data_5XFF # _entry.id 5XFF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5XFF pdb_00005xff 10.2210/pdb5xff/pdb WWPDB D_1300003369 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-05 2 'Structure model' 1 1 2019-03-27 3 'Structure model' 1 2 2024-03-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5XFF _pdbx_database_status.recvd_initial_deposition_date 2017-04-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 5XFJ _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wu, D.' 1 ? 'Chen, Y.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem. Commun. (Camb.)' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1364-548X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 54 _citation.language ? _citation.page_first 12089 _citation.page_last 12092 _citation.title 'LY2874455 potently inhibits FGFR gatekeeper mutants and overcomes mutation-based resistance.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/c8cc07546h _citation.pdbx_database_id_PubMed 30298149 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, D.' 1 ? primary 'Guo, M.' 2 ? primary 'Min, X.' 3 ? primary 'Dai, S.' 4 ? primary 'Li, M.' 5 ? primary 'Tan, S.' 6 ? primary 'Li, G.' 7 ? primary 'Chen, X.' 8 ? primary 'Ma, Y.' 9 ? primary 'Li, J.' 10 ? primary 'Jiang, L.' 11 ? primary 'Qu, L.' 12 ? primary 'Zhou, Z.' 13 ? primary 'Chen, Z.' 14 ? primary 'Chen, L.' 15 ? primary 'Xu, G.' 16 ? primary 'Chen, Y.' 17 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Fibroblast growth factor receptor 4' 34705.102 1 2.7.10.1 V550L ? ? 2 non-polymer syn '2-[4-[E-2-[5-[(1R)-1-[3,5-bis(chloranyl)pyridin-4-yl]ethoxy]-1H-indazol-3-yl]ethenyl]pyrazol-1-yl]ethanol' 444.314 1 ? ? ? ? 3 water nat water 18.015 5 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name FGFR-4 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGAFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEME VMKLIGRHKNIINLLGVCTQEGPLYVILECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQY LESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEI FTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGAFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEME VMKLIGRHKNIINLLGVCTQEGPLYVILECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQY LESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEI FTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-[4-[E-2-[5-[(1R)-1-[3,5-bis(chloranyl)pyridin-4-yl]ethoxy]-1H-indazol-3-yl]ethenyl]pyrazol-1-yl]ethanol' 6LF 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 LEU n 1 5 ALA n 1 6 GLY n 1 7 LEU n 1 8 VAL n 1 9 SER n 1 10 LEU n 1 11 ASP n 1 12 LEU n 1 13 PRO n 1 14 LEU n 1 15 ASP n 1 16 PRO n 1 17 LEU n 1 18 TRP n 1 19 GLU n 1 20 PHE n 1 21 PRO n 1 22 ARG n 1 23 ASP n 1 24 ARG n 1 25 LEU n 1 26 VAL n 1 27 LEU n 1 28 GLY n 1 29 LYS n 1 30 PRO n 1 31 LEU n 1 32 GLY n 1 33 GLU n 1 34 GLY n 1 35 ALA n 1 36 PHE n 1 37 GLY n 1 38 GLN n 1 39 VAL n 1 40 VAL n 1 41 ARG n 1 42 ALA n 1 43 GLU n 1 44 ALA n 1 45 PHE n 1 46 GLY n 1 47 MET n 1 48 ASP n 1 49 PRO n 1 50 ALA n 1 51 ARG n 1 52 PRO n 1 53 ASP n 1 54 GLN n 1 55 ALA n 1 56 SER n 1 57 THR n 1 58 VAL n 1 59 ALA n 1 60 VAL n 1 61 LYS n 1 62 MET n 1 63 LEU n 1 64 LYS n 1 65 ASP n 1 66 ASN n 1 67 ALA n 1 68 SER n 1 69 ASP n 1 70 LYS n 1 71 ASP n 1 72 LEU n 1 73 ALA n 1 74 ASP n 1 75 LEU n 1 76 VAL n 1 77 SER n 1 78 GLU n 1 79 MET n 1 80 GLU n 1 81 VAL n 1 82 MET n 1 83 LYS n 1 84 LEU n 1 85 ILE n 1 86 GLY n 1 87 ARG n 1 88 HIS n 1 89 LYS n 1 90 ASN n 1 91 ILE n 1 92 ILE n 1 93 ASN n 1 94 LEU n 1 95 LEU n 1 96 GLY n 1 97 VAL n 1 98 CYS n 1 99 THR n 1 100 GLN n 1 101 GLU n 1 102 GLY n 1 103 PRO n 1 104 LEU n 1 105 TYR n 1 106 VAL n 1 107 ILE n 1 108 LEU n 1 109 GLU n 1 110 CYS n 1 111 ALA n 1 112 ALA n 1 113 LYS n 1 114 GLY n 1 115 ASN n 1 116 LEU n 1 117 ARG n 1 118 GLU n 1 119 PHE n 1 120 LEU n 1 121 ARG n 1 122 ALA n 1 123 ARG n 1 124 ARG n 1 125 PRO n 1 126 PRO n 1 127 GLY n 1 128 PRO n 1 129 ASP n 1 130 LEU n 1 131 SER n 1 132 PRO n 1 133 ASP n 1 134 GLY n 1 135 PRO n 1 136 ARG n 1 137 SER n 1 138 SER n 1 139 GLU n 1 140 GLY n 1 141 PRO n 1 142 LEU n 1 143 SER n 1 144 PHE n 1 145 PRO n 1 146 VAL n 1 147 LEU n 1 148 VAL n 1 149 SER n 1 150 CYS n 1 151 ALA n 1 152 TYR n 1 153 GLN n 1 154 VAL n 1 155 ALA n 1 156 ARG n 1 157 GLY n 1 158 MET n 1 159 GLN n 1 160 TYR n 1 161 LEU n 1 162 GLU n 1 163 SER n 1 164 ARG n 1 165 LYS n 1 166 CYS n 1 167 ILE n 1 168 HIS n 1 169 ARG n 1 170 ASP n 1 171 LEU n 1 172 ALA n 1 173 ALA n 1 174 ARG n 1 175 ASN n 1 176 VAL n 1 177 LEU n 1 178 VAL n 1 179 THR n 1 180 GLU n 1 181 ASP n 1 182 ASN n 1 183 VAL n 1 184 MET n 1 185 LYS n 1 186 ILE n 1 187 ALA n 1 188 ASP n 1 189 PHE n 1 190 GLY n 1 191 LEU n 1 192 ALA n 1 193 ARG n 1 194 GLY n 1 195 VAL n 1 196 HIS n 1 197 HIS n 1 198 ILE n 1 199 ASP n 1 200 TYR n 1 201 TYR n 1 202 LYS n 1 203 LYS n 1 204 THR n 1 205 SER n 1 206 ASN n 1 207 GLY n 1 208 ARG n 1 209 LEU n 1 210 PRO n 1 211 VAL n 1 212 LYS n 1 213 TRP n 1 214 MET n 1 215 ALA n 1 216 PRO n 1 217 GLU n 1 218 ALA n 1 219 LEU n 1 220 PHE n 1 221 ASP n 1 222 ARG n 1 223 VAL n 1 224 TYR n 1 225 THR n 1 226 HIS n 1 227 GLN n 1 228 SER n 1 229 ASP n 1 230 VAL n 1 231 TRP n 1 232 SER n 1 233 PHE n 1 234 GLY n 1 235 ILE n 1 236 LEU n 1 237 LEU n 1 238 TRP n 1 239 GLU n 1 240 ILE n 1 241 PHE n 1 242 THR n 1 243 LEU n 1 244 GLY n 1 245 GLY n 1 246 SER n 1 247 PRO n 1 248 TYR n 1 249 PRO n 1 250 GLY n 1 251 ILE n 1 252 PRO n 1 253 VAL n 1 254 GLU n 1 255 GLU n 1 256 LEU n 1 257 PHE n 1 258 SER n 1 259 LEU n 1 260 LEU n 1 261 ARG n 1 262 GLU n 1 263 GLY n 1 264 HIS n 1 265 ARG n 1 266 MET n 1 267 ASP n 1 268 ARG n 1 269 PRO n 1 270 PRO n 1 271 HIS n 1 272 CYS n 1 273 PRO n 1 274 PRO n 1 275 GLU n 1 276 LEU n 1 277 TYR n 1 278 GLY n 1 279 LEU n 1 280 MET n 1 281 ARG n 1 282 GLU n 1 283 CYS n 1 284 TRP n 1 285 HIS n 1 286 ALA n 1 287 ALA n 1 288 PRO n 1 289 SER n 1 290 GLN n 1 291 ARG n 1 292 PRO n 1 293 THR n 1 294 PHE n 1 295 LYS n 1 296 GLN n 1 297 LEU n 1 298 VAL n 1 299 GLU n 1 300 ALA n 1 301 LEU n 1 302 ASP n 1 303 LYS n 1 304 VAL n 1 305 LEU n 1 306 LEU n 1 307 ALA n 1 308 VAL n 1 309 SER n 1 310 GLU n 1 311 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 311 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FGFR4, JTK2, TKF' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6LF non-polymer . '2-[4-[E-2-[5-[(1R)-1-[3,5-bis(chloranyl)pyridin-4-yl]ethoxy]-1H-indazol-3-yl]ethenyl]pyrazol-1-yl]ethanol' LY2874455 'C21 H19 Cl2 N5 O2' 444.314 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 443 ? ? ? A . n A 1 2 PRO 2 444 ? ? ? A . n A 1 3 LEU 3 445 ? ? ? A . n A 1 4 LEU 4 446 ? ? ? A . n A 1 5 ALA 5 447 ? ? ? A . n A 1 6 GLY 6 448 ? ? ? A . n A 1 7 LEU 7 449 ? ? ? A . n A 1 8 VAL 8 450 ? ? ? A . n A 1 9 SER 9 451 ? ? ? A . n A 1 10 LEU 10 452 ? ? ? A . n A 1 11 ASP 11 453 453 ASP ASP A . n A 1 12 LEU 12 454 454 LEU LEU A . n A 1 13 PRO 13 455 455 PRO PRO A . n A 1 14 LEU 14 456 456 LEU LEU A . n A 1 15 ASP 15 457 457 ASP ASP A . n A 1 16 PRO 16 458 458 PRO PRO A . n A 1 17 LEU 17 459 459 LEU LEU A . n A 1 18 TRP 18 460 460 TRP TRP A . n A 1 19 GLU 19 461 461 GLU GLU A . n A 1 20 PHE 20 462 462 PHE PHE A . n A 1 21 PRO 21 463 463 PRO PRO A . n A 1 22 ARG 22 464 464 ARG ARG A . n A 1 23 ASP 23 465 465 ASP ASP A . n A 1 24 ARG 24 466 466 ARG ARG A . n A 1 25 LEU 25 467 467 LEU LEU A . n A 1 26 VAL 26 468 468 VAL VAL A . n A 1 27 LEU 27 469 469 LEU LEU A . n A 1 28 GLY 28 470 470 GLY GLY A . n A 1 29 LYS 29 471 471 LYS LYS A . n A 1 30 PRO 30 472 472 PRO PRO A . n A 1 31 LEU 31 473 473 LEU LEU A . n A 1 32 GLY 32 474 474 GLY GLY A . n A 1 33 GLU 33 475 475 GLU GLU A . n A 1 34 GLY 34 476 476 GLY GLY A . n A 1 35 ALA 35 477 477 ALA ALA A . n A 1 36 PHE 36 478 478 PHE PHE A . n A 1 37 GLY 37 479 479 GLY GLY A . n A 1 38 GLN 38 480 480 GLN GLN A . n A 1 39 VAL 39 481 481 VAL VAL A . n A 1 40 VAL 40 482 482 VAL VAL A . n A 1 41 ARG 41 483 483 ARG ARG A . n A 1 42 ALA 42 484 484 ALA ALA A . n A 1 43 GLU 43 485 485 GLU GLU A . n A 1 44 ALA 44 486 486 ALA ALA A . n A 1 45 PHE 45 487 487 PHE PHE A . n A 1 46 GLY 46 488 488 GLY GLY A . n A 1 47 MET 47 489 489 MET MET A . n A 1 48 ASP 48 490 490 ASP ASP A . n A 1 49 PRO 49 491 491 PRO PRO A . n A 1 50 ALA 50 492 492 ALA ALA A . n A 1 51 ARG 51 493 493 ARG ARG A . n A 1 52 PRO 52 494 494 PRO PRO A . n A 1 53 ASP 53 495 495 ASP ASP A . n A 1 54 GLN 54 496 496 GLN GLN A . n A 1 55 ALA 55 497 497 ALA ALA A . n A 1 56 SER 56 498 498 SER SER A . n A 1 57 THR 57 499 499 THR THR A . n A 1 58 VAL 58 500 500 VAL VAL A . n A 1 59 ALA 59 501 501 ALA ALA A . n A 1 60 VAL 60 502 502 VAL VAL A . n A 1 61 LYS 61 503 503 LYS LYS A . n A 1 62 MET 62 504 504 MET MET A . n A 1 63 LEU 63 505 505 LEU LEU A . n A 1 64 LYS 64 506 506 LYS LYS A . n A 1 65 ASP 65 507 507 ASP ASP A . n A 1 66 ASN 66 508 508 ASN ASN A . n A 1 67 ALA 67 509 509 ALA ALA A . n A 1 68 SER 68 510 510 SER SER A . n A 1 69 ASP 69 511 511 ASP ASP A . n A 1 70 LYS 70 512 512 LYS LYS A . n A 1 71 ASP 71 513 513 ASP ASP A . n A 1 72 LEU 72 514 514 LEU LEU A . n A 1 73 ALA 73 515 515 ALA ALA A . n A 1 74 ASP 74 516 516 ASP ASP A . n A 1 75 LEU 75 517 517 LEU LEU A . n A 1 76 VAL 76 518 518 VAL VAL A . n A 1 77 SER 77 519 519 SER SER A . n A 1 78 GLU 78 520 520 GLU GLU A . n A 1 79 MET 79 521 521 MET MET A . n A 1 80 GLU 80 522 522 GLU GLU A . n A 1 81 VAL 81 523 523 VAL VAL A . n A 1 82 MET 82 524 524 MET MET A . n A 1 83 LYS 83 525 525 LYS LYS A . n A 1 84 LEU 84 526 526 LEU LEU A . n A 1 85 ILE 85 527 527 ILE ILE A . n A 1 86 GLY 86 528 528 GLY GLY A . n A 1 87 ARG 87 529 529 ARG ARG A . n A 1 88 HIS 88 530 530 HIS HIS A . n A 1 89 LYS 89 531 531 LYS LYS A . n A 1 90 ASN 90 532 532 ASN ASN A . n A 1 91 ILE 91 533 533 ILE ILE A . n A 1 92 ILE 92 534 534 ILE ILE A . n A 1 93 ASN 93 535 535 ASN ASN A . n A 1 94 LEU 94 536 536 LEU LEU A . n A 1 95 LEU 95 537 537 LEU LEU A . n A 1 96 GLY 96 538 538 GLY GLY A . n A 1 97 VAL 97 539 539 VAL VAL A . n A 1 98 CYS 98 540 540 CYS CYS A . n A 1 99 THR 99 541 541 THR THR A . n A 1 100 GLN 100 542 542 GLN GLN A . n A 1 101 GLU 101 543 543 GLU GLU A . n A 1 102 GLY 102 544 544 GLY GLY A . n A 1 103 PRO 103 545 545 PRO PRO A . n A 1 104 LEU 104 546 546 LEU LEU A . n A 1 105 TYR 105 547 547 TYR TYR A . n A 1 106 VAL 106 548 548 VAL VAL A . n A 1 107 ILE 107 549 549 ILE ILE A . n A 1 108 LEU 108 550 550 LEU LEU A . n A 1 109 GLU 109 551 551 GLU GLU A . n A 1 110 CYS 110 552 552 CYS CYS A . n A 1 111 ALA 111 553 553 ALA ALA A . n A 1 112 ALA 112 554 554 ALA ALA A . n A 1 113 LYS 113 555 555 LYS LYS A . n A 1 114 GLY 114 556 556 GLY GLY A . n A 1 115 ASN 115 557 557 ASN ASN A . n A 1 116 LEU 116 558 558 LEU LEU A . n A 1 117 ARG 117 559 559 ARG ARG A . n A 1 118 GLU 118 560 560 GLU GLU A . n A 1 119 PHE 119 561 561 PHE PHE A . n A 1 120 LEU 120 562 562 LEU LEU A . n A 1 121 ARG 121 563 563 ARG ARG A . n A 1 122 ALA 122 564 564 ALA ALA A . n A 1 123 ARG 123 565 565 ARG ARG A . n A 1 124 ARG 124 566 566 ARG ARG A . n A 1 125 PRO 125 567 567 PRO PRO A . n A 1 126 PRO 126 568 568 PRO PRO A . n A 1 127 GLY 127 569 569 GLY GLY A . n A 1 128 PRO 128 570 570 PRO PRO A . n A 1 129 ASP 129 571 ? ? ? A . n A 1 130 LEU 130 572 ? ? ? A . n A 1 131 SER 131 573 ? ? ? A . n A 1 132 PRO 132 574 ? ? ? A . n A 1 133 ASP 133 575 ? ? ? A . n A 1 134 GLY 134 576 ? ? ? A . n A 1 135 PRO 135 577 ? ? ? A . n A 1 136 ARG 136 578 ? ? ? A . n A 1 137 SER 137 579 ? ? ? A . n A 1 138 SER 138 580 ? ? ? A . n A 1 139 GLU 139 581 ? ? ? A . n A 1 140 GLY 140 582 ? ? ? A . n A 1 141 PRO 141 583 583 PRO PRO A . n A 1 142 LEU 142 584 584 LEU LEU A . n A 1 143 SER 143 585 585 SER SER A . n A 1 144 PHE 144 586 586 PHE PHE A . n A 1 145 PRO 145 587 587 PRO PRO A . n A 1 146 VAL 146 588 588 VAL VAL A . n A 1 147 LEU 147 589 589 LEU LEU A . n A 1 148 VAL 148 590 590 VAL VAL A . n A 1 149 SER 149 591 591 SER SER A . n A 1 150 CYS 150 592 592 CYS CYS A . n A 1 151 ALA 151 593 593 ALA ALA A . n A 1 152 TYR 152 594 594 TYR TYR A . n A 1 153 GLN 153 595 595 GLN GLN A . n A 1 154 VAL 154 596 596 VAL VAL A . n A 1 155 ALA 155 597 597 ALA ALA A . n A 1 156 ARG 156 598 598 ARG ARG A . n A 1 157 GLY 157 599 599 GLY GLY A . n A 1 158 MET 158 600 600 MET MET A . n A 1 159 GLN 159 601 601 GLN GLN A . n A 1 160 TYR 160 602 602 TYR TYR A . n A 1 161 LEU 161 603 603 LEU LEU A . n A 1 162 GLU 162 604 604 GLU GLU A . n A 1 163 SER 163 605 605 SER SER A . n A 1 164 ARG 164 606 606 ARG ARG A . n A 1 165 LYS 165 607 607 LYS LYS A . n A 1 166 CYS 166 608 608 CYS CYS A . n A 1 167 ILE 167 609 609 ILE ILE A . n A 1 168 HIS 168 610 610 HIS HIS A . n A 1 169 ARG 169 611 611 ARG ARG A . n A 1 170 ASP 170 612 612 ASP ASP A . n A 1 171 LEU 171 613 613 LEU LEU A . n A 1 172 ALA 172 614 614 ALA ALA A . n A 1 173 ALA 173 615 615 ALA ALA A . n A 1 174 ARG 174 616 616 ARG ARG A . n A 1 175 ASN 175 617 617 ASN ASN A . n A 1 176 VAL 176 618 618 VAL VAL A . n A 1 177 LEU 177 619 619 LEU LEU A . n A 1 178 VAL 178 620 620 VAL VAL A . n A 1 179 THR 179 621 621 THR THR A . n A 1 180 GLU 180 622 622 GLU GLU A . n A 1 181 ASP 181 623 623 ASP ASP A . n A 1 182 ASN 182 624 624 ASN ASN A . n A 1 183 VAL 183 625 625 VAL VAL A . n A 1 184 MET 184 626 626 MET MET A . n A 1 185 LYS 185 627 627 LYS LYS A . n A 1 186 ILE 186 628 628 ILE ILE A . n A 1 187 ALA 187 629 629 ALA ALA A . n A 1 188 ASP 188 630 630 ASP ASP A . n A 1 189 PHE 189 631 631 PHE PHE A . n A 1 190 GLY 190 632 632 GLY GLY A . n A 1 191 LEU 191 633 633 LEU LEU A . n A 1 192 ALA 192 634 ? ? ? A . n A 1 193 ARG 193 635 ? ? ? A . n A 1 194 GLY 194 636 ? ? ? A . n A 1 195 VAL 195 637 ? ? ? A . n A 1 196 HIS 196 638 ? ? ? A . n A 1 197 HIS 197 639 ? ? ? A . n A 1 198 ILE 198 640 ? ? ? A . n A 1 199 ASP 199 641 ? ? ? A . n A 1 200 TYR 200 642 ? ? ? A . n A 1 201 TYR 201 643 ? ? ? A . n A 1 202 LYS 202 644 ? ? ? A . n A 1 203 LYS 203 645 ? ? ? A . n A 1 204 THR 204 646 ? ? ? A . n A 1 205 SER 205 647 ? ? ? A . n A 1 206 ASN 206 648 ? ? ? A . n A 1 207 GLY 207 649 ? ? ? A . n A 1 208 ARG 208 650 ? ? ? A . n A 1 209 LEU 209 651 651 LEU LEU A . n A 1 210 PRO 210 652 652 PRO PRO A . n A 1 211 VAL 211 653 653 VAL VAL A . n A 1 212 LYS 212 654 654 LYS LYS A . n A 1 213 TRP 213 655 655 TRP TRP A . n A 1 214 MET 214 656 656 MET MET A . n A 1 215 ALA 215 657 657 ALA ALA A . n A 1 216 PRO 216 658 658 PRO PRO A . n A 1 217 GLU 217 659 659 GLU GLU A . n A 1 218 ALA 218 660 660 ALA ALA A . n A 1 219 LEU 219 661 661 LEU LEU A . n A 1 220 PHE 220 662 662 PHE PHE A . n A 1 221 ASP 221 663 663 ASP ASP A . n A 1 222 ARG 222 664 664 ARG ARG A . n A 1 223 VAL 223 665 665 VAL VAL A . n A 1 224 TYR 224 666 666 TYR TYR A . n A 1 225 THR 225 667 667 THR THR A . n A 1 226 HIS 226 668 668 HIS HIS A . n A 1 227 GLN 227 669 669 GLN GLN A . n A 1 228 SER 228 670 670 SER SER A . n A 1 229 ASP 229 671 671 ASP ASP A . n A 1 230 VAL 230 672 672 VAL VAL A . n A 1 231 TRP 231 673 673 TRP TRP A . n A 1 232 SER 232 674 674 SER SER A . n A 1 233 PHE 233 675 675 PHE PHE A . n A 1 234 GLY 234 676 676 GLY GLY A . n A 1 235 ILE 235 677 677 ILE ILE A . n A 1 236 LEU 236 678 678 LEU LEU A . n A 1 237 LEU 237 679 679 LEU LEU A . n A 1 238 TRP 238 680 680 TRP TRP A . n A 1 239 GLU 239 681 681 GLU GLU A . n A 1 240 ILE 240 682 682 ILE ILE A . n A 1 241 PHE 241 683 683 PHE PHE A . n A 1 242 THR 242 684 684 THR THR A . n A 1 243 LEU 243 685 685 LEU LEU A . n A 1 244 GLY 244 686 686 GLY GLY A . n A 1 245 GLY 245 687 687 GLY GLY A . n A 1 246 SER 246 688 688 SER SER A . n A 1 247 PRO 247 689 689 PRO PRO A . n A 1 248 TYR 248 690 690 TYR TYR A . n A 1 249 PRO 249 691 691 PRO PRO A . n A 1 250 GLY 250 692 692 GLY GLY A . n A 1 251 ILE 251 693 693 ILE ILE A . n A 1 252 PRO 252 694 694 PRO PRO A . n A 1 253 VAL 253 695 695 VAL VAL A . n A 1 254 GLU 254 696 696 GLU GLU A . n A 1 255 GLU 255 697 697 GLU GLU A . n A 1 256 LEU 256 698 698 LEU LEU A . n A 1 257 PHE 257 699 699 PHE PHE A . n A 1 258 SER 258 700 700 SER SER A . n A 1 259 LEU 259 701 701 LEU LEU A . n A 1 260 LEU 260 702 702 LEU LEU A . n A 1 261 ARG 261 703 703 ARG ARG A . n A 1 262 GLU 262 704 704 GLU GLU A . n A 1 263 GLY 263 705 705 GLY GLY A . n A 1 264 HIS 264 706 706 HIS HIS A . n A 1 265 ARG 265 707 707 ARG ARG A . n A 1 266 MET 266 708 708 MET MET A . n A 1 267 ASP 267 709 709 ASP ASP A . n A 1 268 ARG 268 710 710 ARG ARG A . n A 1 269 PRO 269 711 711 PRO PRO A . n A 1 270 PRO 270 712 712 PRO PRO A . n A 1 271 HIS 271 713 713 HIS HIS A . n A 1 272 CYS 272 714 714 CYS CYS A . n A 1 273 PRO 273 715 715 PRO PRO A . n A 1 274 PRO 274 716 716 PRO PRO A . n A 1 275 GLU 275 717 717 GLU GLU A . n A 1 276 LEU 276 718 718 LEU LEU A . n A 1 277 TYR 277 719 719 TYR TYR A . n A 1 278 GLY 278 720 720 GLY GLY A . n A 1 279 LEU 279 721 721 LEU LEU A . n A 1 280 MET 280 722 722 MET MET A . n A 1 281 ARG 281 723 723 ARG ARG A . n A 1 282 GLU 282 724 724 GLU GLU A . n A 1 283 CYS 283 725 725 CYS CYS A . n A 1 284 TRP 284 726 726 TRP TRP A . n A 1 285 HIS 285 727 727 HIS HIS A . n A 1 286 ALA 286 728 728 ALA ALA A . n A 1 287 ALA 287 729 729 ALA ALA A . n A 1 288 PRO 288 730 730 PRO PRO A . n A 1 289 SER 289 731 731 SER SER A . n A 1 290 GLN 290 732 732 GLN GLN A . n A 1 291 ARG 291 733 733 ARG ARG A . n A 1 292 PRO 292 734 734 PRO PRO A . n A 1 293 THR 293 735 735 THR THR A . n A 1 294 PHE 294 736 736 PHE PHE A . n A 1 295 LYS 295 737 737 LYS LYS A . n A 1 296 GLN 296 738 738 GLN GLN A . n A 1 297 LEU 297 739 739 LEU LEU A . n A 1 298 VAL 298 740 740 VAL VAL A . n A 1 299 GLU 299 741 741 GLU GLU A . n A 1 300 ALA 300 742 742 ALA ALA A . n A 1 301 LEU 301 743 743 LEU LEU A . n A 1 302 ASP 302 744 744 ASP ASP A . n A 1 303 LYS 303 745 745 LYS LYS A . n A 1 304 VAL 304 746 746 VAL VAL A . n A 1 305 LEU 305 747 747 LEU LEU A . n A 1 306 LEU 306 748 748 LEU LEU A . n A 1 307 ALA 307 749 749 ALA ALA A . n A 1 308 VAL 308 750 750 VAL VAL A . n A 1 309 SER 309 751 ? ? ? A . n A 1 310 GLU 310 752 ? ? ? A . n A 1 311 GLU 311 753 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 6LF 1 801 801 6LF 6LF A . C 3 HOH 1 901 5 HOH HOH A . C 3 HOH 2 902 4 HOH HOH A . C 3 HOH 3 903 3 HOH HOH A . C 3 HOH 4 904 2 HOH HOH A . C 3 HOH 5 905 1 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5XFF _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.291 _cell.length_a_esd ? _cell.length_b 62.291 _cell.length_b_esd ? _cell.length_c 184.586 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5XFF _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XFF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.32 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.65 M NH4H2PO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5XFF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.70 _reflns.d_resolution_low 39.75 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10635 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 26.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 29.63 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5XFF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.700 _refine.ls_d_res_low 39.75 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10547 _refine.ls_number_reflns_R_free 1053 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.05 _refine.ls_percent_reflns_R_free 9.98 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2704 _refine.ls_R_factor_R_free 0.3197 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2652 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.54 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.41 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2123 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 2158 _refine_hist.d_res_high 2.700 _refine_hist.d_res_low 39.75 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 2210 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.846 ? 2998 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.015 ? 1334 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.044 ? 326 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 385 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7005 2.8234 . . 128 1150 99.00 . . . 0.3947 . 0.3214 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8234 2.9722 . . 128 1161 100.00 . . . 0.3370 . 0.3153 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9722 3.1583 . . 129 1171 100.00 . . . 0.3420 . 0.3017 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1583 3.4020 . . 130 1174 100.00 . . . 0.3690 . 0.2984 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4020 3.7442 . . 125 1130 96.00 . . . 0.3471 . 0.3147 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7442 4.2854 . . 130 1169 98.00 . . . 0.2802 . 0.2502 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2854 5.3970 . . 136 1223 100.00 . . . 0.3025 . 0.2369 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.3970 39.7557 . . 147 1316 100.00 . . . 0.3183 . 0.2511 . . . . . . . . . . # _struct.entry_id 5XFF _struct.title 'Crystal structure of LY2874455 in complex of FGFR4 gatekeeper mutation (V550L)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XFF _struct_keywords.text 'inhibitor, kinase, gatekeeper, mutation, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FGFR4_HUMAN _struct_ref.pdbx_db_accession P22455 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVM KLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQYLE SRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFT LGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE ; _struct_ref.pdbx_align_begin 445 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XFF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 311 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22455 _struct_ref_seq.db_align_beg 445 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 753 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 445 _struct_ref_seq.pdbx_auth_seq_align_end 753 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5XFF GLY A 1 ? UNP P22455 ? ? 'expression tag' 443 1 1 5XFF PRO A 2 ? UNP P22455 ? ? 'expression tag' 444 2 1 5XFF ALA A 35 ? UNP P22455 CYS 477 conflict 477 3 1 5XFF LEU A 108 ? UNP P22455 VAL 550 'engineered mutation' 550 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13930 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 21 ? ASP A 23 ? PRO A 463 ASP A 465 5 ? 3 HELX_P HELX_P2 AA2 ASP A 71 ? GLY A 86 ? ASP A 513 GLY A 528 1 ? 16 HELX_P HELX_P3 AA3 ASN A 115 ? ARG A 123 ? ASN A 557 ARG A 565 1 ? 9 HELX_P HELX_P4 AA4 SER A 143 ? ARG A 164 ? SER A 585 ARG A 606 1 ? 22 HELX_P HELX_P5 AA5 ALA A 172 ? ARG A 174 ? ALA A 614 ARG A 616 5 ? 3 HELX_P HELX_P6 AA6 PRO A 210 ? MET A 214 ? PRO A 652 MET A 656 5 ? 5 HELX_P HELX_P7 AA7 ALA A 215 ? PHE A 220 ? ALA A 657 PHE A 662 1 ? 6 HELX_P HELX_P8 AA8 THR A 225 ? THR A 242 ? THR A 667 THR A 684 1 ? 18 HELX_P HELX_P9 AA9 GLU A 255 ? GLU A 262 ? GLU A 697 GLU A 704 1 ? 8 HELX_P HELX_P10 AB1 PRO A 273 ? TRP A 284 ? PRO A 715 TRP A 726 1 ? 12 HELX_P HELX_P11 AB2 ALA A 287 ? ARG A 291 ? ALA A 729 ARG A 733 5 ? 5 HELX_P HELX_P12 AB3 THR A 293 ? ALA A 307 ? THR A 735 ALA A 749 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 12 A . ? LEU 454 A PRO 13 A ? PRO 455 A 1 -11.02 2 GLU 33 A . ? GLU 475 A GLY 34 A ? GLY 476 A 1 -1.08 3 SER 68 A . ? SER 510 A ASP 69 A ? ASP 511 A 1 14.58 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 25 ? GLY A 32 ? LEU A 467 GLY A 474 AA1 2 GLN A 38 ? ALA A 44 ? GLN A 480 ALA A 486 AA1 3 THR A 57 ? MET A 62 ? THR A 499 MET A 504 AA1 4 TYR A 105 ? LEU A 108 ? TYR A 547 LEU A 550 AA1 5 LEU A 94 ? CYS A 98 ? LEU A 536 CYS A 540 AA2 1 VAL A 176 ? VAL A 178 ? VAL A 618 VAL A 620 AA2 2 MET A 184 ? ILE A 186 ? MET A 626 ILE A 628 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 26 ? N VAL A 468 O GLU A 43 ? O GLU A 485 AA1 2 3 N VAL A 40 ? N VAL A 482 O VAL A 60 ? O VAL A 502 AA1 3 4 N ALA A 59 ? N ALA A 501 O LEU A 108 ? O LEU A 550 AA1 4 5 O ILE A 107 ? O ILE A 549 N GLY A 96 ? N GLY A 538 AA2 1 2 N LEU A 177 ? N LEU A 619 O LYS A 185 ? O LYS A 627 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 6LF _struct_site.pdbx_auth_seq_id 801 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'binding site for residue 6LF A 801' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 LEU A 31 ? LEU A 473 . ? 1_555 ? 2 AC1 10 ALA A 59 ? ALA A 501 . ? 1_555 ? 3 AC1 10 GLU A 109 ? GLU A 551 . ? 1_555 ? 4 AC1 10 CYS A 110 ? CYS A 552 . ? 1_555 ? 5 AC1 10 ALA A 111 ? ALA A 553 . ? 1_555 ? 6 AC1 10 GLY A 114 ? GLY A 556 . ? 1_555 ? 7 AC1 10 ASN A 115 ? ASN A 557 . ? 1_555 ? 8 AC1 10 GLU A 118 ? GLU A 560 . ? 1_555 ? 9 AC1 10 ARG A 174 ? ARG A 616 . ? 1_555 ? 10 AC1 10 LEU A 177 ? LEU A 619 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 631 ? ? O A HOH 901 ? ? 1.82 2 1 OH A TYR 594 ? ? NH1 A ARG 598 ? ? 2.08 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 507 ? ? CA A ASP 507 ? ? C A ASP 507 ? ? 88.21 110.40 -22.19 2.00 N 2 1 N A ASP 507 ? ? CA A ASP 507 ? ? C A ASP 507 ? ? 131.45 111.00 20.45 2.70 N 3 1 N A ASN 508 ? ? CA A ASN 508 ? ? C A ASN 508 ? ? 70.66 111.00 -40.34 2.70 N 4 1 N A ALA 509 ? ? CA A ALA 509 ? ? CB A ALA 509 ? ? 120.38 110.10 10.28 1.40 N 5 1 CB A SER 510 ? ? CA A SER 510 ? ? C A SER 510 ? ? 127.25 110.10 17.15 1.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 454 ? ? -173.00 139.89 2 1 PRO A 455 ? ? -119.65 -114.29 3 1 TRP A 460 ? ? -141.25 -18.99 4 1 ALA A 477 ? ? 78.07 -13.71 5 1 ASP A 507 ? ? 123.96 -23.09 6 1 LYS A 512 ? ? 108.14 -8.25 7 1 ASP A 612 ? ? -51.86 -79.68 8 1 ASP A 630 ? ? 71.12 141.83 9 1 TYR A 690 ? ? 37.71 59.14 10 1 GLU A 696 ? ? -88.12 -71.66 11 1 ALA A 749 ? ? -63.31 86.36 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 59.6061 35.3701 575.7559 2.4231 1.0175 0.5709 -0.3080 0.7431 0.1826 2.1964 1.0392 5.6757 -0.6900 -2.8551 2.1798 1.0315 0.1441 0.2537 3.7528 0.0074 0.2922 -0.0882 -1.7242 0.5241 'X-RAY DIFFRACTION' 2 ? refined 66.2245 49.4526 568.8871 1.3234 0.8753 1.0884 0.0212 0.0938 0.0345 4.4757 5.0129 3.9146 1.3994 -1.0965 0.2318 0.9297 0.1023 1.8773 0.2295 -0.5147 1.3913 -1.4397 -1.0911 -0.4251 'X-RAY DIFFRACTION' 3 ? refined 71.0703 44.4810 573.6513 1.7699 0.7179 1.0343 -0.3862 0.1815 -0.0423 4.0874 6.4751 6.6072 1.1545 -2.8185 -1.1502 1.2958 -0.9884 -0.3596 3.3767 -1.6306 -0.7932 -2.4870 1.9339 -0.1086 'X-RAY DIFFRACTION' 4 ? refined 50.6658 47.7642 560.1221 1.3137 2.6263 2.4326 -0.2047 -0.0619 -0.3554 1.8787 1.3388 2.9842 1.5521 1.9182 1.4544 -0.6234 -0.5550 -2.1076 -0.7190 0.3275 0.1787 1.5925 -0.4735 -0.7550 'X-RAY DIFFRACTION' 5 ? refined 59.3849 35.3525 563.7618 0.8416 0.8765 1.3956 -0.2851 0.1626 0.0587 5.0381 4.1381 7.0754 -0.8583 -0.8742 1.3608 -0.2730 1.2380 -0.7873 -0.1603 0.7631 2.2949 1.0288 -0.4818 -0.3408 'X-RAY DIFFRACTION' 6 ? refined 66.5164 38.2580 568.9003 1.1310 0.3737 0.5191 -0.1175 0.1049 0.0782 5.7519 3.0685 6.6310 0.6189 0.1989 1.8303 -0.1984 -0.9960 -0.8681 1.4939 -0.2216 0.7235 0.0512 0.1044 0.0080 'X-RAY DIFFRACTION' 7 ? refined 82.2652 48.0142 552.4819 1.1081 0.7525 1.1225 -0.2624 0.1533 0.1408 9.0540 4.2520 4.8596 1.1631 -1.4012 -1.6982 0.7853 0.3171 1.9532 0.6161 -0.2431 -0.1725 -0.5462 -0.0853 -0.1607 'X-RAY DIFFRACTION' 8 ? refined 81.0760 32.8603 552.1084 0.5827 0.6126 0.7566 0.0244 -0.0794 0.0849 4.4958 2.9638 4.8680 1.1793 -1.5605 0.1701 -0.5033 0.6931 -0.0083 0.0451 0.3928 -0.8761 0.1162 0.5333 0.2134 'X-RAY DIFFRACTION' 9 ? refined 65.9516 32.2453 551.8189 1.2511 1.5404 1.5615 -0.1645 0.0776 -0.1300 0.7691 3.5676 0.6927 1.7106 -0.7025 -0.8189 -0.2099 0.7522 0.6638 -1.7889 1.3916 4.0940 0.0290 -1.5958 0.4495 'X-RAY DIFFRACTION' 10 ? refined 75.0682 39.4356 557.0709 0.7802 0.8257 0.8225 -0.2412 0.0342 0.1596 3.8749 6.8993 4.8435 -3.7257 -3.7218 0.8333 0.1236 -0.5714 0.7171 0.0076 0.0705 0.4833 -0.1177 -0.9782 -0.1873 'X-RAY DIFFRACTION' 11 ? refined 65.4577 39.7050 539.4409 0.9792 1.5070 0.9053 0.4549 0.0220 0.4474 4.9970 3.9482 4.0550 2.7039 2.1663 2.1493 -0.9214 -0.1210 1.1066 -0.6088 0.1273 1.6740 0.1864 0.9397 0.3638 'X-RAY DIFFRACTION' 12 ? refined 70.3573 34.7789 541.8350 0.7637 0.9969 0.6818 0.0544 -0.0254 0.1405 7.3442 7.1394 4.2121 -0.3898 -0.5054 -1.0506 0.9148 0.5307 -0.8248 -0.1041 -0.1714 0.3506 -0.0486 -1.0811 -0.6557 'X-RAY DIFFRACTION' 13 ? refined 73.6793 47.1593 535.8023 1.4843 0.9247 1.4580 0.2817 0.0436 1.0775 5.9839 5.2743 2.0428 0.1177 -6.7183 1.4711 0.8361 2.9526 3.0095 1.5165 -0.2203 2.4763 -3.4466 -2.6769 -1.2177 'X-RAY DIFFRACTION' 14 ? refined 77.0483 34.1917 534.1367 0.9138 1.0414 0.6869 0.1513 0.0164 0.1426 5.8395 4.6578 3.9595 -1.7226 1.6777 0.4562 0.5186 1.1452 -0.0899 -0.2374 -0.4702 -0.5205 -0.5779 0.3014 0.2237 'X-RAY DIFFRACTION' 15 ? refined 84.6938 25.7707 547.8537 0.8747 0.6057 0.5765 -0.0381 -0.1252 0.1754 7.3190 1.4619 2.6632 -1.2599 -0.1052 -0.4045 1.4750 0.1525 -0.8967 0.3841 -1.1764 -0.3771 0.2834 0.4348 -0.0788 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 453 through 463 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 464 through 480 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 481 through 507 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 508 through 513 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 514 through 527 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 528 through 550 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 551 through 570 ) ; 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 583 through 605 ) ; 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 606 through 614 ) ; 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 615 through 633 ) ; 'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 651 through 661 ) ; 'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 662 through 683 ) ; 'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 684 through 697 ) ; 'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 698 through 735 ) ; 'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 736 through 750 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 443 ? A GLY 1 2 1 Y 1 A PRO 444 ? A PRO 2 3 1 Y 1 A LEU 445 ? A LEU 3 4 1 Y 1 A LEU 446 ? A LEU 4 5 1 Y 1 A ALA 447 ? A ALA 5 6 1 Y 1 A GLY 448 ? A GLY 6 7 1 Y 1 A LEU 449 ? A LEU 7 8 1 Y 1 A VAL 450 ? A VAL 8 9 1 Y 1 A SER 451 ? A SER 9 10 1 Y 1 A LEU 452 ? A LEU 10 11 1 Y 1 A ASP 571 ? A ASP 129 12 1 Y 1 A LEU 572 ? A LEU 130 13 1 Y 1 A SER 573 ? A SER 131 14 1 Y 1 A PRO 574 ? A PRO 132 15 1 Y 1 A ASP 575 ? A ASP 133 16 1 Y 1 A GLY 576 ? A GLY 134 17 1 Y 1 A PRO 577 ? A PRO 135 18 1 Y 1 A ARG 578 ? A ARG 136 19 1 Y 1 A SER 579 ? A SER 137 20 1 Y 1 A SER 580 ? A SER 138 21 1 Y 1 A GLU 581 ? A GLU 139 22 1 Y 1 A GLY 582 ? A GLY 140 23 1 Y 1 A ALA 634 ? A ALA 192 24 1 Y 1 A ARG 635 ? A ARG 193 25 1 Y 1 A GLY 636 ? A GLY 194 26 1 Y 1 A VAL 637 ? A VAL 195 27 1 Y 1 A HIS 638 ? A HIS 196 28 1 Y 1 A HIS 639 ? A HIS 197 29 1 Y 1 A ILE 640 ? A ILE 198 30 1 Y 1 A ASP 641 ? A ASP 199 31 1 Y 1 A TYR 642 ? A TYR 200 32 1 Y 1 A TYR 643 ? A TYR 201 33 1 Y 1 A LYS 644 ? A LYS 202 34 1 Y 1 A LYS 645 ? A LYS 203 35 1 Y 1 A THR 646 ? A THR 204 36 1 Y 1 A SER 647 ? A SER 205 37 1 Y 1 A ASN 648 ? A ASN 206 38 1 Y 1 A GLY 649 ? A GLY 207 39 1 Y 1 A ARG 650 ? A ARG 208 40 1 Y 1 A SER 751 ? A SER 309 41 1 Y 1 A GLU 752 ? A GLU 310 42 1 Y 1 A GLU 753 ? A GLU 311 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 6LF CAJ C Y N 1 6LF CAK C N R 2 6LF CAL C Y N 3 6LF CAM C Y N 4 6LF CAN C Y N 5 6LF CAO C Y N 6 6LF CAP C Y N 7 6LF CAQ C Y N 8 6LF CAR C Y N 9 6LF CAS C N N 10 6LF CAT C N N 11 6LF CAU C Y N 12 6LF CAV C N N 13 6LF CAW C N N 14 6LF CAX C Y N 15 6LF CAY C Y N 16 6LF CAZ C Y N 17 6LF NAE N Y N 18 6LF NAF N Y N 19 6LF NAG N Y N 20 6LF NAH N Y N 21 6LF NAI N Y N 22 6LF OAC O N N 23 6LF OAD O N N 24 6LF CBA C Y N 25 6LF CBB C N N 26 6LF CBC C Y N 27 6LF CBD C Y N 28 6LF CL1 CL N N 29 6LF CL2 CL N N 30 6LF H1 H N N 31 6LF H2 H N N 32 6LF H3 H N N 33 6LF H4 H N N 34 6LF H5 H N N 35 6LF H6 H N N 36 6LF H7 H N N 37 6LF H8 H N N 38 6LF H10 H N N 39 6LF H12 H N N 40 6LF H13 H N N 41 6LF H14 H N N 42 6LF H15 H N N 43 6LF H16 H N N 44 6LF H17 H N N 45 6LF H18 H N N 46 6LF H19 H N N 47 6LF H9 H N N 48 6LF H11 H N N 49 ALA N N N N 50 ALA CA C N S 51 ALA C C N N 52 ALA O O N N 53 ALA CB C N N 54 ALA OXT O N N 55 ALA H H N N 56 ALA H2 H N N 57 ALA HA H N N 58 ALA HB1 H N N 59 ALA HB2 H N N 60 ALA HB3 H N N 61 ALA HXT H N N 62 ARG N N N N 63 ARG CA C N S 64 ARG C C N N 65 ARG O O N N 66 ARG CB C N N 67 ARG CG C N N 68 ARG CD C N N 69 ARG NE N N N 70 ARG CZ C N N 71 ARG NH1 N N N 72 ARG NH2 N N N 73 ARG OXT O N N 74 ARG H H N N 75 ARG H2 H N N 76 ARG HA H N N 77 ARG HB2 H N N 78 ARG HB3 H N N 79 ARG HG2 H N N 80 ARG HG3 H N N 81 ARG HD2 H N N 82 ARG HD3 H N N 83 ARG HE H N N 84 ARG HH11 H N N 85 ARG HH12 H N N 86 ARG HH21 H N N 87 ARG HH22 H N N 88 ARG HXT H N N 89 ASN N N N N 90 ASN CA C N S 91 ASN C C N N 92 ASN O O N N 93 ASN CB C N N 94 ASN CG C N N 95 ASN OD1 O N N 96 ASN ND2 N N N 97 ASN OXT O N N 98 ASN H H N N 99 ASN H2 H N N 100 ASN HA H N N 101 ASN HB2 H N N 102 ASN HB3 H N N 103 ASN HD21 H N N 104 ASN HD22 H N N 105 ASN HXT H N N 106 ASP N N N N 107 ASP CA C N S 108 ASP C C N N 109 ASP O O N N 110 ASP CB C N N 111 ASP CG C N N 112 ASP OD1 O N N 113 ASP OD2 O N N 114 ASP OXT O N N 115 ASP H H N N 116 ASP H2 H N N 117 ASP HA H N N 118 ASP HB2 H N N 119 ASP HB3 H N N 120 ASP HD2 H N N 121 ASP HXT H N N 122 CYS N N N N 123 CYS CA C N R 124 CYS C C N N 125 CYS O O N N 126 CYS CB C N N 127 CYS SG S N N 128 CYS OXT O N N 129 CYS H H N N 130 CYS H2 H N N 131 CYS HA H N N 132 CYS HB2 H N N 133 CYS HB3 H N N 134 CYS HG H N N 135 CYS HXT H N N 136 GLN N N N N 137 GLN CA C N S 138 GLN C C N N 139 GLN O O N N 140 GLN CB C N N 141 GLN CG C N N 142 GLN CD C N N 143 GLN OE1 O N N 144 GLN NE2 N N N 145 GLN OXT O N N 146 GLN H H N N 147 GLN H2 H N N 148 GLN HA H N N 149 GLN HB2 H N N 150 GLN HB3 H N N 151 GLN HG2 H N N 152 GLN HG3 H N N 153 GLN HE21 H N N 154 GLN HE22 H N N 155 GLN HXT H N N 156 GLU N N N N 157 GLU CA C N S 158 GLU C C N N 159 GLU O O N N 160 GLU CB C N N 161 GLU CG C N N 162 GLU CD C N N 163 GLU OE1 O N N 164 GLU OE2 O N N 165 GLU OXT O N N 166 GLU H H N N 167 GLU H2 H N N 168 GLU HA H N N 169 GLU HB2 H N N 170 GLU HB3 H N N 171 GLU HG2 H N N 172 GLU HG3 H N N 173 GLU HE2 H N N 174 GLU HXT H N N 175 GLY N N N N 176 GLY CA C N N 177 GLY C C N N 178 GLY O O N N 179 GLY OXT O N N 180 GLY H H N N 181 GLY H2 H N N 182 GLY HA2 H N N 183 GLY HA3 H N N 184 GLY HXT H N N 185 HIS N N N N 186 HIS CA C N S 187 HIS C C N N 188 HIS O O N N 189 HIS CB C N N 190 HIS CG C Y N 191 HIS ND1 N Y N 192 HIS CD2 C Y N 193 HIS CE1 C Y N 194 HIS NE2 N Y N 195 HIS OXT O N N 196 HIS H H N N 197 HIS H2 H N N 198 HIS HA H N N 199 HIS HB2 H N N 200 HIS HB3 H N N 201 HIS HD1 H N N 202 HIS HD2 H N N 203 HIS HE1 H N N 204 HIS HE2 H N N 205 HIS HXT H N N 206 HOH O O N N 207 HOH H1 H N N 208 HOH H2 H N N 209 ILE N N N N 210 ILE CA C N S 211 ILE C C N N 212 ILE O O N N 213 ILE CB C N S 214 ILE CG1 C N N 215 ILE CG2 C N N 216 ILE CD1 C N N 217 ILE OXT O N N 218 ILE H H N N 219 ILE H2 H N N 220 ILE HA H N N 221 ILE HB H N N 222 ILE HG12 H N N 223 ILE HG13 H N N 224 ILE HG21 H N N 225 ILE HG22 H N N 226 ILE HG23 H N N 227 ILE HD11 H N N 228 ILE HD12 H N N 229 ILE HD13 H N N 230 ILE HXT H N N 231 LEU N N N N 232 LEU CA C N S 233 LEU C C N N 234 LEU O O N N 235 LEU CB C N N 236 LEU CG C N N 237 LEU CD1 C N N 238 LEU CD2 C N N 239 LEU OXT O N N 240 LEU H H N N 241 LEU H2 H N N 242 LEU HA H N N 243 LEU HB2 H N N 244 LEU HB3 H N N 245 LEU HG H N N 246 LEU HD11 H N N 247 LEU HD12 H N N 248 LEU HD13 H N N 249 LEU HD21 H N N 250 LEU HD22 H N N 251 LEU HD23 H N N 252 LEU HXT H N N 253 LYS N N N N 254 LYS CA C N S 255 LYS C C N N 256 LYS O O N N 257 LYS CB C N N 258 LYS CG C N N 259 LYS CD C N N 260 LYS CE C N N 261 LYS NZ N N N 262 LYS OXT O N N 263 LYS H H N N 264 LYS H2 H N N 265 LYS HA H N N 266 LYS HB2 H N N 267 LYS HB3 H N N 268 LYS HG2 H N N 269 LYS HG3 H N N 270 LYS HD2 H N N 271 LYS HD3 H N N 272 LYS HE2 H N N 273 LYS HE3 H N N 274 LYS HZ1 H N N 275 LYS HZ2 H N N 276 LYS HZ3 H N N 277 LYS HXT H N N 278 MET N N N N 279 MET CA C N S 280 MET C C N N 281 MET O O N N 282 MET CB C N N 283 MET CG C N N 284 MET SD S N N 285 MET CE C N N 286 MET OXT O N N 287 MET H H N N 288 MET H2 H N N 289 MET HA H N N 290 MET HB2 H N N 291 MET HB3 H N N 292 MET HG2 H N N 293 MET HG3 H N N 294 MET HE1 H N N 295 MET HE2 H N N 296 MET HE3 H N N 297 MET HXT H N N 298 PHE N N N N 299 PHE CA C N S 300 PHE C C N N 301 PHE O O N N 302 PHE CB C N N 303 PHE CG C Y N 304 PHE CD1 C Y N 305 PHE CD2 C Y N 306 PHE CE1 C Y N 307 PHE CE2 C Y N 308 PHE CZ C Y N 309 PHE OXT O N N 310 PHE H H N N 311 PHE H2 H N N 312 PHE HA H N N 313 PHE HB2 H N N 314 PHE HB3 H N N 315 PHE HD1 H N N 316 PHE HD2 H N N 317 PHE HE1 H N N 318 PHE HE2 H N N 319 PHE HZ H N N 320 PHE HXT H N N 321 PRO N N N N 322 PRO CA C N S 323 PRO C C N N 324 PRO O O N N 325 PRO CB C N N 326 PRO CG C N N 327 PRO CD C N N 328 PRO OXT O N N 329 PRO H H N N 330 PRO HA H N N 331 PRO HB2 H N N 332 PRO HB3 H N N 333 PRO HG2 H N N 334 PRO HG3 H N N 335 PRO HD2 H N N 336 PRO HD3 H N N 337 PRO HXT H N N 338 SER N N N N 339 SER CA C N S 340 SER C C N N 341 SER O O N N 342 SER CB C N N 343 SER OG O N N 344 SER OXT O N N 345 SER H H N N 346 SER H2 H N N 347 SER HA H N N 348 SER HB2 H N N 349 SER HB3 H N N 350 SER HG H N N 351 SER HXT H N N 352 THR N N N N 353 THR CA C N S 354 THR C C N N 355 THR O O N N 356 THR CB C N R 357 THR OG1 O N N 358 THR CG2 C N N 359 THR OXT O N N 360 THR H H N N 361 THR H2 H N N 362 THR HA H N N 363 THR HB H N N 364 THR HG1 H N N 365 THR HG21 H N N 366 THR HG22 H N N 367 THR HG23 H N N 368 THR HXT H N N 369 TRP N N N N 370 TRP CA C N S 371 TRP C C N N 372 TRP O O N N 373 TRP CB C N N 374 TRP CG C Y N 375 TRP CD1 C Y N 376 TRP CD2 C Y N 377 TRP NE1 N Y N 378 TRP CE2 C Y N 379 TRP CE3 C Y N 380 TRP CZ2 C Y N 381 TRP CZ3 C Y N 382 TRP CH2 C Y N 383 TRP OXT O N N 384 TRP H H N N 385 TRP H2 H N N 386 TRP HA H N N 387 TRP HB2 H N N 388 TRP HB3 H N N 389 TRP HD1 H N N 390 TRP HE1 H N N 391 TRP HE3 H N N 392 TRP HZ2 H N N 393 TRP HZ3 H N N 394 TRP HH2 H N N 395 TRP HXT H N N 396 TYR N N N N 397 TYR CA C N S 398 TYR C C N N 399 TYR O O N N 400 TYR CB C N N 401 TYR CG C Y N 402 TYR CD1 C Y N 403 TYR CD2 C Y N 404 TYR CE1 C Y N 405 TYR CE2 C Y N 406 TYR CZ C Y N 407 TYR OH O N N 408 TYR OXT O N N 409 TYR H H N N 410 TYR H2 H N N 411 TYR HA H N N 412 TYR HB2 H N N 413 TYR HB3 H N N 414 TYR HD1 H N N 415 TYR HD2 H N N 416 TYR HE1 H N N 417 TYR HE2 H N N 418 TYR HH H N N 419 TYR HXT H N N 420 VAL N N N N 421 VAL CA C N S 422 VAL C C N N 423 VAL O O N N 424 VAL CB C N N 425 VAL CG1 C N N 426 VAL CG2 C N N 427 VAL OXT O N N 428 VAL H H N N 429 VAL H2 H N N 430 VAL HA H N N 431 VAL HB H N N 432 VAL HG11 H N N 433 VAL HG12 H N N 434 VAL HG13 H N N 435 VAL HG21 H N N 436 VAL HG22 H N N 437 VAL HG23 H N N 438 VAL HXT H N N 439 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 6LF NAI CBC doub Y N 1 6LF NAI CBD sing Y N 2 6LF CBC CAY sing Y N 3 6LF CBD CAZ doub Y N 4 6LF CAY CL1 sing N N 5 6LF CAY CAP doub Y N 6 6LF CAZ CAP sing Y N 7 6LF CAZ CL2 sing N N 8 6LF CAP CAK sing N N 9 6LF CAS CAK sing N N 10 6LF CAK OAC sing N N 11 6LF OAC CAM sing N N 12 6LF CBA NAH doub Y N 13 6LF CBA CAU sing Y N 14 6LF NAH NAG sing Y N 15 6LF CAM CAO doub Y N 16 6LF CAM CAR sing Y N 17 6LF NAG CAW sing N N 18 6LF NAG CAX sing Y N 19 6LF CAU CAV sing N N 20 6LF CAU CAX doub Y N 21 6LF CAO CAJ sing Y N 22 6LF CAW CBB sing N N 23 6LF CAV CAT doub N E 24 6LF CAR CAQ doub Y N 25 6LF CBB OAD sing N N 26 6LF CAJ CAN sing Y N 27 6LF CAJ CAL doub Y N 28 6LF CAQ CAL sing Y N 29 6LF CAT CAN sing N N 30 6LF CAN NAF doub Y N 31 6LF CAL NAE sing Y N 32 6LF NAF NAE sing Y N 33 6LF CAK H1 sing N N 34 6LF CAO H2 sing N N 35 6LF CAQ H3 sing N N 36 6LF CAR H4 sing N N 37 6LF CAS H5 sing N N 38 6LF CAS H6 sing N N 39 6LF CAS H7 sing N N 40 6LF CAT H8 sing N N 41 6LF CAV H10 sing N N 42 6LF CAW H12 sing N N 43 6LF CAW H13 sing N N 44 6LF CAX H14 sing N N 45 6LF NAE H15 sing N N 46 6LF CBA H16 sing N N 47 6LF CBB H17 sing N N 48 6LF CBC H18 sing N N 49 6LF CBD H19 sing N N 50 6LF OAD H9 sing N N 51 6LF CBB H11 sing N N 52 ALA N CA sing N N 53 ALA N H sing N N 54 ALA N H2 sing N N 55 ALA CA C sing N N 56 ALA CA CB sing N N 57 ALA CA HA sing N N 58 ALA C O doub N N 59 ALA C OXT sing N N 60 ALA CB HB1 sing N N 61 ALA CB HB2 sing N N 62 ALA CB HB3 sing N N 63 ALA OXT HXT sing N N 64 ARG N CA sing N N 65 ARG N H sing N N 66 ARG N H2 sing N N 67 ARG CA C sing N N 68 ARG CA CB sing N N 69 ARG CA HA sing N N 70 ARG C O doub N N 71 ARG C OXT sing N N 72 ARG CB CG sing N N 73 ARG CB HB2 sing N N 74 ARG CB HB3 sing N N 75 ARG CG CD sing N N 76 ARG CG HG2 sing N N 77 ARG CG HG3 sing N N 78 ARG CD NE sing N N 79 ARG CD HD2 sing N N 80 ARG CD HD3 sing N N 81 ARG NE CZ sing N N 82 ARG NE HE sing N N 83 ARG CZ NH1 sing N N 84 ARG CZ NH2 doub N N 85 ARG NH1 HH11 sing N N 86 ARG NH1 HH12 sing N N 87 ARG NH2 HH21 sing N N 88 ARG NH2 HH22 sing N N 89 ARG OXT HXT sing N N 90 ASN N CA sing N N 91 ASN N H sing N N 92 ASN N H2 sing N N 93 ASN CA C sing N N 94 ASN CA CB sing N N 95 ASN CA HA sing N N 96 ASN C O doub N N 97 ASN C OXT sing N N 98 ASN CB CG sing N N 99 ASN CB HB2 sing N N 100 ASN CB HB3 sing N N 101 ASN CG OD1 doub N N 102 ASN CG ND2 sing N N 103 ASN ND2 HD21 sing N N 104 ASN ND2 HD22 sing N N 105 ASN OXT HXT sing N N 106 ASP N CA sing N N 107 ASP N H sing N N 108 ASP N H2 sing N N 109 ASP CA C sing N N 110 ASP CA CB sing N N 111 ASP CA HA sing N N 112 ASP C O doub N N 113 ASP C OXT sing N N 114 ASP CB CG sing N N 115 ASP CB HB2 sing N N 116 ASP CB HB3 sing N N 117 ASP CG OD1 doub N N 118 ASP CG OD2 sing N N 119 ASP OD2 HD2 sing N N 120 ASP OXT HXT sing N N 121 CYS N CA sing N N 122 CYS N H sing N N 123 CYS N H2 sing N N 124 CYS CA C sing N N 125 CYS CA CB sing N N 126 CYS CA HA sing N N 127 CYS C O doub N N 128 CYS C OXT sing N N 129 CYS CB SG sing N N 130 CYS CB HB2 sing N N 131 CYS CB HB3 sing N N 132 CYS SG HG sing N N 133 CYS OXT HXT sing N N 134 GLN N CA sing N N 135 GLN N H sing N N 136 GLN N H2 sing N N 137 GLN CA C sing N N 138 GLN CA CB sing N N 139 GLN CA HA sing N N 140 GLN C O doub N N 141 GLN C OXT sing N N 142 GLN CB CG sing N N 143 GLN CB HB2 sing N N 144 GLN CB HB3 sing N N 145 GLN CG CD sing N N 146 GLN CG HG2 sing N N 147 GLN CG HG3 sing N N 148 GLN CD OE1 doub N N 149 GLN CD NE2 sing N N 150 GLN NE2 HE21 sing N N 151 GLN NE2 HE22 sing N N 152 GLN OXT HXT sing N N 153 GLU N CA sing N N 154 GLU N H sing N N 155 GLU N H2 sing N N 156 GLU CA C sing N N 157 GLU CA CB sing N N 158 GLU CA HA sing N N 159 GLU C O doub N N 160 GLU C OXT sing N N 161 GLU CB CG sing N N 162 GLU CB HB2 sing N N 163 GLU CB HB3 sing N N 164 GLU CG CD sing N N 165 GLU CG HG2 sing N N 166 GLU CG HG3 sing N N 167 GLU CD OE1 doub N N 168 GLU CD OE2 sing N N 169 GLU OE2 HE2 sing N N 170 GLU OXT HXT sing N N 171 GLY N CA sing N N 172 GLY N H sing N N 173 GLY N H2 sing N N 174 GLY CA C sing N N 175 GLY CA HA2 sing N N 176 GLY CA HA3 sing N N 177 GLY C O doub N N 178 GLY C OXT sing N N 179 GLY OXT HXT sing N N 180 HIS N CA sing N N 181 HIS N H sing N N 182 HIS N H2 sing N N 183 HIS CA C sing N N 184 HIS CA CB sing N N 185 HIS CA HA sing N N 186 HIS C O doub N N 187 HIS C OXT sing N N 188 HIS CB CG sing N N 189 HIS CB HB2 sing N N 190 HIS CB HB3 sing N N 191 HIS CG ND1 sing Y N 192 HIS CG CD2 doub Y N 193 HIS ND1 CE1 doub Y N 194 HIS ND1 HD1 sing N N 195 HIS CD2 NE2 sing Y N 196 HIS CD2 HD2 sing N N 197 HIS CE1 NE2 sing Y N 198 HIS CE1 HE1 sing N N 199 HIS NE2 HE2 sing N N 200 HIS OXT HXT sing N N 201 HOH O H1 sing N N 202 HOH O H2 sing N N 203 ILE N CA sing N N 204 ILE N H sing N N 205 ILE N H2 sing N N 206 ILE CA C sing N N 207 ILE CA CB sing N N 208 ILE CA HA sing N N 209 ILE C O doub N N 210 ILE C OXT sing N N 211 ILE CB CG1 sing N N 212 ILE CB CG2 sing N N 213 ILE CB HB sing N N 214 ILE CG1 CD1 sing N N 215 ILE CG1 HG12 sing N N 216 ILE CG1 HG13 sing N N 217 ILE CG2 HG21 sing N N 218 ILE CG2 HG22 sing N N 219 ILE CG2 HG23 sing N N 220 ILE CD1 HD11 sing N N 221 ILE CD1 HD12 sing N N 222 ILE CD1 HD13 sing N N 223 ILE OXT HXT sing N N 224 LEU N CA sing N N 225 LEU N H sing N N 226 LEU N H2 sing N N 227 LEU CA C sing N N 228 LEU CA CB sing N N 229 LEU CA HA sing N N 230 LEU C O doub N N 231 LEU C OXT sing N N 232 LEU CB CG sing N N 233 LEU CB HB2 sing N N 234 LEU CB HB3 sing N N 235 LEU CG CD1 sing N N 236 LEU CG CD2 sing N N 237 LEU CG HG sing N N 238 LEU CD1 HD11 sing N N 239 LEU CD1 HD12 sing N N 240 LEU CD1 HD13 sing N N 241 LEU CD2 HD21 sing N N 242 LEU CD2 HD22 sing N N 243 LEU CD2 HD23 sing N N 244 LEU OXT HXT sing N N 245 LYS N CA sing N N 246 LYS N H sing N N 247 LYS N H2 sing N N 248 LYS CA C sing N N 249 LYS CA CB sing N N 250 LYS CA HA sing N N 251 LYS C O doub N N 252 LYS C OXT sing N N 253 LYS CB CG sing N N 254 LYS CB HB2 sing N N 255 LYS CB HB3 sing N N 256 LYS CG CD sing N N 257 LYS CG HG2 sing N N 258 LYS CG HG3 sing N N 259 LYS CD CE sing N N 260 LYS CD HD2 sing N N 261 LYS CD HD3 sing N N 262 LYS CE NZ sing N N 263 LYS CE HE2 sing N N 264 LYS CE HE3 sing N N 265 LYS NZ HZ1 sing N N 266 LYS NZ HZ2 sing N N 267 LYS NZ HZ3 sing N N 268 LYS OXT HXT sing N N 269 MET N CA sing N N 270 MET N H sing N N 271 MET N H2 sing N N 272 MET CA C sing N N 273 MET CA CB sing N N 274 MET CA HA sing N N 275 MET C O doub N N 276 MET C OXT sing N N 277 MET CB CG sing N N 278 MET CB HB2 sing N N 279 MET CB HB3 sing N N 280 MET CG SD sing N N 281 MET CG HG2 sing N N 282 MET CG HG3 sing N N 283 MET SD CE sing N N 284 MET CE HE1 sing N N 285 MET CE HE2 sing N N 286 MET CE HE3 sing N N 287 MET OXT HXT sing N N 288 PHE N CA sing N N 289 PHE N H sing N N 290 PHE N H2 sing N N 291 PHE CA C sing N N 292 PHE CA CB sing N N 293 PHE CA HA sing N N 294 PHE C O doub N N 295 PHE C OXT sing N N 296 PHE CB CG sing N N 297 PHE CB HB2 sing N N 298 PHE CB HB3 sing N N 299 PHE CG CD1 doub Y N 300 PHE CG CD2 sing Y N 301 PHE CD1 CE1 sing Y N 302 PHE CD1 HD1 sing N N 303 PHE CD2 CE2 doub Y N 304 PHE CD2 HD2 sing N N 305 PHE CE1 CZ doub Y N 306 PHE CE1 HE1 sing N N 307 PHE CE2 CZ sing Y N 308 PHE CE2 HE2 sing N N 309 PHE CZ HZ sing N N 310 PHE OXT HXT sing N N 311 PRO N CA sing N N 312 PRO N CD sing N N 313 PRO N H sing N N 314 PRO CA C sing N N 315 PRO CA CB sing N N 316 PRO CA HA sing N N 317 PRO C O doub N N 318 PRO C OXT sing N N 319 PRO CB CG sing N N 320 PRO CB HB2 sing N N 321 PRO CB HB3 sing N N 322 PRO CG CD sing N N 323 PRO CG HG2 sing N N 324 PRO CG HG3 sing N N 325 PRO CD HD2 sing N N 326 PRO CD HD3 sing N N 327 PRO OXT HXT sing N N 328 SER N CA sing N N 329 SER N H sing N N 330 SER N H2 sing N N 331 SER CA C sing N N 332 SER CA CB sing N N 333 SER CA HA sing N N 334 SER C O doub N N 335 SER C OXT sing N N 336 SER CB OG sing N N 337 SER CB HB2 sing N N 338 SER CB HB3 sing N N 339 SER OG HG sing N N 340 SER OXT HXT sing N N 341 THR N CA sing N N 342 THR N H sing N N 343 THR N H2 sing N N 344 THR CA C sing N N 345 THR CA CB sing N N 346 THR CA HA sing N N 347 THR C O doub N N 348 THR C OXT sing N N 349 THR CB OG1 sing N N 350 THR CB CG2 sing N N 351 THR CB HB sing N N 352 THR OG1 HG1 sing N N 353 THR CG2 HG21 sing N N 354 THR CG2 HG22 sing N N 355 THR CG2 HG23 sing N N 356 THR OXT HXT sing N N 357 TRP N CA sing N N 358 TRP N H sing N N 359 TRP N H2 sing N N 360 TRP CA C sing N N 361 TRP CA CB sing N N 362 TRP CA HA sing N N 363 TRP C O doub N N 364 TRP C OXT sing N N 365 TRP CB CG sing N N 366 TRP CB HB2 sing N N 367 TRP CB HB3 sing N N 368 TRP CG CD1 doub Y N 369 TRP CG CD2 sing Y N 370 TRP CD1 NE1 sing Y N 371 TRP CD1 HD1 sing N N 372 TRP CD2 CE2 doub Y N 373 TRP CD2 CE3 sing Y N 374 TRP NE1 CE2 sing Y N 375 TRP NE1 HE1 sing N N 376 TRP CE2 CZ2 sing Y N 377 TRP CE3 CZ3 doub Y N 378 TRP CE3 HE3 sing N N 379 TRP CZ2 CH2 doub Y N 380 TRP CZ2 HZ2 sing N N 381 TRP CZ3 CH2 sing Y N 382 TRP CZ3 HZ3 sing N N 383 TRP CH2 HH2 sing N N 384 TRP OXT HXT sing N N 385 TYR N CA sing N N 386 TYR N H sing N N 387 TYR N H2 sing N N 388 TYR CA C sing N N 389 TYR CA CB sing N N 390 TYR CA HA sing N N 391 TYR C O doub N N 392 TYR C OXT sing N N 393 TYR CB CG sing N N 394 TYR CB HB2 sing N N 395 TYR CB HB3 sing N N 396 TYR CG CD1 doub Y N 397 TYR CG CD2 sing Y N 398 TYR CD1 CE1 sing Y N 399 TYR CD1 HD1 sing N N 400 TYR CD2 CE2 doub Y N 401 TYR CD2 HD2 sing N N 402 TYR CE1 CZ doub Y N 403 TYR CE1 HE1 sing N N 404 TYR CE2 CZ sing Y N 405 TYR CE2 HE2 sing N N 406 TYR CZ OH sing N N 407 TYR OH HH sing N N 408 TYR OXT HXT sing N N 409 VAL N CA sing N N 410 VAL N H sing N N 411 VAL N H2 sing N N 412 VAL CA C sing N N 413 VAL CA CB sing N N 414 VAL CA HA sing N N 415 VAL C O doub N N 416 VAL C OXT sing N N 417 VAL CB CG1 sing N N 418 VAL CB CG2 sing N N 419 VAL CB HB sing N N 420 VAL CG1 HG11 sing N N 421 VAL CG1 HG12 sing N N 422 VAL CG1 HG13 sing N N 423 VAL CG2 HG21 sing N N 424 VAL CG2 HG22 sing N N 425 VAL CG2 HG23 sing N N 426 VAL OXT HXT sing N N 427 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China' China 81372904 1 'National Natural Science Foundation of China' China 81570537 2 'National Natural Science Foundation of China' China 81272971 3 # _atom_sites.entry_id 5XFF _atom_sites.fract_transf_matrix[1][1] 0.016054 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016054 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005418 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_