data_5XD9 # _entry.id 5XD9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5XD9 pdb_00005xd9 10.2210/pdb5xd9/pdb WWPDB D_1300003321 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5XD7 PDB . unspecified 5XD8 PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5XD9 _pdbx_database_status.recvd_initial_deposition_date 2017-03-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lee, S.' 1 ? 'Choi, I.-G.' 2 ? 'Kim, H.-Y.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochem. Biophys. Res. Commun.' _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 491 _citation.language ? _citation.page_first 217 _citation.page_last 222 _citation.title ;Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase suggests emergence of novel substrate specificity in the enolase superfamily ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2017.07.080 _citation.pdbx_database_id_PubMed 28716734 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, S.' 1 ? primary 'Kim, K.H.' 2 ? primary 'Kim, H.-Y.' 3 ? primary 'Choi, I.-G.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5XD9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 89.821 _cell.length_a_esd ? _cell.length_b 89.821 _cell.length_b_esd ? _cell.length_c 142.467 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5XD9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3,6-anhydro-alpha-L-galactonate cycloisomerase' 41296.691 1 5.5.1.25 ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 3 water nat water 18.015 56 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AHGA cycloisomerase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKTTIKDIKTRLFKIPLKEILSDAKHGDHDHFELITTTVTLEDGSQGTGYTYTGGKGGYSIKAMLEYDIQPALIGKDATQ IEEIYDFMEWHIHYVGRGGISTFAMSAVDIALWDLKGKREGLPLWKMAGGKNNTCKAYCGGIDLQFPLEKLLNNICGYLE SGFNAVKIKIGRENMQEDIDRIKAVRELIGPDITFMIDANYSLTVEQAIKLSKAVEQYDITWFEEPTLPDDYKGFAEIAD NTAIPLAMGENLHTIHEFGYAMDQAKLGYCQPDASNCGGITGWLKAADLITEHNIPVCTNGMQELHVSLVSAFDTGWLEV HSFPIDEYTKRPLVVENFRAVASNEPGIGVEFDWDKIAQYEVHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKTTIKDIKTRLFKIPLKEILSDAKHGDHDHFELITTTVTLEDGSQGTGYTYTGGKGGYSIKAMLEYDIQPALIGKDATQ IEEIYDFMEWHIHYVGRGGISTFAMSAVDIALWDLKGKREGLPLWKMAGGKNNTCKAYCGGIDLQFPLEKLLNNICGYLE SGFNAVKIKIGRENMQEDIDRIKAVRELIGPDITFMIDANYSLTVEQAIKLSKAVEQYDITWFEEPTLPDDYKGFAEIAD NTAIPLAMGENLHTIHEFGYAMDQAKLGYCQPDASNCGGITGWLKAADLITEHNIPVCTNGMQELHVSLVSAFDTGWLEV HSFPIDEYTKRPLVVENFRAVASNEPGIGVEFDWDKIAQYEVHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 THR n 1 4 THR n 1 5 ILE n 1 6 LYS n 1 7 ASP n 1 8 ILE n 1 9 LYS n 1 10 THR n 1 11 ARG n 1 12 LEU n 1 13 PHE n 1 14 LYS n 1 15 ILE n 1 16 PRO n 1 17 LEU n 1 18 LYS n 1 19 GLU n 1 20 ILE n 1 21 LEU n 1 22 SER n 1 23 ASP n 1 24 ALA n 1 25 LYS n 1 26 HIS n 1 27 GLY n 1 28 ASP n 1 29 HIS n 1 30 ASP n 1 31 HIS n 1 32 PHE n 1 33 GLU n 1 34 LEU n 1 35 ILE n 1 36 THR n 1 37 THR n 1 38 THR n 1 39 VAL n 1 40 THR n 1 41 LEU n 1 42 GLU n 1 43 ASP n 1 44 GLY n 1 45 SER n 1 46 GLN n 1 47 GLY n 1 48 THR n 1 49 GLY n 1 50 TYR n 1 51 THR n 1 52 TYR n 1 53 THR n 1 54 GLY n 1 55 GLY n 1 56 LYS n 1 57 GLY n 1 58 GLY n 1 59 TYR n 1 60 SER n 1 61 ILE n 1 62 LYS n 1 63 ALA n 1 64 MET n 1 65 LEU n 1 66 GLU n 1 67 TYR n 1 68 ASP n 1 69 ILE n 1 70 GLN n 1 71 PRO n 1 72 ALA n 1 73 LEU n 1 74 ILE n 1 75 GLY n 1 76 LYS n 1 77 ASP n 1 78 ALA n 1 79 THR n 1 80 GLN n 1 81 ILE n 1 82 GLU n 1 83 GLU n 1 84 ILE n 1 85 TYR n 1 86 ASP n 1 87 PHE n 1 88 MET n 1 89 GLU n 1 90 TRP n 1 91 HIS n 1 92 ILE n 1 93 HIS n 1 94 TYR n 1 95 VAL n 1 96 GLY n 1 97 ARG n 1 98 GLY n 1 99 GLY n 1 100 ILE n 1 101 SER n 1 102 THR n 1 103 PHE n 1 104 ALA n 1 105 MET n 1 106 SER n 1 107 ALA n 1 108 VAL n 1 109 ASP n 1 110 ILE n 1 111 ALA n 1 112 LEU n 1 113 TRP n 1 114 ASP n 1 115 LEU n 1 116 LYS n 1 117 GLY n 1 118 LYS n 1 119 ARG n 1 120 GLU n 1 121 GLY n 1 122 LEU n 1 123 PRO n 1 124 LEU n 1 125 TRP n 1 126 LYS n 1 127 MET n 1 128 ALA n 1 129 GLY n 1 130 GLY n 1 131 LYS n 1 132 ASN n 1 133 ASN n 1 134 THR n 1 135 CYS n 1 136 LYS n 1 137 ALA n 1 138 TYR n 1 139 CYS n 1 140 GLY n 1 141 GLY n 1 142 ILE n 1 143 ASP n 1 144 LEU n 1 145 GLN n 1 146 PHE n 1 147 PRO n 1 148 LEU n 1 149 GLU n 1 150 LYS n 1 151 LEU n 1 152 LEU n 1 153 ASN n 1 154 ASN n 1 155 ILE n 1 156 CYS n 1 157 GLY n 1 158 TYR n 1 159 LEU n 1 160 GLU n 1 161 SER n 1 162 GLY n 1 163 PHE n 1 164 ASN n 1 165 ALA n 1 166 VAL n 1 167 LYS n 1 168 ILE n 1 169 LYS n 1 170 ILE n 1 171 GLY n 1 172 ARG n 1 173 GLU n 1 174 ASN n 1 175 MET n 1 176 GLN n 1 177 GLU n 1 178 ASP n 1 179 ILE n 1 180 ASP n 1 181 ARG n 1 182 ILE n 1 183 LYS n 1 184 ALA n 1 185 VAL n 1 186 ARG n 1 187 GLU n 1 188 LEU n 1 189 ILE n 1 190 GLY n 1 191 PRO n 1 192 ASP n 1 193 ILE n 1 194 THR n 1 195 PHE n 1 196 MET n 1 197 ILE n 1 198 ASP n 1 199 ALA n 1 200 ASN n 1 201 TYR n 1 202 SER n 1 203 LEU n 1 204 THR n 1 205 VAL n 1 206 GLU n 1 207 GLN n 1 208 ALA n 1 209 ILE n 1 210 LYS n 1 211 LEU n 1 212 SER n 1 213 LYS n 1 214 ALA n 1 215 VAL n 1 216 GLU n 1 217 GLN n 1 218 TYR n 1 219 ASP n 1 220 ILE n 1 221 THR n 1 222 TRP n 1 223 PHE n 1 224 GLU n 1 225 GLU n 1 226 PRO n 1 227 THR n 1 228 LEU n 1 229 PRO n 1 230 ASP n 1 231 ASP n 1 232 TYR n 1 233 LYS n 1 234 GLY n 1 235 PHE n 1 236 ALA n 1 237 GLU n 1 238 ILE n 1 239 ALA n 1 240 ASP n 1 241 ASN n 1 242 THR n 1 243 ALA n 1 244 ILE n 1 245 PRO n 1 246 LEU n 1 247 ALA n 1 248 MET n 1 249 GLY n 1 250 GLU n 1 251 ASN n 1 252 LEU n 1 253 HIS n 1 254 THR n 1 255 ILE n 1 256 HIS n 1 257 GLU n 1 258 PHE n 1 259 GLY n 1 260 TYR n 1 261 ALA n 1 262 MET n 1 263 ASP n 1 264 GLN n 1 265 ALA n 1 266 LYS n 1 267 LEU n 1 268 GLY n 1 269 TYR n 1 270 CYS n 1 271 GLN n 1 272 PRO n 1 273 ASP n 1 274 ALA n 1 275 SER n 1 276 ASN n 1 277 CYS n 1 278 GLY n 1 279 GLY n 1 280 ILE n 1 281 THR n 1 282 GLY n 1 283 TRP n 1 284 LEU n 1 285 LYS n 1 286 ALA n 1 287 ALA n 1 288 ASP n 1 289 LEU n 1 290 ILE n 1 291 THR n 1 292 GLU n 1 293 HIS n 1 294 ASN n 1 295 ILE n 1 296 PRO n 1 297 VAL n 1 298 CYS n 1 299 THR n 1 300 ASN n 1 301 GLY n 1 302 MET n 1 303 GLN n 1 304 GLU n 1 305 LEU n 1 306 HIS n 1 307 VAL n 1 308 SER n 1 309 LEU n 1 310 VAL n 1 311 SER n 1 312 ALA n 1 313 PHE n 1 314 ASP n 1 315 THR n 1 316 GLY n 1 317 TRP n 1 318 LEU n 1 319 GLU n 1 320 VAL n 1 321 HIS n 1 322 SER n 1 323 PHE n 1 324 PRO n 1 325 ILE n 1 326 ASP n 1 327 GLU n 1 328 TYR n 1 329 THR n 1 330 LYS n 1 331 ARG n 1 332 PRO n 1 333 LEU n 1 334 VAL n 1 335 VAL n 1 336 GLU n 1 337 ASN n 1 338 PHE n 1 339 ARG n 1 340 ALA n 1 341 VAL n 1 342 ALA n 1 343 SER n 1 344 ASN n 1 345 GLU n 1 346 PRO n 1 347 GLY n 1 348 ILE n 1 349 GLY n 1 350 VAL n 1 351 GLU n 1 352 PHE n 1 353 ASP n 1 354 TRP n 1 355 ASP n 1 356 LYS n 1 357 ILE n 1 358 ALA n 1 359 GLN n 1 360 TYR n 1 361 GLU n 1 362 VAL n 1 363 HIS n 1 364 HIS n 1 365 HIS n 1 366 HIS n 1 367 HIS n 1 368 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 368 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Vejaci, VEJY3_09370' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain EJY3 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vibrio sp. (strain EJY3)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1116375 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ACI_VIBSJ _struct_ref.pdbx_db_accession H2IFX0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKTTIKDIKTRLFKIPLKEILSDAKHGDHDHFELITTTVTLEDGSQGTGYTYTGGKGGYSIKAMLEYDIQPALIGKDATQ IEEIYDFMEWHIHYVGRGGISTFAMSAVDIALWDLKGKREGLPLWKMAGGKNNTCKAYCGGIDLQFPLEKLLNNICGYLE SGFNAVKIKIGRENMQEDIDRIKAVRELIGPDITFMIDANYSLTVEQAIKLSKAVEQYDITWFEEPTLPDDYKGFAEIAD NTAIPLAMGENLHTIHEFGYAMDQAKLGYCQPDASNCGGITGWLKAADLITEHNIPVCTHGMQELHVSLVSAFDTGWLEV HSFPIDEYTKRPLVVENFRAVASNEPGIGVEFDWDKIAQYEV ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XD9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 362 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession H2IFX0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 362 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 362 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5XD9 ASN A 300 ? UNP H2IFX0 HIS 300 conflict 300 1 1 5XD9 HIS A 363 ? UNP H2IFX0 ? ? 'expression tag' 363 2 1 5XD9 HIS A 364 ? UNP H2IFX0 ? ? 'expression tag' 364 3 1 5XD9 HIS A 365 ? UNP H2IFX0 ? ? 'expression tag' 365 4 1 5XD9 HIS A 366 ? UNP H2IFX0 ? ? 'expression tag' 366 5 1 5XD9 HIS A 367 ? UNP H2IFX0 ? ? 'expression tag' 367 6 1 5XD9 HIS A 368 ? UNP H2IFX0 ? ? 'expression tag' 368 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XD9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.48 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.65 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M magnesium acetate tetrahydrate, 0.1M sodium cacodylate (pH 6.5), 20% (w/v) polyethylene glycol 8000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-04-11 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97960 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97960 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5XD9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.6 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 119413 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5XD9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.600 _refine.ls_d_res_low 47.406 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17687 _refine.ls_number_reflns_R_free 1769 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.04 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1752 _refine.ls_R_factor_R_free 0.2334 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1687 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.46 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5XD7 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.48 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.33 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2844 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 2902 _refine_hist.d_res_high 2.600 _refine_hist.d_res_low 47.406 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 2909 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.108 ? 3941 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.179 ? 1057 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.042 ? 431 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 507 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5996 2.6698 . . 125 1126 90.00 . . . 0.3535 . 0.2722 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6698 2.7484 . . 133 1194 95.00 . . . 0.3478 . 0.2681 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7484 2.8371 . . 135 1210 96.00 . . . 0.3285 . 0.2492 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8371 2.9385 . . 134 1214 96.00 . . . 0.3153 . 0.2245 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9385 3.0561 . . 135 1213 95.00 . . . 0.2649 . 0.1972 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0561 3.1952 . . 135 1213 96.00 . . . 0.2793 . 0.1744 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1952 3.3636 . . 135 1219 96.00 . . . 0.2191 . 0.1527 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3636 3.5742 . . 138 1237 96.00 . . . 0.2230 . 0.1476 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5742 3.8501 . . 135 1224 95.00 . . . 0.2061 . 0.1363 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8501 4.2373 . . 138 1235 96.00 . . . 0.1935 . 0.1216 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2373 4.8500 . . 137 1240 96.00 . . . 0.1871 . 0.1266 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.8500 6.1084 . . 141 1267 95.00 . . . 0.1885 . 0.1568 . . . . . . . . . . 'X-RAY DIFFRACTION' 6.1084 47.4138 . . 148 1326 93.00 . . . 0.2071 . 0.1694 . . . . . . . . . . # _struct.entry_id 5XD9 _struct.title 'Crystal structure analysis of 3,6-anhydro-L-galactonate cycloisomerase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XD9 _struct_keywords.text 'Enolase superfamily, 3, 6-anhydro-L-galactonate cycloisomerase, lyase, barrel domain, capping domain, ISOMERASE' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 57 ? ILE A 69 ? GLY A 57 ILE A 69 1 ? 13 HELX_P HELX_P2 AA2 ILE A 69 ? ILE A 74 ? ILE A 69 ILE A 74 1 ? 6 HELX_P HELX_P3 AA3 GLN A 80 ? ILE A 92 ? GLN A 80 ILE A 92 1 ? 13 HELX_P HELX_P4 AA4 GLY A 99 ? GLY A 121 ? GLY A 99 GLY A 121 1 ? 23 HELX_P HELX_P5 AA5 PRO A 123 ? ALA A 128 ? PRO A 123 ALA A 128 1 ? 6 HELX_P HELX_P6 AA6 PRO A 147 ? SER A 161 ? PRO A 147 SER A 161 1 ? 15 HELX_P HELX_P7 AA7 ASN A 174 ? GLY A 190 ? ASN A 174 GLY A 190 1 ? 17 HELX_P HELX_P8 AA8 THR A 204 ? GLU A 216 ? THR A 204 GLU A 216 1 ? 13 HELX_P HELX_P9 AA9 GLN A 217 ? ASP A 219 ? GLN A 217 ASP A 219 5 ? 3 HELX_P HELX_P10 AB1 ASP A 231 ? ASP A 240 ? ASP A 231 ASP A 240 1 ? 10 HELX_P HELX_P11 AB2 THR A 254 ? ALA A 265 ? THR A 254 ALA A 265 1 ? 12 HELX_P HELX_P12 AB3 ASP A 273 ? CYS A 277 ? ASP A 273 CYS A 277 5 ? 5 HELX_P HELX_P13 AB4 GLY A 278 ? HIS A 293 ? GLY A 278 HIS A 293 1 ? 16 HELX_P HELX_P14 AB5 MET A 302 ? ASP A 314 ? MET A 302 ASP A 314 1 ? 13 HELX_P HELX_P15 AB6 PRO A 324 ? THR A 329 ? PRO A 324 THR A 329 5 ? 6 HELX_P HELX_P16 AB7 ASP A 353 ? ALA A 358 ? ASP A 353 ALA A 358 1 ? 6 HELX_P HELX_P17 AB8 GLN A 359 ? GLU A 361 ? GLN A 359 GLU A 361 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A TYR 52 OH ? ? ? 1_555 C MG . MG ? ? A TYR 52 A MG 402 1_555 ? ? ? ? ? ? ? 2.920 ? ? metalc2 metalc ? ? A ASP 198 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 198 A MG 401 1_555 ? ? ? ? ? ? ? 2.725 ? ? metalc3 metalc ? ? A ASP 198 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 198 A MG 401 1_555 ? ? ? ? ? ? ? 2.229 ? ? metalc4 metalc ? ? A GLU 224 OE2 ? ? ? 1_555 B MG . MG ? ? A GLU 224 A MG 401 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc5 metalc ? ? A GLU 225 OE1 ? ? ? 1_555 B MG . MG ? ? A GLU 225 A MG 401 1_555 ? ? ? ? ? ? ? 2.587 ? ? metalc6 metalc ? ? A GLU 250 OE2 ? ? ? 1_555 C MG . MG ? ? A GLU 250 A MG 402 1_555 ? ? ? ? ? ? ? 2.669 ? ? metalc7 metalc ? ? A ASP 273 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 273 A MG 402 1_555 ? ? ? ? ? ? ? 1.853 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 7 ? AA3 ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? parallel AA2 6 7 ? parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? parallel AA3 4 5 ? parallel AA3 5 6 ? parallel AA3 6 7 ? anti-parallel AA3 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 5 ? ASP A 23 ? ILE A 5 ASP A 23 AA1 2 GLY A 27 ? LEU A 41 ? GLY A 27 LEU A 41 AA1 3 GLN A 46 ? THR A 53 ? GLN A 46 THR A 53 AA2 1 TYR A 269 ? CYS A 270 ? TYR A 269 CYS A 270 AA2 2 LEU A 246 ? MET A 248 ? LEU A 246 MET A 248 AA2 3 PHE A 223 ? GLU A 224 ? PHE A 223 GLU A 224 AA2 4 THR A 194 ? ASP A 198 ? THR A 194 ASP A 198 AA2 5 ALA A 165 ? LYS A 169 ? ALA A 165 LYS A 169 AA2 6 THR A 134 ? GLY A 140 ? THR A 134 GLY A 140 AA2 7 TRP A 317 ? VAL A 320 ? TRP A 317 VAL A 320 AA3 1 TYR A 269 ? CYS A 270 ? TYR A 269 CYS A 270 AA3 2 LEU A 246 ? MET A 248 ? LEU A 246 MET A 248 AA3 3 PHE A 223 ? GLU A 224 ? PHE A 223 GLU A 224 AA3 4 THR A 194 ? ASP A 198 ? THR A 194 ASP A 198 AA3 5 ALA A 165 ? LYS A 169 ? ALA A 165 LYS A 169 AA3 6 THR A 134 ? GLY A 140 ? THR A 134 GLY A 140 AA3 7 ARG A 339 ? VAL A 341 ? ARG A 339 VAL A 341 AA3 8 VAL A 334 ? GLU A 336 ? VAL A 334 GLU A 336 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 7 ? N ASP A 7 O THR A 40 ? O THR A 40 AA1 2 3 N VAL A 39 ? N VAL A 39 O GLY A 47 ? O GLY A 47 AA2 1 2 N TYR A 269 ? N TYR A 269 O LEU A 246 ? O LEU A 246 AA2 2 3 O ALA A 247 ? O ALA A 247 N PHE A 223 ? N PHE A 223 AA2 3 4 O GLU A 224 ? O GLU A 224 N ILE A 197 ? N ILE A 197 AA2 4 5 O MET A 196 ? O MET A 196 N VAL A 166 ? N VAL A 166 AA2 5 6 O LYS A 167 ? O LYS A 167 N CYS A 139 ? N CYS A 139 AA2 6 7 N TYR A 138 ? N TYR A 138 O VAL A 320 ? O VAL A 320 AA3 1 2 N TYR A 269 ? N TYR A 269 O LEU A 246 ? O LEU A 246 AA3 2 3 O ALA A 247 ? O ALA A 247 N PHE A 223 ? N PHE A 223 AA3 3 4 O GLU A 224 ? O GLU A 224 N ILE A 197 ? N ILE A 197 AA3 4 5 O MET A 196 ? O MET A 196 N VAL A 166 ? N VAL A 166 AA3 5 6 O LYS A 167 ? O LYS A 167 N CYS A 139 ? N CYS A 139 AA3 6 7 N CYS A 135 ? N CYS A 135 O ALA A 340 ? O ALA A 340 AA3 7 8 O VAL A 341 ? O VAL A 341 N VAL A 334 ? N VAL A 334 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 401 ? 5 'binding site for residue MG A 401' AC2 Software A MG 402 ? 5 'binding site for residue MG A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 198 ? ASP A 198 . ? 1_555 ? 2 AC1 5 ASN A 200 ? ASN A 200 . ? 1_555 ? 3 AC1 5 GLU A 224 ? GLU A 224 . ? 1_555 ? 4 AC1 5 GLU A 225 ? GLU A 225 . ? 1_555 ? 5 AC1 5 GLU A 250 ? GLU A 250 . ? 1_555 ? 6 AC2 5 TYR A 52 ? TYR A 52 . ? 1_555 ? 7 AC2 5 TYR A 94 ? TYR A 94 . ? 7_557 ? 8 AC2 5 GLU A 250 ? GLU A 250 . ? 1_555 ? 9 AC2 5 ASP A 273 ? ASP A 273 . ? 1_555 ? 10 AC2 5 ASN A 300 ? ASN A 300 . ? 1_555 ? # _atom_sites.entry_id 5XD9 _atom_sites.fract_transf_matrix[1][1] 0.011133 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011133 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007019 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 TRP 113 113 113 TRP TRP A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 MET 127 127 127 MET MET A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 CYS 135 135 135 CYS CYS A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 CYS 139 139 139 CYS CYS A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 CYS 156 156 156 CYS CYS A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 PHE 163 163 163 PHE PHE A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 MET 175 175 175 MET MET A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 ASP 178 178 178 ASP ASP A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 PHE 195 195 195 PHE PHE A . n A 1 196 MET 196 196 196 MET MET A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 ASN 200 200 200 ASN ASN A . n A 1 201 TYR 201 201 201 TYR TYR A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 GLN 207 207 207 GLN GLN A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 GLN 217 217 217 GLN GLN A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 THR 221 221 221 THR THR A . n A 1 222 TRP 222 222 222 TRP TRP A . n A 1 223 PHE 223 223 223 PHE PHE A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 GLU 225 225 225 GLU GLU A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 THR 227 227 227 THR THR A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 PRO 229 229 229 PRO PRO A . n A 1 230 ASP 230 230 230 ASP ASP A . n A 1 231 ASP 231 231 231 ASP ASP A . n A 1 232 TYR 232 232 232 TYR TYR A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 GLY 234 234 234 GLY GLY A . n A 1 235 PHE 235 235 235 PHE PHE A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 ILE 238 238 238 ILE ILE A . n A 1 239 ALA 239 239 239 ALA ALA A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 ASN 241 241 241 ASN ASN A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 PRO 245 245 245 PRO PRO A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 ALA 247 247 247 ALA ALA A . n A 1 248 MET 248 248 248 MET MET A . n A 1 249 GLY 249 249 249 GLY GLY A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 ASN 251 251 251 ASN ASN A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 HIS 253 253 253 HIS HIS A . n A 1 254 THR 254 254 254 THR THR A . n A 1 255 ILE 255 255 255 ILE ILE A . n A 1 256 HIS 256 256 256 HIS HIS A . n A 1 257 GLU 257 257 257 GLU GLU A . n A 1 258 PHE 258 258 258 PHE PHE A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 TYR 260 260 260 TYR TYR A . n A 1 261 ALA 261 261 261 ALA ALA A . n A 1 262 MET 262 262 262 MET MET A . n A 1 263 ASP 263 263 263 ASP ASP A . n A 1 264 GLN 264 264 264 GLN GLN A . n A 1 265 ALA 265 265 265 ALA ALA A . n A 1 266 LYS 266 266 266 LYS LYS A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 GLY 268 268 268 GLY GLY A . n A 1 269 TYR 269 269 269 TYR TYR A . n A 1 270 CYS 270 270 270 CYS CYS A . n A 1 271 GLN 271 271 271 GLN GLN A . n A 1 272 PRO 272 272 272 PRO PRO A . n A 1 273 ASP 273 273 273 ASP ASP A . n A 1 274 ALA 274 274 274 ALA ALA A . n A 1 275 SER 275 275 275 SER SER A . n A 1 276 ASN 276 276 276 ASN ASN A . n A 1 277 CYS 277 277 277 CYS CYS A . n A 1 278 GLY 278 278 278 GLY GLY A . n A 1 279 GLY 279 279 279 GLY GLY A . n A 1 280 ILE 280 280 280 ILE ILE A . n A 1 281 THR 281 281 281 THR THR A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 TRP 283 283 283 TRP TRP A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 LYS 285 285 285 LYS LYS A . n A 1 286 ALA 286 286 286 ALA ALA A . n A 1 287 ALA 287 287 287 ALA ALA A . n A 1 288 ASP 288 288 288 ASP ASP A . n A 1 289 LEU 289 289 289 LEU LEU A . n A 1 290 ILE 290 290 290 ILE ILE A . n A 1 291 THR 291 291 291 THR THR A . n A 1 292 GLU 292 292 292 GLU GLU A . n A 1 293 HIS 293 293 293 HIS HIS A . n A 1 294 ASN 294 294 294 ASN ASN A . n A 1 295 ILE 295 295 295 ILE ILE A . n A 1 296 PRO 296 296 296 PRO PRO A . n A 1 297 VAL 297 297 297 VAL VAL A . n A 1 298 CYS 298 298 298 CYS CYS A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 ASN 300 300 300 ASN ASN A . n A 1 301 GLY 301 301 301 GLY GLY A . n A 1 302 MET 302 302 302 MET MET A . n A 1 303 GLN 303 303 303 GLN GLN A . n A 1 304 GLU 304 304 304 GLU GLU A . n A 1 305 LEU 305 305 305 LEU LEU A . n A 1 306 HIS 306 306 306 HIS HIS A . n A 1 307 VAL 307 307 307 VAL VAL A . n A 1 308 SER 308 308 308 SER SER A . n A 1 309 LEU 309 309 309 LEU LEU A . n A 1 310 VAL 310 310 310 VAL VAL A . n A 1 311 SER 311 311 311 SER SER A . n A 1 312 ALA 312 312 312 ALA ALA A . n A 1 313 PHE 313 313 313 PHE PHE A . n A 1 314 ASP 314 314 314 ASP ASP A . n A 1 315 THR 315 315 315 THR THR A . n A 1 316 GLY 316 316 316 GLY GLY A . n A 1 317 TRP 317 317 317 TRP TRP A . n A 1 318 LEU 318 318 318 LEU LEU A . n A 1 319 GLU 319 319 319 GLU GLU A . n A 1 320 VAL 320 320 320 VAL VAL A . n A 1 321 HIS 321 321 321 HIS HIS A . n A 1 322 SER 322 322 322 SER SER A . n A 1 323 PHE 323 323 323 PHE PHE A . n A 1 324 PRO 324 324 324 PRO PRO A . n A 1 325 ILE 325 325 325 ILE ILE A . n A 1 326 ASP 326 326 326 ASP ASP A . n A 1 327 GLU 327 327 327 GLU GLU A . n A 1 328 TYR 328 328 328 TYR TYR A . n A 1 329 THR 329 329 329 THR THR A . n A 1 330 LYS 330 330 330 LYS LYS A . n A 1 331 ARG 331 331 331 ARG ARG A . n A 1 332 PRO 332 332 332 PRO PRO A . n A 1 333 LEU 333 333 333 LEU LEU A . n A 1 334 VAL 334 334 334 VAL VAL A . n A 1 335 VAL 335 335 335 VAL VAL A . n A 1 336 GLU 336 336 336 GLU GLU A . n A 1 337 ASN 337 337 337 ASN ASN A . n A 1 338 PHE 338 338 338 PHE PHE A . n A 1 339 ARG 339 339 339 ARG ARG A . n A 1 340 ALA 340 340 340 ALA ALA A . n A 1 341 VAL 341 341 341 VAL VAL A . n A 1 342 ALA 342 342 342 ALA ALA A . n A 1 343 SER 343 343 343 SER SER A . n A 1 344 ASN 344 344 344 ASN ASN A . n A 1 345 GLU 345 345 345 GLU GLU A . n A 1 346 PRO 346 346 346 PRO PRO A . n A 1 347 GLY 347 347 347 GLY GLY A . n A 1 348 ILE 348 348 348 ILE ILE A . n A 1 349 GLY 349 349 349 GLY GLY A . n A 1 350 VAL 350 350 350 VAL VAL A . n A 1 351 GLU 351 351 351 GLU GLU A . n A 1 352 PHE 352 352 352 PHE PHE A . n A 1 353 ASP 353 353 353 ASP ASP A . n A 1 354 TRP 354 354 354 TRP TRP A . n A 1 355 ASP 355 355 355 ASP ASP A . n A 1 356 LYS 356 356 356 LYS LYS A . n A 1 357 ILE 357 357 357 ILE ILE A . n A 1 358 ALA 358 358 358 ALA ALA A . n A 1 359 GLN 359 359 359 GLN GLN A . n A 1 360 TYR 360 360 360 TYR TYR A . n A 1 361 GLU 361 361 361 GLU GLU A . n A 1 362 VAL 362 362 362 VAL VAL A . n A 1 363 HIS 363 363 ? ? ? A . n A 1 364 HIS 364 364 ? ? ? A . n A 1 365 HIS 365 365 ? ? ? A . n A 1 366 HIS 366 366 ? ? ? A . n A 1 367 HIS 367 367 ? ? ? A . n A 1 368 HIS 368 368 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 401 1 MG MG A . C 2 MG 1 402 2 MG MG A . D 3 HOH 1 501 11 HOH HOH A . D 3 HOH 2 502 28 HOH HOH A . D 3 HOH 3 503 50 HOH HOH A . D 3 HOH 4 504 39 HOH HOH A . D 3 HOH 5 505 55 HOH HOH A . D 3 HOH 6 506 49 HOH HOH A . D 3 HOH 7 507 60 HOH HOH A . D 3 HOH 8 508 53 HOH HOH A . D 3 HOH 9 509 5 HOH HOH A . D 3 HOH 10 510 12 HOH HOH A . D 3 HOH 11 511 34 HOH HOH A . D 3 HOH 12 512 46 HOH HOH A . D 3 HOH 13 513 56 HOH HOH A . D 3 HOH 14 514 15 HOH HOH A . D 3 HOH 15 515 42 HOH HOH A . D 3 HOH 16 516 57 HOH HOH A . D 3 HOH 17 517 36 HOH HOH A . D 3 HOH 18 518 2 HOH HOH A . D 3 HOH 19 519 13 HOH HOH A . D 3 HOH 20 520 41 HOH HOH A . D 3 HOH 21 521 30 HOH HOH A . D 3 HOH 22 522 14 HOH HOH A . D 3 HOH 23 523 10 HOH HOH A . D 3 HOH 24 524 40 HOH HOH A . D 3 HOH 25 525 27 HOH HOH A . D 3 HOH 26 526 9 HOH HOH A . D 3 HOH 27 527 22 HOH HOH A . D 3 HOH 28 528 3 HOH HOH A . D 3 HOH 29 529 24 HOH HOH A . D 3 HOH 30 530 45 HOH HOH A . D 3 HOH 31 531 8 HOH HOH A . D 3 HOH 32 532 18 HOH HOH A . D 3 HOH 33 533 1 HOH HOH A . D 3 HOH 34 534 20 HOH HOH A . D 3 HOH 35 535 6 HOH HOH A . D 3 HOH 36 536 17 HOH HOH A . D 3 HOH 37 537 23 HOH HOH A . D 3 HOH 38 538 19 HOH HOH A . D 3 HOH 39 539 64 HOH HOH A . D 3 HOH 40 540 4 HOH HOH A . D 3 HOH 41 541 21 HOH HOH A . D 3 HOH 42 542 52 HOH HOH A . D 3 HOH 43 543 16 HOH HOH A . D 3 HOH 44 544 43 HOH HOH A . D 3 HOH 45 545 48 HOH HOH A . D 3 HOH 46 546 7 HOH HOH A . D 3 HOH 47 547 35 HOH HOH A . D 3 HOH 48 548 51 HOH HOH A . D 3 HOH 49 549 62 HOH HOH A . D 3 HOH 50 550 63 HOH HOH A . D 3 HOH 51 551 61 HOH HOH A . D 3 HOH 52 552 54 HOH HOH A . D 3 HOH 53 553 58 HOH HOH A . D 3 HOH 54 554 59 HOH HOH A . D 3 HOH 55 555 32 HOH HOH A . D 3 HOH 56 556 33 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4150 ? 1 MORE -54 ? 1 'SSA (A^2)' 25120 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_557 y,x,-z+2 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 284.9340000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 521 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OH ? A TYR 52 ? A TYR 52 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OE2 ? A GLU 250 ? A GLU 250 ? 1_555 102.0 ? 2 OH ? A TYR 52 ? A TYR 52 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OD2 ? A ASP 273 ? A ASP 273 ? 1_555 87.0 ? 3 OE2 ? A GLU 250 ? A GLU 250 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OD2 ? A ASP 273 ? A ASP 273 ? 1_555 171.0 ? 4 OD1 ? A ASP 198 ? A ASP 198 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 198 ? A ASP 198 ? 1_555 51.4 ? 5 OD1 ? A ASP 198 ? A ASP 198 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE2 ? A GLU 224 ? A GLU 224 ? 1_555 103.9 ? 6 OD2 ? A ASP 198 ? A ASP 198 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE2 ? A GLU 224 ? A GLU 224 ? 1_555 101.0 ? 7 OD1 ? A ASP 198 ? A ASP 198 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE1 ? A GLU 225 ? A GLU 225 ? 1_555 101.4 ? 8 OD2 ? A ASP 198 ? A ASP 198 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE1 ? A GLU 225 ? A GLU 225 ? 1_555 148.7 ? 9 OE2 ? A GLU 224 ? A GLU 224 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE1 ? A GLU 225 ? A GLU 225 ? 1_555 100.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-27 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OH A TYR 50 ? ? OE2 A GLU 304 ? ? 2.17 2 1 O A VAL 362 ? ? O A HOH 501 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 219 ? ? 55.03 72.09 2 1 ASN A 276 ? ? -149.18 25.16 3 1 ARG A 331 ? ? -152.79 85.23 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 363 ? A HIS 363 2 1 Y 1 A HIS 364 ? A HIS 364 3 1 Y 1 A HIS 365 ? A HIS 365 4 1 Y 1 A HIS 366 ? A HIS 366 5 1 Y 1 A HIS 367 ? A HIS 367 6 1 Y 1 A HIS 368 ? A HIS 368 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MG MG MG N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5XD7 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #