 6 2 2 '2D 1H-1H E COSY' 1 isotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm ambient 3.0 . ? ? 'Not defined' conditions_1 ? pH ? ? K 2 298 atm ambient 3.0 . ? ? 'Not defined' conditions_2 ? pH ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM MCoTI-HA, 90% H2O/10% D2O' '90% H2O/10% D2O' H2O solution ? 2 '0.5 mM MCoTI-HA, 100% D2O' '100% D2O' D2O solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details 'equipped with a cryoprobe' # _pdbx_nmr_refine.entry_id 5WOW _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 5WOW _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5WOW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' CcpNMR ? CCPN 4 'peak picking' CcpNMR ? CCPN 5 collection TopSpin ? 'Bruker Biospin' 6 processing TopSpin ? 'Bruker Biospin' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5WOW _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5WOW _struct.title 'Solution NMR structure of cyclotide MCoTI-I' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5WOW _struct_keywords.text 'cyclotide, plant peptide, cyclic cystine knot, grafted peptide, bioactive epitope, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 4 A CYS 21 1_555 ? ? ? ? ? ? ? 2.015 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 11 A CYS 23 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 17 A CYS 29 1_555 ? ? ? ? ? ? ? 2.035 ? ? covale1 covale both ? A GLY 1 N ? ? ? 1_555 A ALA 39 C ? ? A GLY 1 A ALA 39 1_555 ? ? ? ? ? ? ? 1.290 sing ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _atom_sites.entry_id 5WOW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 ALA 39 39 39 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-08-08 2 'Structure model' 1 1 2018-10-10 3 'Structure model' 1 2 2018-10-31 4 'Structure model' 1 3 2020-01-08 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Structure summary' 7 4 'Structure model' 'Author supporting evidence' 8 4 'Structure model' 'Data collection' 9 4 'Structure model' 'Derived calculations' 10 5 'Structure model' 'Database references' 11 5 'Structure model' 'Derived calculations' 12 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' entity 4 3 'Structure model' citation 5 3 'Structure model' entity 6 4 'Structure model' pdbx_audit_support 7 4 'Structure model' pdbx_nmr_software 8 4 'Structure model' pdbx_nmr_spectrometer 9 4 'Structure model' struct_conn 10 5 'Structure model' database_2 11 5 'Structure model' pdbx_database_status 12 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_entity.formula_weight' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation.title' 14 3 'Structure model' '_entity.formula_weight' 15 4 'Structure model' '_pdbx_audit_support.funding_organization' 16 4 'Structure model' '_pdbx_nmr_software.name' 17 4 'Structure model' '_pdbx_nmr_spectrometer.model' 18 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 19 5 'Structure model' '_database_2.pdbx_DOI' 20 5 'Structure model' '_database_2.pdbx_database_accession' 21 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 22 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 28 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 29 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 30 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 31 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 MCoTI-HA 0.5 ? mM 'natural abundance' 2 MCoTI-HA 0.5 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 PRO A 32 ? ? -49.17 166.74 2 2 VAL A 35 ? ? -116.81 79.19 3 3 VAL A 35 ? ? -116.21 78.59 4 4 LYS A 6 ? ? -78.34 -167.15 5 4 ALA A 20 ? ? -79.79 24.06 6 5 VAL A 35 ? ? -116.97 69.29 7 6 ALA A 20 ? ? -69.32 7.46 8 7 LEU A 8 ? ? 46.16 72.58 9 7 TYR A 33 ? ? -49.61 -15.82 10 8 ALA A 20 ? ? -77.09 20.03 11 8 ASP A 34 ? ? -61.45 3.33 12 9 PRO A 32 ? ? -64.92 -179.44 13 11 LEU A 8 ? ? 54.48 80.00 14 12 LEU A 8 ? ? -63.41 91.71 15 13 ALA A 20 ? ? -79.77 24.11 16 14 LEU A 8 ? ? 59.52 73.81 17 15 PRO A 32 ? ? -61.84 -177.50 18 16 LEU A 8 ? ? -48.56 150.17 19 16 ALA A 20 ? ? -79.97 26.07 20 16 ASP A 34 ? ? -69.08 1.08 21 20 LEU A 8 ? ? -62.06 98.11 22 20 ALA A 20 ? ? -79.17 23.15 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 14 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 12 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.074 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_audit_support.funding_organization 'National Health and Medical Research Council (NHMRC, Australia)' _pdbx_audit_support.country Australia _pdbx_audit_support.grant_number APP1047857 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? #