data_5XQ5 # _entry.id 5XQ5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5XQ5 pdb_00005xq5 10.2210/pdb5xq5/pdb WWPDB D_1300003982 ? ? BMRB 36095 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of the domain 5 of the E. coli ribosomal protein S1' _pdbx_database_related.db_id 36095 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5XQ5 _pdbx_database_status.recvd_initial_deposition_date 2017-06-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lu, Y.' 1 ? 'Lim, L.Z.' 2 ? 'Song, J.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'NMR structure of the domain 5 of the E. coli ribosomal protein S1' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lu, Y.' 1 ? primary 'Lim, L.Z.' 2 ? primary 'Song, J.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description '30S ribosomal protein S1' _entity.formula_weight 11580.876 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 350-443' _entity.details None # _entity_name_com.entity_id 1 _entity_name_com.name 'Bacteriophage Q beta RNA-directed RNA polymerase subunit I,Small ribosomal subunit protein bS1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKANPWQQFAETHNKGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWNVAGEEAVREYKKGDEIAAVVLQVDAERER ISLGVKQLAEDPFNNLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKANPWQQFAETHNKGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWNVAGEEAVREYKKGDEIAAVVLQVDAERER ISLGVKQLAEDPFNNLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ALA n 1 4 ASN n 1 5 PRO n 1 6 TRP n 1 7 GLN n 1 8 GLN n 1 9 PHE n 1 10 ALA n 1 11 GLU n 1 12 THR n 1 13 HIS n 1 14 ASN n 1 15 LYS n 1 16 GLY n 1 17 ASP n 1 18 ARG n 1 19 VAL n 1 20 GLU n 1 21 GLY n 1 22 LYS n 1 23 ILE n 1 24 LYS n 1 25 SER n 1 26 ILE n 1 27 THR n 1 28 ASP n 1 29 PHE n 1 30 GLY n 1 31 ILE n 1 32 PHE n 1 33 ILE n 1 34 GLY n 1 35 LEU n 1 36 ASP n 1 37 GLY n 1 38 GLY n 1 39 ILE n 1 40 ASP n 1 41 GLY n 1 42 LEU n 1 43 VAL n 1 44 HIS n 1 45 LEU n 1 46 SER n 1 47 ASP n 1 48 ILE n 1 49 SER n 1 50 TRP n 1 51 ASN n 1 52 VAL n 1 53 ALA n 1 54 GLY n 1 55 GLU n 1 56 GLU n 1 57 ALA n 1 58 VAL n 1 59 ARG n 1 60 GLU n 1 61 TYR n 1 62 LYS n 1 63 LYS n 1 64 GLY n 1 65 ASP n 1 66 GLU n 1 67 ILE n 1 68 ALA n 1 69 ALA n 1 70 VAL n 1 71 VAL n 1 72 LEU n 1 73 GLN n 1 74 VAL n 1 75 ASP n 1 76 ALA n 1 77 GLU n 1 78 ARG n 1 79 GLU n 1 80 ARG n 1 81 ILE n 1 82 SER n 1 83 LEU n 1 84 GLY n 1 85 VAL n 1 86 LYS n 1 87 GLN n 1 88 LEU n 1 89 ALA n 1 90 GLU n 1 91 ASP n 1 92 PRO n 1 93 PHE n 1 94 ASN n 1 95 ASN n 1 96 LEU n 1 97 GLU n 1 98 HIS n 1 99 HIS n 1 100 HIS n 1 101 HIS n 1 102 HIS n 1 103 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 103 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rpsA, ssyF, b0911, JW0894' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli K12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RS1_ECOLI _struct_ref.pdbx_db_accession P0AG67 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KANPWQQFAETHNKGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWNVAGEEAVREYKKGDEIAAVVLQVDAERERI SLGVKQLAEDPFNN ; _struct_ref.pdbx_align_begin 350 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XQ5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AG67 _struct_ref_seq.db_align_beg 350 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 443 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 94 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5XQ5 MET A 1 ? UNP P0AG67 ? ? 'expression tag' 0 1 1 5XQ5 LEU A 96 ? UNP P0AG67 ? ? 'expression tag' 95 2 1 5XQ5 GLU A 97 ? UNP P0AG67 ? ? 'expression tag' 96 3 1 5XQ5 HIS A 98 ? UNP P0AG67 ? ? 'expression tag' 97 4 1 5XQ5 HIS A 99 ? UNP P0AG67 ? ? 'expression tag' 98 5 1 5XQ5 HIS A 100 ? UNP P0AG67 ? ? 'expression tag' 99 6 1 5XQ5 HIS A 101 ? UNP P0AG67 ? ? 'expression tag' 100 7 1 5XQ5 HIS A 102 ? UNP P0AG67 ? ? 'expression tag' 101 8 1 5XQ5 HIS A 103 ? UNP P0AG67 ? ? 'expression tag' 102 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 1 isotropic 2 1 1 '3D 1H-15N TOCSY' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '700 uM [U-99% 13C; U-99% 15N] Domain 5 of the E. coli ribosomal protein S1, 10 mM sodium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 5XQ5 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # _pdbx_nmr_ensemble.entry_id 5XQ5 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 5 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5XQ5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' CcpNMR 2.4.1 CCPN 2 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 3 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XQ5 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5XQ5 _struct.title 'NMR structure of the domain 5 of the E. coli ribosomal protein S1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XQ5 _struct_keywords.text 'S1 RNA-binding domain, E. coli ribosomal protein, NMR solution structure, RIBOSOMAL PROTEIN' _struct_keywords.pdbx_keywords 'RIBOSOMAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 5 ? ALA A 10 ? PRO A 4 ALA A 9 1 ? 6 HELX_P HELX_P2 AA2 GLU A 11 ? ASN A 14 ? GLU A 10 ASN A 13 5 ? 4 HELX_P HELX_P3 AA3 VAL A 43 ? ILE A 48 ? VAL A 42 ILE A 47 5 ? 6 HELX_P HELX_P4 AA4 ALA A 53 ? VAL A 58 ? ALA A 52 VAL A 57 1 ? 6 HELX_P HELX_P5 AA5 ARG A 59 ? TYR A 61 ? ARG A 58 TYR A 60 5 ? 3 HELX_P HELX_P6 AA6 GLY A 84 ? ALA A 89 ? GLY A 83 ALA A 88 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 17 ? GLU A 20 ? ASP A 16 GLU A 19 AA1 2 ALA A 68 ? VAL A 74 ? ALA A 67 VAL A 73 AA1 3 ILE A 81 ? LEU A 83 ? ILE A 80 LEU A 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 19 ? N VAL A 18 O ALA A 69 ? O ALA A 68 AA1 2 3 N GLN A 73 ? N GLN A 72 O SER A 82 ? O SER A 81 # _atom_sites.entry_id 5XQ5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 LYS 2 1 1 LYS LYS A . n A 1 3 ALA 3 2 2 ALA ALA A . n A 1 4 ASN 4 3 3 ASN ASN A . n A 1 5 PRO 5 4 4 PRO PRO A . n A 1 6 TRP 6 5 5 TRP TRP A . n A 1 7 GLN 7 6 6 GLN GLN A . n A 1 8 GLN 8 7 7 GLN GLN A . n A 1 9 PHE 9 8 8 PHE PHE A . n A 1 10 ALA 10 9 9 ALA ALA A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 THR 12 11 11 THR THR A . n A 1 13 HIS 13 12 12 HIS HIS A . n A 1 14 ASN 14 13 13 ASN ASN A . n A 1 15 LYS 15 14 14 LYS LYS A . n A 1 16 GLY 16 15 15 GLY GLY A . n A 1 17 ASP 17 16 16 ASP ASP A . n A 1 18 ARG 18 17 17 ARG ARG A . n A 1 19 VAL 19 18 18 VAL VAL A . n A 1 20 GLU 20 19 19 GLU GLU A . n A 1 21 GLY 21 20 20 GLY GLY A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 ILE 23 22 22 ILE ILE A . n A 1 24 LYS 24 23 23 LYS LYS A . n A 1 25 SER 25 24 24 SER SER A . n A 1 26 ILE 26 25 25 ILE ILE A . n A 1 27 THR 27 26 26 THR THR A . n A 1 28 ASP 28 27 27 ASP ASP A . n A 1 29 PHE 29 28 28 PHE PHE A . n A 1 30 GLY 30 29 29 GLY GLY A . n A 1 31 ILE 31 30 30 ILE ILE A . n A 1 32 PHE 32 31 31 PHE PHE A . n A 1 33 ILE 33 32 32 ILE ILE A . n A 1 34 GLY 34 33 33 GLY GLY A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 ASP 36 35 35 ASP ASP A . n A 1 37 GLY 37 36 36 GLY GLY A . n A 1 38 GLY 38 37 37 GLY GLY A . n A 1 39 ILE 39 38 38 ILE ILE A . n A 1 40 ASP 40 39 39 ASP ASP A . n A 1 41 GLY 41 40 40 GLY GLY A . n A 1 42 LEU 42 41 41 LEU LEU A . n A 1 43 VAL 43 42 42 VAL VAL A . n A 1 44 HIS 44 43 43 HIS HIS A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 SER 46 45 45 SER SER A . n A 1 47 ASP 47 46 46 ASP ASP A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 SER 49 48 48 SER SER A . n A 1 50 TRP 50 49 49 TRP TRP A . n A 1 51 ASN 51 50 50 ASN ASN A . n A 1 52 VAL 52 51 51 VAL VAL A . n A 1 53 ALA 53 52 52 ALA ALA A . n A 1 54 GLY 54 53 53 GLY GLY A . n A 1 55 GLU 55 54 54 GLU GLU A . n A 1 56 GLU 56 55 55 GLU GLU A . n A 1 57 ALA 57 56 56 ALA ALA A . n A 1 58 VAL 58 57 57 VAL VAL A . n A 1 59 ARG 59 58 58 ARG ARG A . n A 1 60 GLU 60 59 59 GLU GLU A . n A 1 61 TYR 61 60 60 TYR TYR A . n A 1 62 LYS 62 61 61 LYS LYS A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 GLY 64 63 63 GLY GLY A . n A 1 65 ASP 65 64 64 ASP ASP A . n A 1 66 GLU 66 65 65 GLU GLU A . n A 1 67 ILE 67 66 66 ILE ILE A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 VAL 70 69 69 VAL VAL A . n A 1 71 VAL 71 70 70 VAL VAL A . n A 1 72 LEU 72 71 71 LEU LEU A . n A 1 73 GLN 73 72 72 GLN GLN A . n A 1 74 VAL 74 73 73 VAL VAL A . n A 1 75 ASP 75 74 74 ASP ASP A . n A 1 76 ALA 76 75 75 ALA ALA A . n A 1 77 GLU 77 76 76 GLU GLU A . n A 1 78 ARG 78 77 77 ARG ARG A . n A 1 79 GLU 79 78 78 GLU GLU A . n A 1 80 ARG 80 79 79 ARG ARG A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 SER 82 81 81 SER SER A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 GLY 84 83 83 GLY GLY A . n A 1 85 VAL 85 84 84 VAL VAL A . n A 1 86 LYS 86 85 85 LYS LYS A . n A 1 87 GLN 87 86 86 GLN GLN A . n A 1 88 LEU 88 87 87 LEU LEU A . n A 1 89 ALA 89 88 88 ALA ALA A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 ASP 91 90 90 ASP ASP A . n A 1 92 PRO 92 91 91 PRO PRO A . n A 1 93 PHE 93 92 92 PHE PHE A . n A 1 94 ASN 94 93 93 ASN ASN A . n A 1 95 ASN 95 94 94 ASN ASN A . n A 1 96 LEU 96 95 ? ? ? A . n A 1 97 GLU 97 96 ? ? ? A . n A 1 98 HIS 98 97 ? ? ? A . n A 1 99 HIS 99 98 ? ? ? A . n A 1 100 HIS 100 99 ? ? ? A . n A 1 101 HIS 101 100 ? ? ? A . n A 1 102 HIS 102 101 ? ? ? A . n A 1 103 HIS 103 102 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7720 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-06-06 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Domain 5 of the E. coli ribosomal protein S1' 700 ? uM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate' 10 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 14 ? ? -176.18 112.20 2 1 PHE A 28 ? ? -152.97 19.75 3 1 SER A 48 ? ? 67.25 156.55 4 1 ASN A 50 ? ? -150.52 -48.10 5 1 TYR A 60 ? ? -58.89 -178.31 6 1 GLU A 65 ? ? 178.33 -69.92 7 1 GLU A 89 ? ? -69.49 -179.36 8 2 ALA A 2 ? ? -140.21 51.28 9 2 LYS A 14 ? ? -177.23 116.43 10 2 PHE A 28 ? ? -152.53 18.88 11 2 VAL A 42 ? ? -161.14 119.59 12 2 SER A 48 ? ? 67.40 157.31 13 2 ASN A 50 ? ? -151.54 -47.94 14 2 TYR A 60 ? ? -68.57 -176.71 15 2 GLU A 65 ? ? -176.92 -66.88 16 2 LEU A 71 ? ? -122.93 -51.21 17 2 GLU A 89 ? ? -58.52 174.46 18 2 ASN A 93 ? ? -176.72 144.63 19 3 ALA A 2 ? ? 62.44 84.02 20 3 PRO A 4 ? ? -67.47 84.93 21 3 LYS A 14 ? ? -177.52 114.28 22 3 SER A 24 ? ? -61.29 -173.08 23 3 PHE A 28 ? ? -154.00 28.29 24 3 LEU A 34 ? ? -107.68 -169.74 25 3 SER A 48 ? ? 67.93 172.50 26 3 ASN A 50 ? ? -153.94 -48.26 27 3 PHE A 92 ? ? 66.39 166.14 28 4 PRO A 4 ? ? -69.51 79.78 29 4 LYS A 14 ? ? -178.30 112.79 30 4 PHE A 28 ? ? -154.11 31.46 31 4 SER A 48 ? ? 67.10 173.46 32 4 ASN A 50 ? ? -157.72 -48.34 33 4 TYR A 60 ? ? 47.31 -168.83 34 4 GLU A 65 ? ? -179.74 -77.92 35 4 VAL A 73 ? ? -172.23 148.12 36 4 GLU A 89 ? ? -60.79 -177.01 37 4 PHE A 92 ? ? 65.38 167.32 38 5 ASN A 3 ? ? -119.95 68.21 39 5 LYS A 14 ? ? -174.84 117.50 40 5 PHE A 28 ? ? -156.16 15.39 41 5 ILE A 30 ? ? -77.35 -120.06 42 5 SER A 48 ? ? 68.86 151.63 43 5 ASN A 50 ? ? -152.43 -48.10 44 5 VAL A 73 ? ? -171.78 142.75 45 5 ALA A 88 ? ? -178.55 112.14 46 5 PHE A 92 ? ? 65.20 164.49 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A LEU 95 ? A LEU 96 3 1 Y 1 A GLU 96 ? A GLU 97 4 1 Y 1 A HIS 97 ? A HIS 98 5 1 Y 1 A HIS 98 ? A HIS 99 6 1 Y 1 A HIS 99 ? A HIS 100 7 1 Y 1 A HIS 100 ? A HIS 101 8 1 Y 1 A HIS 101 ? A HIS 102 9 1 Y 1 A HIS 102 ? A HIS 103 10 2 Y 1 A MET 0 ? A MET 1 11 2 Y 1 A LEU 95 ? A LEU 96 12 2 Y 1 A GLU 96 ? A GLU 97 13 2 Y 1 A HIS 97 ? A HIS 98 14 2 Y 1 A HIS 98 ? A HIS 99 15 2 Y 1 A HIS 99 ? A HIS 100 16 2 Y 1 A HIS 100 ? A HIS 101 17 2 Y 1 A HIS 101 ? A HIS 102 18 2 Y 1 A HIS 102 ? A HIS 103 19 3 Y 1 A MET 0 ? A MET 1 20 3 Y 1 A LEU 95 ? A LEU 96 21 3 Y 1 A GLU 96 ? A GLU 97 22 3 Y 1 A HIS 97 ? A HIS 98 23 3 Y 1 A HIS 98 ? A HIS 99 24 3 Y 1 A HIS 99 ? A HIS 100 25 3 Y 1 A HIS 100 ? A HIS 101 26 3 Y 1 A HIS 101 ? A HIS 102 27 3 Y 1 A HIS 102 ? A HIS 103 28 4 Y 1 A MET 0 ? A MET 1 29 4 Y 1 A LEU 95 ? A LEU 96 30 4 Y 1 A GLU 96 ? A GLU 97 31 4 Y 1 A HIS 97 ? A HIS 98 32 4 Y 1 A HIS 98 ? A HIS 99 33 4 Y 1 A HIS 99 ? A HIS 100 34 4 Y 1 A HIS 100 ? A HIS 101 35 4 Y 1 A HIS 101 ? A HIS 102 36 4 Y 1 A HIS 102 ? A HIS 103 37 5 Y 1 A MET 0 ? A MET 1 38 5 Y 1 A LEU 95 ? A LEU 96 39 5 Y 1 A GLU 96 ? A GLU 97 40 5 Y 1 A HIS 97 ? A HIS 98 41 5 Y 1 A HIS 98 ? A HIS 99 42 5 Y 1 A HIS 99 ? A HIS 100 43 5 Y 1 A HIS 100 ? A HIS 101 44 5 Y 1 A HIS 101 ? A HIS 102 45 5 Y 1 A HIS 102 ? A HIS 103 # _pdbx_audit_support.funding_organization 'Ministry of Education (Singapore)' _pdbx_audit_support.country Singapore _pdbx_audit_support.grant_number MOE2015-T2-1-111 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #