data_5XZH # _entry.id 5XZH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5XZH pdb_00005xzh 10.2210/pdb5xzh/pdb WWPDB D_1300004425 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 5XZF _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5XZH _pdbx_database_status.recvd_initial_deposition_date 2017-07-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Otero, R.' 1 ? 'Numoto, N.' 2 ? 'Ikura, T.' 3 ? 'Yamada, S.' 4 ? 'Mourino, A.' 5 ? 'Makishima, M.' 6 ? 'Ito, N.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Med. Chem.' _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 1520-4804 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 61 _citation.language ? _citation.page_first 6658 _citation.page_last 6673 _citation.title ;25 S-Adamantyl-23-yne-26,27-dinor-1 alpha ,25-dihydroxyvitamin D3: Synthesis, Tissue Selective Biological Activities, and X-ray Crystal Structural Analysis of Its Vitamin D Receptor Complex. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.8b00427 _citation.pdbx_database_id_PubMed 29989817 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Otero, R.' 1 ? primary 'Ishizawa, M.' 2 ? primary 'Numoto, N.' 3 ? primary 'Ikura, T.' 4 ? primary 'Ito, N.' 5 ? primary 'Tokiwa, H.' 6 0000-0002-3790-1799 primary 'Mourino, A.' 7 0000-0001-8922-8033 primary 'Makishima, M.' 8 0000-0002-4630-905X primary 'Yamada, S.' 9 ? # _cell.entry_id 5XZH _cell.length_a 153.665 _cell.length_b 41.763 _cell.length_c 42.010 _cell.angle_alpha 90.00 _cell.angle_beta 95.58 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5XZH _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Vitamin D3 receptor' 30595.037 1 ? '165-211 deletion' 'UNP residues 116-423' ? 2 polymer syn 'Mediator of RNA polymerase II transcription subunit 1' 1570.898 1 ? ? 'UNP residues 640-652' ? 3 non-polymer syn ;(1R,3S,5Z)-5-[(2E)-2-[(1R,3aS,7aR)-1-[(2R,6R)-6-(1-adamantyl)-6-oxidanyl-hex-4-yn-2-yl]-7a-methyl-2,3,3a,5,6,7-hexahydro-1H-inden-4-ylidene]ethylidene]-4-methylidene-cyclohexane-1,3-diol ; 518.770 1 ? ? ? ? 4 water nat water 18.015 12 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'VDR,1,25-dihydroxyvitamin D3 receptor,Nuclear receptor subfamily 1 group I member 1' 2 ;Activator-recruited cofactor 205 kDa component,ARC205,Mediator complex subunit 1,Peroxisome proliferator-activated receptor-binding protein,PPAR-binding protein,Thyroid hormone receptor-associated protein complex 220 kDa component,Trap220,Thyroid receptor-interacting protein 2,TRIP-2,Vitamin D receptor-interacting protein complex component DRIP205,p53 regulatory protein RB18A ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHMGSPNSPLKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSVTLDLSPLSMLPHLADLVSY SIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKF QVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEE HSKQYRSLSFQPENSMKLTPLVLEVFGNEIS ; ;GSHMGSPNSPLKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSVTLDLSPLSMLPHLADLVSY SIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKF QVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEE HSKQYRSLSFQPENSMKLTPLVLEVFGNEIS ; A ? 2 'polypeptide(L)' no no KNHPMLMNLLKDN KNHPMLMNLLKDN C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 SER n 1 7 PRO n 1 8 ASN n 1 9 SER n 1 10 PRO n 1 11 LEU n 1 12 LYS n 1 13 ASP n 1 14 SER n 1 15 LEU n 1 16 ARG n 1 17 PRO n 1 18 LYS n 1 19 LEU n 1 20 SER n 1 21 GLU n 1 22 GLU n 1 23 GLN n 1 24 GLN n 1 25 HIS n 1 26 ILE n 1 27 ILE n 1 28 ALA n 1 29 ILE n 1 30 LEU n 1 31 LEU n 1 32 ASP n 1 33 ALA n 1 34 HIS n 1 35 HIS n 1 36 LYS n 1 37 THR n 1 38 TYR n 1 39 ASP n 1 40 PRO n 1 41 THR n 1 42 TYR n 1 43 ALA n 1 44 ASP n 1 45 PHE n 1 46 ARG n 1 47 ASP n 1 48 PHE n 1 49 ARG n 1 50 PRO n 1 51 PRO n 1 52 VAL n 1 53 ARG n 1 54 MET n 1 55 ASP n 1 56 GLY n 1 57 SER n 1 58 THR n 1 59 GLY n 1 60 SER n 1 61 VAL n 1 62 THR n 1 63 LEU n 1 64 ASP n 1 65 LEU n 1 66 SER n 1 67 PRO n 1 68 LEU n 1 69 SER n 1 70 MET n 1 71 LEU n 1 72 PRO n 1 73 HIS n 1 74 LEU n 1 75 ALA n 1 76 ASP n 1 77 LEU n 1 78 VAL n 1 79 SER n 1 80 TYR n 1 81 SER n 1 82 ILE n 1 83 GLN n 1 84 LYS n 1 85 VAL n 1 86 ILE n 1 87 GLY n 1 88 PHE n 1 89 ALA n 1 90 LYS n 1 91 MET n 1 92 ILE n 1 93 PRO n 1 94 GLY n 1 95 PHE n 1 96 ARG n 1 97 ASP n 1 98 LEU n 1 99 THR n 1 100 SER n 1 101 ASP n 1 102 ASP n 1 103 GLN n 1 104 ILE n 1 105 VAL n 1 106 LEU n 1 107 LEU n 1 108 LYS n 1 109 SER n 1 110 SER n 1 111 ALA n 1 112 ILE n 1 113 GLU n 1 114 VAL n 1 115 ILE n 1 116 MET n 1 117 LEU n 1 118 ARG n 1 119 SER n 1 120 ASN n 1 121 GLN n 1 122 SER n 1 123 PHE n 1 124 THR n 1 125 MET n 1 126 ASP n 1 127 ASP n 1 128 MET n 1 129 SER n 1 130 TRP n 1 131 ASP n 1 132 CYS n 1 133 GLY n 1 134 SER n 1 135 GLN n 1 136 ASP n 1 137 TYR n 1 138 LYS n 1 139 TYR n 1 140 ASP n 1 141 VAL n 1 142 THR n 1 143 ASP n 1 144 VAL n 1 145 SER n 1 146 LYS n 1 147 ALA n 1 148 GLY n 1 149 HIS n 1 150 THR n 1 151 LEU n 1 152 GLU n 1 153 LEU n 1 154 ILE n 1 155 GLU n 1 156 PRO n 1 157 LEU n 1 158 ILE n 1 159 LYS n 1 160 PHE n 1 161 GLN n 1 162 VAL n 1 163 GLY n 1 164 LEU n 1 165 LYS n 1 166 LYS n 1 167 LEU n 1 168 ASN n 1 169 LEU n 1 170 HIS n 1 171 GLU n 1 172 GLU n 1 173 GLU n 1 174 HIS n 1 175 VAL n 1 176 LEU n 1 177 LEU n 1 178 MET n 1 179 ALA n 1 180 ILE n 1 181 CYS n 1 182 ILE n 1 183 VAL n 1 184 SER n 1 185 PRO n 1 186 ASP n 1 187 ARG n 1 188 PRO n 1 189 GLY n 1 190 VAL n 1 191 GLN n 1 192 ASP n 1 193 ALA n 1 194 LYS n 1 195 LEU n 1 196 VAL n 1 197 GLU n 1 198 ALA n 1 199 ILE n 1 200 GLN n 1 201 ASP n 1 202 ARG n 1 203 LEU n 1 204 SER n 1 205 ASN n 1 206 THR n 1 207 LEU n 1 208 GLN n 1 209 THR n 1 210 TYR n 1 211 ILE n 1 212 ARG n 1 213 CYS n 1 214 ARG n 1 215 HIS n 1 216 PRO n 1 217 PRO n 1 218 PRO n 1 219 GLY n 1 220 SER n 1 221 HIS n 1 222 GLN n 1 223 LEU n 1 224 TYR n 1 225 ALA n 1 226 LYS n 1 227 MET n 1 228 ILE n 1 229 GLN n 1 230 LYS n 1 231 LEU n 1 232 ALA n 1 233 ASP n 1 234 LEU n 1 235 ARG n 1 236 SER n 1 237 LEU n 1 238 ASN n 1 239 GLU n 1 240 GLU n 1 241 HIS n 1 242 SER n 1 243 LYS n 1 244 GLN n 1 245 TYR n 1 246 ARG n 1 247 SER n 1 248 LEU n 1 249 SER n 1 250 PHE n 1 251 GLN n 1 252 PRO n 1 253 GLU n 1 254 ASN n 1 255 SER n 1 256 MET n 1 257 LYS n 1 258 LEU n 1 259 THR n 1 260 PRO n 1 261 LEU n 1 262 VAL n 1 263 LEU n 1 264 GLU n 1 265 VAL n 1 266 PHE n 1 267 GLY n 1 268 ASN n 1 269 GLU n 1 270 ILE n 1 271 SER n 2 1 LYS n 2 2 ASN n 2 3 HIS n 2 4 PRO n 2 5 MET n 2 6 LEU n 2 7 MET n 2 8 ASN n 2 9 LEU n 2 10 LEU n 2 11 LYS n 2 12 ASP n 2 13 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 271 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Vdr, Nr1i1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain C41 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 13 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP VDR_RAT P13053 ? 1 ;LKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSYSPRPTLSFSGNSSSSSSDLYTTSLDMMEP SGFSNLDLNGEDSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSF TMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRL SNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGNEIS ; 116 2 UNP MED1_HUMAN Q15648 ? 2 KNHPMLMNLLKDN 640 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5XZH A 11 ? 271 ? P13053 116 ? 423 ? 116 423 2 2 5XZH C 1 ? 13 ? Q15648 640 ? 652 ? 625 637 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5XZH GLY A 1 ? UNP P13053 ? ? 'expression tag' 106 1 1 5XZH SER A 2 ? UNP P13053 ? ? 'expression tag' 107 2 1 5XZH HIS A 3 ? UNP P13053 ? ? 'expression tag' 108 3 1 5XZH MET A 4 ? UNP P13053 ? ? 'expression tag' 109 4 1 5XZH GLY A 5 ? UNP P13053 ? ? 'expression tag' 110 5 1 5XZH SER A 6 ? UNP P13053 ? ? 'expression tag' 111 6 1 5XZH PRO A 7 ? UNP P13053 ? ? 'expression tag' 112 7 1 5XZH ASN A 8 ? UNP P13053 ? ? 'expression tag' 113 8 1 5XZH SER A 9 ? UNP P13053 ? ? 'expression tag' 114 9 1 5XZH PRO A 10 ? UNP P13053 ? ? 'expression tag' 115 10 1 5XZH ? A ? ? UNP P13053 SER 165 deletion ? 11 1 5XZH ? A ? ? UNP P13053 TYR 166 deletion ? 12 1 5XZH ? A ? ? UNP P13053 SER 167 deletion ? 13 1 5XZH ? A ? ? UNP P13053 PRO 168 deletion ? 14 1 5XZH ? A ? ? UNP P13053 ARG 169 deletion ? 15 1 5XZH ? A ? ? UNP P13053 PRO 170 deletion ? 16 1 5XZH ? A ? ? UNP P13053 THR 171 deletion ? 17 1 5XZH ? A ? ? UNP P13053 LEU 172 deletion ? 18 1 5XZH ? A ? ? UNP P13053 SER 173 deletion ? 19 1 5XZH ? A ? ? UNP P13053 PHE 174 deletion ? 20 1 5XZH ? A ? ? UNP P13053 SER 175 deletion ? 21 1 5XZH ? A ? ? UNP P13053 GLY 176 deletion ? 22 1 5XZH ? A ? ? UNP P13053 ASN 177 deletion ? 23 1 5XZH ? A ? ? UNP P13053 SER 178 deletion ? 24 1 5XZH ? A ? ? UNP P13053 SER 179 deletion ? 25 1 5XZH ? A ? ? UNP P13053 SER 180 deletion ? 26 1 5XZH ? A ? ? UNP P13053 SER 181 deletion ? 27 1 5XZH ? A ? ? UNP P13053 SER 182 deletion ? 28 1 5XZH ? A ? ? UNP P13053 SER 183 deletion ? 29 1 5XZH ? A ? ? UNP P13053 ASP 184 deletion ? 30 1 5XZH ? A ? ? UNP P13053 LEU 185 deletion ? 31 1 5XZH ? A ? ? UNP P13053 TYR 186 deletion ? 32 1 5XZH ? A ? ? UNP P13053 THR 187 deletion ? 33 1 5XZH ? A ? ? UNP P13053 THR 188 deletion ? 34 1 5XZH ? A ? ? UNP P13053 SER 189 deletion ? 35 1 5XZH ? A ? ? UNP P13053 LEU 190 deletion ? 36 1 5XZH ? A ? ? UNP P13053 ASP 191 deletion ? 37 1 5XZH ? A ? ? UNP P13053 MET 192 deletion ? 38 1 5XZH ? A ? ? UNP P13053 MET 193 deletion ? 39 1 5XZH ? A ? ? UNP P13053 GLU 194 deletion ? 40 1 5XZH ? A ? ? UNP P13053 PRO 195 deletion ? 41 1 5XZH ? A ? ? UNP P13053 SER 196 deletion ? 42 1 5XZH ? A ? ? UNP P13053 GLY 197 deletion ? 43 1 5XZH ? A ? ? UNP P13053 PHE 198 deletion ? 44 1 5XZH ? A ? ? UNP P13053 SER 199 deletion ? 45 1 5XZH ? A ? ? UNP P13053 ASN 200 deletion ? 46 1 5XZH ? A ? ? UNP P13053 LEU 201 deletion ? 47 1 5XZH ? A ? ? UNP P13053 ASP 202 deletion ? 48 1 5XZH ? A ? ? UNP P13053 LEU 203 deletion ? 49 1 5XZH ? A ? ? UNP P13053 ASN 204 deletion ? 50 1 5XZH ? A ? ? UNP P13053 GLY 205 deletion ? 51 1 5XZH ? A ? ? UNP P13053 GLU 206 deletion ? 52 1 5XZH ? A ? ? UNP P13053 ASP 207 deletion ? 53 1 5XZH ? A ? ? UNP P13053 SER 208 deletion ? 54 1 5XZH ? A ? ? UNP P13053 ASP 209 deletion ? 55 1 5XZH ? A ? ? UNP P13053 ASP 210 deletion ? 56 1 5XZH ? A ? ? UNP P13053 PRO 211 deletion ? 57 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8J3 non-polymer . ;(1R,3S,5Z)-5-[(2E)-2-[(1R,3aS,7aR)-1-[(2R,6R)-6-(1-adamantyl)-6-oxidanyl-hex-4-yn-2-yl]-7a-methyl-2,3,3a,5,6,7-hexahydro-1H-inden-4-ylidene]ethylidene]-4-methylidene-cyclohexane-1,3-diol ; ? 'C35 H50 O3' 518.770 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XZH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.02 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M MOPS/NaOH, 0.2M sodium formate, 14-18%(w/v) PEG4000, 8% (v/v) ethylene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-06-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-17A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-17A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5XZH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18042 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.078 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.07 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.3 _reflns_shell.pdbx_Rsym_value 0.685 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5XZH _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 17148 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.01 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 99.14 _refine.ls_R_factor_obs 0.19683 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19432 _refine.ls_R_factor_R_free 0.24338 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 901 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.970 _refine.correlation_coeff_Fo_to_Fc_free 0.950 _refine.B_iso_mean 50.249 _refine.aniso_B[1][1] -4.09 _refine.aniso_B[2][2] 2.07 _refine.aniso_B[3][3] 2.44 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -2.36 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 3W5P _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.190 _refine.pdbx_overall_ESU_R_Free 0.172 _refine.overall_SU_ML 0.182 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 7.420 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2004 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.number_atoms_solvent 12 _refine_hist.number_atoms_total 2054 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 50.01 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.016 0.019 ? 2089 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 2044 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.897 2.003 ? 2831 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.061 3.000 ? 4731 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.950 5.000 ? 247 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 38.492 24.565 ? 92 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 17.532 15.000 ? 379 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 20.110 15.000 ? 11 'X-RAY DIFFRACTION' ? r_chiral_restr 0.103 0.200 ? 325 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.009 0.021 ? 2262 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.004 0.020 ? 447 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 4.045 4.692 ? 997 'X-RAY DIFFRACTION' ? r_mcbond_other 4.020 4.691 ? 996 'X-RAY DIFFRACTION' ? r_mcangle_it 5.712 7.020 ? 1241 'X-RAY DIFFRACTION' ? r_mcangle_other 5.718 7.022 ? 1242 'X-RAY DIFFRACTION' ? r_scbond_it 4.943 5.281 ? 1092 'X-RAY DIFFRACTION' ? r_scbond_other 4.941 5.281 ? 1093 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other 7.357 7.702 ? 1591 'X-RAY DIFFRACTION' ? r_long_range_B_refined 9.077 37.397 ? 2357 'X-RAY DIFFRACTION' ? r_long_range_B_other 9.100 37.301 ? 2343 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.000 _refine_ls_shell.d_res_low 2.052 _refine_ls_shell.number_reflns_R_work 1246 _refine_ls_shell.R_factor_R_work 0.387 _refine_ls_shell.percent_reflns_obs 99.39 _refine_ls_shell.R_factor_R_free 0.376 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 68 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 5XZH _struct.title 'Vitamin D receptor with a synthetic ligand ADRO2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XZH _struct_keywords.text 'Vitamin D receptor, vitamin D analogue, adamantan, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 20 ? TYR A 38 ? SER A 125 TYR A 143 1 ? 19 HELX_P HELX_P2 AA2 TYR A 42 ? PHE A 48 ? TYR A 147 PHE A 153 5 ? 7 HELX_P HELX_P3 AA3 MET A 70 ? ILE A 92 ? MET A 222 ILE A 244 1 ? 23 HELX_P HELX_P4 AA4 GLY A 94 ? LEU A 98 ? GLY A 246 LEU A 250 5 ? 5 HELX_P HELX_P5 AA5 THR A 99 ? ASN A 120 ? THR A 251 ASN A 272 1 ? 22 HELX_P HELX_P6 AA6 SER A 134 ? ASP A 136 ? SER A 286 ASP A 288 5 ? 3 HELX_P HELX_P7 AA7 ASP A 140 ? LYS A 146 ? ASP A 292 LYS A 298 1 ? 7 HELX_P HELX_P8 AA8 THR A 150 ? LYS A 166 ? THR A 302 LYS A 318 1 ? 17 HELX_P HELX_P9 AA9 HIS A 170 ? VAL A 183 ? HIS A 322 VAL A 335 1 ? 14 HELX_P HELX_P10 AB1 ASP A 192 ? HIS A 215 ? ASP A 344 HIS A 367 1 ? 24 HELX_P HELX_P11 AB2 GLN A 222 ? PHE A 250 ? GLN A 374 PHE A 402 1 ? 29 HELX_P HELX_P12 AB3 GLN A 251 ? MET A 256 ? GLN A 403 MET A 408 1 ? 6 HELX_P HELX_P13 AB4 THR A 259 ? GLY A 267 ? THR A 411 GLY A 419 1 ? 9 HELX_P HELX_P14 AB5 HIS B 3 ? LYS B 11 ? HIS C 627 LYS C 635 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 217 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 369 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 218 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 370 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.05 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 123 ? THR A 124 ? PHE A 275 THR A 276 AA1 2 SER A 129 ? ASP A 131 ? SER A 281 ASP A 283 AA1 3 LYS A 138 ? TYR A 139 ? LYS A 290 TYR A 291 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 124 ? N THR A 276 O SER A 129 ? O SER A 281 AA1 2 3 N TRP A 130 ? N TRP A 282 O TYR A 139 ? O TYR A 291 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 8J3 _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'binding site for residue 8J3 A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 TYR A 38 ? TYR A 143 . ? 1_555 ? 2 AC1 11 LEU A 71 ? LEU A 223 . ? 1_555 ? 3 AC1 11 SER A 81 ? SER A 233 . ? 1_555 ? 4 AC1 11 ILE A 115 ? ILE A 267 . ? 1_555 ? 5 AC1 11 ARG A 118 ? ARG A 270 . ? 1_555 ? 6 AC1 11 SER A 119 ? SER A 271 . ? 1_555 ? 7 AC1 11 SER A 122 ? SER A 274 . ? 1_555 ? 8 AC1 11 TRP A 130 ? TRP A 282 . ? 1_555 ? 9 AC1 11 CYS A 132 ? CYS A 284 . ? 1_555 ? 10 AC1 11 HIS A 149 ? HIS A 301 . ? 1_555 ? 11 AC1 11 HIS A 241 ? HIS A 393 . ? 1_555 ? # _atom_sites.entry_id 5XZH _atom_sites.fract_transf_matrix[1][1] 0.006508 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000636 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023945 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023917 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 106 ? ? ? A . n A 1 2 SER 2 107 ? ? ? A . n A 1 3 HIS 3 108 ? ? ? A . n A 1 4 MET 4 109 ? ? ? A . n A 1 5 GLY 5 110 ? ? ? A . n A 1 6 SER 6 111 ? ? ? A . n A 1 7 PRO 7 112 ? ? ? A . n A 1 8 ASN 8 113 ? ? ? A . n A 1 9 SER 9 114 ? ? ? A . n A 1 10 PRO 10 115 ? ? ? A . n A 1 11 LEU 11 116 ? ? ? A . n A 1 12 LYS 12 117 ? ? ? A . n A 1 13 ASP 13 118 ? ? ? A . n A 1 14 SER 14 119 ? ? ? A . n A 1 15 LEU 15 120 ? ? ? A . n A 1 16 ARG 16 121 121 ARG ARG A . n A 1 17 PRO 17 122 122 PRO PRO A . n A 1 18 LYS 18 123 123 LYS LYS A . n A 1 19 LEU 19 124 124 LEU LEU A . n A 1 20 SER 20 125 125 SER SER A . n A 1 21 GLU 21 126 126 GLU GLU A . n A 1 22 GLU 22 127 127 GLU GLU A . n A 1 23 GLN 23 128 128 GLN GLN A . n A 1 24 GLN 24 129 129 GLN GLN A . n A 1 25 HIS 25 130 130 HIS HIS A . n A 1 26 ILE 26 131 131 ILE ILE A . n A 1 27 ILE 27 132 132 ILE ILE A . n A 1 28 ALA 28 133 133 ALA ALA A . n A 1 29 ILE 29 134 134 ILE ILE A . n A 1 30 LEU 30 135 135 LEU LEU A . n A 1 31 LEU 31 136 136 LEU LEU A . n A 1 32 ASP 32 137 137 ASP ASP A . n A 1 33 ALA 33 138 138 ALA ALA A . n A 1 34 HIS 34 139 139 HIS HIS A . n A 1 35 HIS 35 140 140 HIS HIS A . n A 1 36 LYS 36 141 141 LYS LYS A . n A 1 37 THR 37 142 142 THR THR A . n A 1 38 TYR 38 143 143 TYR TYR A . n A 1 39 ASP 39 144 144 ASP ASP A . n A 1 40 PRO 40 145 145 PRO PRO A . n A 1 41 THR 41 146 146 THR THR A . n A 1 42 TYR 42 147 147 TYR TYR A . n A 1 43 ALA 43 148 148 ALA ALA A . n A 1 44 ASP 44 149 149 ASP ASP A . n A 1 45 PHE 45 150 150 PHE PHE A . n A 1 46 ARG 46 151 151 ARG ARG A . n A 1 47 ASP 47 152 152 ASP ASP A . n A 1 48 PHE 48 153 153 PHE PHE A . n A 1 49 ARG 49 154 154 ARG ARG A . n A 1 50 PRO 50 155 155 PRO PRO A . n A 1 51 PRO 51 156 156 PRO PRO A . n A 1 52 VAL 52 157 157 VAL VAL A . n A 1 53 ARG 53 158 158 ARG ARG A . n A 1 54 MET 54 206 ? ? ? A . n A 1 55 ASP 55 207 ? ? ? A . n A 1 56 GLY 56 208 ? ? ? A . n A 1 57 SER 57 209 ? ? ? A . n A 1 58 THR 58 210 ? ? ? A . n A 1 59 GLY 59 211 ? ? ? A . n A 1 60 SER 60 212 ? ? ? A . n A 1 61 VAL 61 213 ? ? ? A . n A 1 62 THR 62 214 ? ? ? A . n A 1 63 LEU 63 215 ? ? ? A . n A 1 64 ASP 64 216 ? ? ? A . n A 1 65 LEU 65 217 ? ? ? A . n A 1 66 SER 66 218 ? ? ? A . n A 1 67 PRO 67 219 219 PRO PRO A . n A 1 68 LEU 68 220 220 LEU LEU A . n A 1 69 SER 69 221 221 SER SER A . n A 1 70 MET 70 222 222 MET MET A . n A 1 71 LEU 71 223 223 LEU LEU A . n A 1 72 PRO 72 224 224 PRO PRO A . n A 1 73 HIS 73 225 225 HIS HIS A . n A 1 74 LEU 74 226 226 LEU LEU A . n A 1 75 ALA 75 227 227 ALA ALA A . n A 1 76 ASP 76 228 228 ASP ASP A . n A 1 77 LEU 77 229 229 LEU LEU A . n A 1 78 VAL 78 230 230 VAL VAL A . n A 1 79 SER 79 231 231 SER SER A . n A 1 80 TYR 80 232 232 TYR TYR A . n A 1 81 SER 81 233 233 SER SER A . n A 1 82 ILE 82 234 234 ILE ILE A . n A 1 83 GLN 83 235 235 GLN GLN A . n A 1 84 LYS 84 236 236 LYS LYS A . n A 1 85 VAL 85 237 237 VAL VAL A . n A 1 86 ILE 86 238 238 ILE ILE A . n A 1 87 GLY 87 239 239 GLY GLY A . n A 1 88 PHE 88 240 240 PHE PHE A . n A 1 89 ALA 89 241 241 ALA ALA A . n A 1 90 LYS 90 242 242 LYS LYS A . n A 1 91 MET 91 243 243 MET MET A . n A 1 92 ILE 92 244 244 ILE ILE A . n A 1 93 PRO 93 245 245 PRO PRO A . n A 1 94 GLY 94 246 246 GLY GLY A . n A 1 95 PHE 95 247 247 PHE PHE A . n A 1 96 ARG 96 248 248 ARG ARG A . n A 1 97 ASP 97 249 249 ASP ASP A . n A 1 98 LEU 98 250 250 LEU LEU A . n A 1 99 THR 99 251 251 THR THR A . n A 1 100 SER 100 252 252 SER SER A . n A 1 101 ASP 101 253 253 ASP ASP A . n A 1 102 ASP 102 254 254 ASP ASP A . n A 1 103 GLN 103 255 255 GLN GLN A . n A 1 104 ILE 104 256 256 ILE ILE A . n A 1 105 VAL 105 257 257 VAL VAL A . n A 1 106 LEU 106 258 258 LEU LEU A . n A 1 107 LEU 107 259 259 LEU LEU A . n A 1 108 LYS 108 260 260 LYS LYS A . n A 1 109 SER 109 261 261 SER SER A . n A 1 110 SER 110 262 262 SER SER A . n A 1 111 ALA 111 263 263 ALA ALA A . n A 1 112 ILE 112 264 264 ILE ILE A . n A 1 113 GLU 113 265 265 GLU GLU A . n A 1 114 VAL 114 266 266 VAL VAL A . n A 1 115 ILE 115 267 267 ILE ILE A . n A 1 116 MET 116 268 268 MET MET A . n A 1 117 LEU 117 269 269 LEU LEU A . n A 1 118 ARG 118 270 270 ARG ARG A . n A 1 119 SER 119 271 271 SER SER A . n A 1 120 ASN 120 272 272 ASN ASN A . n A 1 121 GLN 121 273 273 GLN GLN A . n A 1 122 SER 122 274 274 SER SER A . n A 1 123 PHE 123 275 275 PHE PHE A . n A 1 124 THR 124 276 276 THR THR A . n A 1 125 MET 125 277 277 MET MET A . n A 1 126 ASP 126 278 278 ASP ASP A . n A 1 127 ASP 127 279 279 ASP ASP A . n A 1 128 MET 128 280 280 MET MET A . n A 1 129 SER 129 281 281 SER SER A . n A 1 130 TRP 130 282 282 TRP TRP A . n A 1 131 ASP 131 283 283 ASP ASP A . n A 1 132 CYS 132 284 284 CYS CYS A . n A 1 133 GLY 133 285 285 GLY GLY A . n A 1 134 SER 134 286 286 SER SER A . n A 1 135 GLN 135 287 287 GLN GLN A . n A 1 136 ASP 136 288 288 ASP ASP A . n A 1 137 TYR 137 289 289 TYR TYR A . n A 1 138 LYS 138 290 290 LYS LYS A . n A 1 139 TYR 139 291 291 TYR TYR A . n A 1 140 ASP 140 292 292 ASP ASP A . n A 1 141 VAL 141 293 293 VAL VAL A . n A 1 142 THR 142 294 294 THR THR A . n A 1 143 ASP 143 295 295 ASP ASP A . n A 1 144 VAL 144 296 296 VAL VAL A . n A 1 145 SER 145 297 297 SER SER A . n A 1 146 LYS 146 298 298 LYS LYS A . n A 1 147 ALA 147 299 299 ALA ALA A . n A 1 148 GLY 148 300 300 GLY GLY A . n A 1 149 HIS 149 301 301 HIS HIS A . n A 1 150 THR 150 302 302 THR THR A . n A 1 151 LEU 151 303 303 LEU LEU A . n A 1 152 GLU 152 304 304 GLU GLU A . n A 1 153 LEU 153 305 305 LEU LEU A . n A 1 154 ILE 154 306 306 ILE ILE A . n A 1 155 GLU 155 307 307 GLU GLU A . n A 1 156 PRO 156 308 308 PRO PRO A . n A 1 157 LEU 157 309 309 LEU LEU A . n A 1 158 ILE 158 310 310 ILE ILE A . n A 1 159 LYS 159 311 311 LYS LYS A . n A 1 160 PHE 160 312 312 PHE PHE A . n A 1 161 GLN 161 313 313 GLN GLN A . n A 1 162 VAL 162 314 314 VAL VAL A . n A 1 163 GLY 163 315 315 GLY GLY A . n A 1 164 LEU 164 316 316 LEU LEU A . n A 1 165 LYS 165 317 317 LYS LYS A . n A 1 166 LYS 166 318 318 LYS LYS A . n A 1 167 LEU 167 319 319 LEU LEU A . n A 1 168 ASN 168 320 320 ASN ASN A . n A 1 169 LEU 169 321 321 LEU LEU A . n A 1 170 HIS 170 322 322 HIS HIS A . n A 1 171 GLU 171 323 323 GLU GLU A . n A 1 172 GLU 172 324 324 GLU GLU A . n A 1 173 GLU 173 325 325 GLU GLU A . n A 1 174 HIS 174 326 326 HIS HIS A . n A 1 175 VAL 175 327 327 VAL VAL A . n A 1 176 LEU 176 328 328 LEU LEU A . n A 1 177 LEU 177 329 329 LEU LEU A . n A 1 178 MET 178 330 330 MET MET A . n A 1 179 ALA 179 331 331 ALA ALA A . n A 1 180 ILE 180 332 332 ILE ILE A . n A 1 181 CYS 181 333 333 CYS CYS A . n A 1 182 ILE 182 334 334 ILE ILE A . n A 1 183 VAL 183 335 335 VAL VAL A . n A 1 184 SER 184 336 336 SER SER A . n A 1 185 PRO 185 337 337 PRO PRO A . n A 1 186 ASP 186 338 338 ASP ASP A . n A 1 187 ARG 187 339 339 ARG ARG A . n A 1 188 PRO 188 340 340 PRO PRO A . n A 1 189 GLY 189 341 341 GLY GLY A . n A 1 190 VAL 190 342 342 VAL VAL A . n A 1 191 GLN 191 343 343 GLN GLN A . n A 1 192 ASP 192 344 344 ASP ASP A . n A 1 193 ALA 193 345 345 ALA ALA A . n A 1 194 LYS 194 346 346 LYS LYS A . n A 1 195 LEU 195 347 347 LEU LEU A . n A 1 196 VAL 196 348 348 VAL VAL A . n A 1 197 GLU 197 349 349 GLU GLU A . n A 1 198 ALA 198 350 350 ALA ALA A . n A 1 199 ILE 199 351 351 ILE ILE A . n A 1 200 GLN 200 352 352 GLN GLN A . n A 1 201 ASP 201 353 353 ASP ASP A . n A 1 202 ARG 202 354 354 ARG ARG A . n A 1 203 LEU 203 355 355 LEU LEU A . n A 1 204 SER 204 356 356 SER SER A . n A 1 205 ASN 205 357 357 ASN ASN A . n A 1 206 THR 206 358 358 THR THR A . n A 1 207 LEU 207 359 359 LEU LEU A . n A 1 208 GLN 208 360 360 GLN GLN A . n A 1 209 THR 209 361 361 THR THR A . n A 1 210 TYR 210 362 362 TYR TYR A . n A 1 211 ILE 211 363 363 ILE ILE A . n A 1 212 ARG 212 364 364 ARG ARG A . n A 1 213 CYS 213 365 365 CYS CYS A . n A 1 214 ARG 214 366 366 ARG ARG A . n A 1 215 HIS 215 367 367 HIS HIS A . n A 1 216 PRO 216 368 368 PRO PRO A . n A 1 217 PRO 217 369 369 PRO PRO A . n A 1 218 PRO 218 370 370 PRO PRO A . n A 1 219 GLY 219 371 371 GLY GLY A . n A 1 220 SER 220 372 372 SER SER A . n A 1 221 HIS 221 373 373 HIS HIS A . n A 1 222 GLN 222 374 374 GLN GLN A . n A 1 223 LEU 223 375 375 LEU LEU A . n A 1 224 TYR 224 376 376 TYR TYR A . n A 1 225 ALA 225 377 377 ALA ALA A . n A 1 226 LYS 226 378 378 LYS LYS A . n A 1 227 MET 227 379 379 MET MET A . n A 1 228 ILE 228 380 380 ILE ILE A . n A 1 229 GLN 229 381 381 GLN GLN A . n A 1 230 LYS 230 382 382 LYS LYS A . n A 1 231 LEU 231 383 383 LEU LEU A . n A 1 232 ALA 232 384 384 ALA ALA A . n A 1 233 ASP 233 385 385 ASP ASP A . n A 1 234 LEU 234 386 386 LEU LEU A . n A 1 235 ARG 235 387 387 ARG ARG A . n A 1 236 SER 236 388 388 SER SER A . n A 1 237 LEU 237 389 389 LEU LEU A . n A 1 238 ASN 238 390 390 ASN ASN A . n A 1 239 GLU 239 391 391 GLU GLU A . n A 1 240 GLU 240 392 392 GLU GLU A . n A 1 241 HIS 241 393 393 HIS HIS A . n A 1 242 SER 242 394 394 SER SER A . n A 1 243 LYS 243 395 395 LYS LYS A . n A 1 244 GLN 244 396 396 GLN GLN A . n A 1 245 TYR 245 397 397 TYR TYR A . n A 1 246 ARG 246 398 398 ARG ARG A . n A 1 247 SER 247 399 399 SER SER A . n A 1 248 LEU 248 400 400 LEU LEU A . n A 1 249 SER 249 401 401 SER SER A . n A 1 250 PHE 250 402 402 PHE PHE A . n A 1 251 GLN 251 403 403 GLN GLN A . n A 1 252 PRO 252 404 404 PRO PRO A . n A 1 253 GLU 253 405 405 GLU GLU A . n A 1 254 ASN 254 406 406 ASN ASN A . n A 1 255 SER 255 407 407 SER SER A . n A 1 256 MET 256 408 408 MET MET A . n A 1 257 LYS 257 409 409 LYS LYS A . n A 1 258 LEU 258 410 410 LEU LEU A . n A 1 259 THR 259 411 411 THR THR A . n A 1 260 PRO 260 412 412 PRO PRO A . n A 1 261 LEU 261 413 413 LEU LEU A . n A 1 262 VAL 262 414 414 VAL VAL A . n A 1 263 LEU 263 415 415 LEU LEU A . n A 1 264 GLU 264 416 416 GLU GLU A . n A 1 265 VAL 265 417 417 VAL VAL A . n A 1 266 PHE 266 418 418 PHE PHE A . n A 1 267 GLY 267 419 419 GLY GLY A . n A 1 268 ASN 268 420 ? ? ? A . n A 1 269 GLU 269 421 ? ? ? A . n A 1 270 ILE 270 422 ? ? ? A . n A 1 271 SER 271 423 ? ? ? A . n B 2 1 LYS 1 625 ? ? ? C . n B 2 2 ASN 2 626 626 ASN ASN C . n B 2 3 HIS 3 627 627 HIS HIS C . n B 2 4 PRO 4 628 628 PRO PRO C . n B 2 5 MET 5 629 629 MET MET C . n B 2 6 LEU 6 630 630 LEU LEU C . n B 2 7 MET 7 631 631 MET MET C . n B 2 8 ASN 8 632 632 ASN ASN C . n B 2 9 LEU 9 633 633 LEU LEU C . n B 2 10 LEU 10 634 634 LEU LEU C . n B 2 11 LYS 11 635 635 LYS LYS C . n B 2 12 ASP 12 636 636 ASP ASP C . n B 2 13 ASN 13 637 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 8J3 1 501 1 8J3 RC2 A . D 4 HOH 1 601 7 HOH HOH A . D 4 HOH 2 602 12 HOH HOH A . D 4 HOH 3 603 5 HOH HOH A . D 4 HOH 4 604 8 HOH HOH A . D 4 HOH 5 605 3 HOH HOH A . D 4 HOH 6 606 11 HOH HOH A . D 4 HOH 7 607 4 HOH HOH A . D 4 HOH 8 608 10 HOH HOH A . D 4 HOH 9 609 1 HOH HOH A . D 4 HOH 10 610 9 HOH HOH A . D 4 HOH 11 611 6 HOH HOH A . D 4 HOH 12 612 2 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1110 ? 1 MORE -9 ? 1 'SSA (A^2)' 11770 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-07-25 2 'Structure model' 1 1 2018-08-01 3 'Structure model' 1 2 2018-08-29 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 2 'Structure model' '_citation_author.name' 12 3 'Structure model' '_citation.journal_volume' 13 3 'Structure model' '_citation.page_first' 14 3 'Structure model' '_citation.page_last' 15 3 'Structure model' '_citation.title' 16 4 'Structure model' '_database_2.pdbx_DOI' 17 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 284 ? ? -104.32 54.79 2 1 TYR A 289 ? ? -101.74 48.49 3 1 GLN A 343 ? ? -88.72 -74.58 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 121 ? CG ? A ARG 16 CG 2 1 Y 1 A ARG 121 ? CD ? A ARG 16 CD 3 1 Y 1 A ARG 121 ? NE ? A ARG 16 NE 4 1 Y 1 A ARG 121 ? CZ ? A ARG 16 CZ 5 1 Y 1 A ARG 121 ? NH1 ? A ARG 16 NH1 6 1 Y 1 A ARG 121 ? NH2 ? A ARG 16 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 106 ? A GLY 1 2 1 Y 1 A SER 107 ? A SER 2 3 1 Y 1 A HIS 108 ? A HIS 3 4 1 Y 1 A MET 109 ? A MET 4 5 1 Y 1 A GLY 110 ? A GLY 5 6 1 Y 1 A SER 111 ? A SER 6 7 1 Y 1 A PRO 112 ? A PRO 7 8 1 Y 1 A ASN 113 ? A ASN 8 9 1 Y 1 A SER 114 ? A SER 9 10 1 Y 1 A PRO 115 ? A PRO 10 11 1 Y 1 A LEU 116 ? A LEU 11 12 1 Y 1 A LYS 117 ? A LYS 12 13 1 Y 1 A ASP 118 ? A ASP 13 14 1 Y 1 A SER 119 ? A SER 14 15 1 Y 1 A LEU 120 ? A LEU 15 16 1 Y 1 A MET 206 ? A MET 54 17 1 Y 1 A ASP 207 ? A ASP 55 18 1 Y 1 A GLY 208 ? A GLY 56 19 1 Y 1 A SER 209 ? A SER 57 20 1 Y 1 A THR 210 ? A THR 58 21 1 Y 1 A GLY 211 ? A GLY 59 22 1 Y 1 A SER 212 ? A SER 60 23 1 Y 1 A VAL 213 ? A VAL 61 24 1 Y 1 A THR 214 ? A THR 62 25 1 Y 1 A LEU 215 ? A LEU 63 26 1 Y 1 A ASP 216 ? A ASP 64 27 1 Y 1 A LEU 217 ? A LEU 65 28 1 Y 1 A SER 218 ? A SER 66 29 1 Y 1 A ASN 420 ? A ASN 268 30 1 Y 1 A GLU 421 ? A GLU 269 31 1 Y 1 A ILE 422 ? A ILE 270 32 1 Y 1 A SER 423 ? A SER 271 33 1 Y 1 C LYS 625 ? B LYS 1 34 1 Y 1 C ASN 637 ? B ASN 13 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 8J3 C01 C N R 1 8J3 O01 O N N 2 8J3 C02 C N N 3 8J3 C03 C N S 4 8J3 C04 C N N 5 8J3 C05 C N N 6 8J3 C06 C N N 7 8J3 C07 C N N 8 8J3 C08 C N N 9 8J3 C09 C N N 10 8J3 C10 C N N 11 8J3 C11 C N N 12 8J3 C12 C N N 13 8J3 C13 C N R 14 8J3 C14 C N S 15 8J3 C15 C N N 16 8J3 C16 C N N 17 8J3 O02 O N N 18 8J3 C39 C N N 19 8J3 C18 C N N 20 8J3 C17 C N R 21 8J3 C20 C N R 22 8J3 C21 C N N 23 8J3 C22 C N N 24 8J3 C23 C N N 25 8J3 C24 C N N 26 8J3 C25 C N R 27 8J3 O03 O N N 28 8J3 C29 C N N 29 8J3 C34 C N N 30 8J3 C37 C N N 31 8J3 C35 C N N 32 8J3 C38 C N N 33 8J3 C33 C N N 34 8J3 C32 C N N 35 8J3 C36 C N N 36 8J3 C31 C N N 37 8J3 C30 C N N 38 8J3 H1 H N N 39 8J3 H2 H N N 40 8J3 H3 H N N 41 8J3 H4 H N N 42 8J3 H5 H N N 43 8J3 H6 H N N 44 8J3 H7 H N N 45 8J3 H8 H N N 46 8J3 H9 H N N 47 8J3 H10 H N N 48 8J3 H11 H N N 49 8J3 H12 H N N 50 8J3 H13 H N N 51 8J3 H14 H N N 52 8J3 H15 H N N 53 8J3 H16 H N N 54 8J3 H17 H N N 55 8J3 H18 H N N 56 8J3 H19 H N N 57 8J3 H20 H N N 58 8J3 H21 H N N 59 8J3 H22 H N N 60 8J3 H23 H N N 61 8J3 H24 H N N 62 8J3 H25 H N N 63 8J3 H26 H N N 64 8J3 H27 H N N 65 8J3 H28 H N N 66 8J3 H29 H N N 67 8J3 H30 H N N 68 8J3 H31 H N N 69 8J3 H32 H N N 70 8J3 H33 H N N 71 8J3 H34 H N N 72 8J3 H35 H N N 73 8J3 H36 H N N 74 8J3 H37 H N N 75 8J3 H38 H N N 76 8J3 H39 H N N 77 8J3 H40 H N N 78 8J3 H41 H N N 79 8J3 H42 H N N 80 8J3 H43 H N N 81 8J3 H44 H N N 82 8J3 H45 H N N 83 8J3 H46 H N N 84 8J3 H47 H N N 85 8J3 H48 H N N 86 8J3 H49 H N N 87 8J3 H50 H N N 88 ALA N N N N 89 ALA CA C N S 90 ALA C C N N 91 ALA O O N N 92 ALA CB C N N 93 ALA OXT O N N 94 ALA H H N N 95 ALA H2 H N N 96 ALA HA H N N 97 ALA HB1 H N N 98 ALA HB2 H N N 99 ALA HB3 H N N 100 ALA HXT H N N 101 ARG N N N N 102 ARG CA C N S 103 ARG C C N N 104 ARG O O N N 105 ARG CB C N N 106 ARG CG C N N 107 ARG CD C N N 108 ARG NE N N N 109 ARG CZ C N N 110 ARG NH1 N N N 111 ARG NH2 N N N 112 ARG OXT O N N 113 ARG H H N N 114 ARG H2 H N N 115 ARG HA H N N 116 ARG HB2 H N N 117 ARG HB3 H N N 118 ARG HG2 H N N 119 ARG HG3 H N N 120 ARG HD2 H N N 121 ARG HD3 H N N 122 ARG HE H N N 123 ARG HH11 H N N 124 ARG HH12 H N N 125 ARG HH21 H N N 126 ARG HH22 H N N 127 ARG HXT H N N 128 ASN N N N N 129 ASN CA C N S 130 ASN C C N N 131 ASN O O N N 132 ASN CB C N N 133 ASN CG C N N 134 ASN OD1 O N N 135 ASN ND2 N N N 136 ASN OXT O N N 137 ASN H H N N 138 ASN H2 H N N 139 ASN HA H N N 140 ASN HB2 H N N 141 ASN HB3 H N N 142 ASN HD21 H N N 143 ASN HD22 H N N 144 ASN HXT H N N 145 ASP N N N N 146 ASP CA C N S 147 ASP C C N N 148 ASP O O N N 149 ASP CB C N N 150 ASP CG C N N 151 ASP OD1 O N N 152 ASP OD2 O N N 153 ASP OXT O N N 154 ASP H H N N 155 ASP H2 H N N 156 ASP HA H N N 157 ASP HB2 H N N 158 ASP HB3 H N N 159 ASP HD2 H N N 160 ASP HXT H N N 161 CYS N N N N 162 CYS CA C N R 163 CYS C C N N 164 CYS O O N N 165 CYS CB C N N 166 CYS SG S N N 167 CYS OXT O N N 168 CYS H H N N 169 CYS H2 H N N 170 CYS HA H N N 171 CYS HB2 H N N 172 CYS HB3 H N N 173 CYS HG H N N 174 CYS HXT H N N 175 GLN N N N N 176 GLN CA C N S 177 GLN C C N N 178 GLN O O N N 179 GLN CB C N N 180 GLN CG C N N 181 GLN CD C N N 182 GLN OE1 O N N 183 GLN NE2 N N N 184 GLN OXT O N N 185 GLN H H N N 186 GLN H2 H N N 187 GLN HA H N N 188 GLN HB2 H N N 189 GLN HB3 H N N 190 GLN HG2 H N N 191 GLN HG3 H N N 192 GLN HE21 H N N 193 GLN HE22 H N N 194 GLN HXT H N N 195 GLU N N N N 196 GLU CA C N S 197 GLU C C N N 198 GLU O O N N 199 GLU CB C N N 200 GLU CG C N N 201 GLU CD C N N 202 GLU OE1 O N N 203 GLU OE2 O N N 204 GLU OXT O N N 205 GLU H H N N 206 GLU H2 H N N 207 GLU HA H N N 208 GLU HB2 H N N 209 GLU HB3 H N N 210 GLU HG2 H N N 211 GLU HG3 H N N 212 GLU HE2 H N N 213 GLU HXT H N N 214 GLY N N N N 215 GLY CA C N N 216 GLY C C N N 217 GLY O O N N 218 GLY OXT O N N 219 GLY H H N N 220 GLY H2 H N N 221 GLY HA2 H N N 222 GLY HA3 H N N 223 GLY HXT H N N 224 HIS N N N N 225 HIS CA C N S 226 HIS C C N N 227 HIS O O N N 228 HIS CB C N N 229 HIS CG C Y N 230 HIS ND1 N Y N 231 HIS CD2 C Y N 232 HIS CE1 C Y N 233 HIS NE2 N Y N 234 HIS OXT O N N 235 HIS H H N N 236 HIS H2 H N N 237 HIS HA H N N 238 HIS HB2 H N N 239 HIS HB3 H N N 240 HIS HD1 H N N 241 HIS HD2 H N N 242 HIS HE1 H N N 243 HIS HE2 H N N 244 HIS HXT H N N 245 HOH O O N N 246 HOH H1 H N N 247 HOH H2 H N N 248 ILE N N N N 249 ILE CA C N S 250 ILE C C N N 251 ILE O O N N 252 ILE CB C N S 253 ILE CG1 C N N 254 ILE CG2 C N N 255 ILE CD1 C N N 256 ILE OXT O N N 257 ILE H H N N 258 ILE H2 H N N 259 ILE HA H N N 260 ILE HB H N N 261 ILE HG12 H N N 262 ILE HG13 H N N 263 ILE HG21 H N N 264 ILE HG22 H N N 265 ILE HG23 H N N 266 ILE HD11 H N N 267 ILE HD12 H N N 268 ILE HD13 H N N 269 ILE HXT H N N 270 LEU N N N N 271 LEU CA C N S 272 LEU C C N N 273 LEU O O N N 274 LEU CB C N N 275 LEU CG C N N 276 LEU CD1 C N N 277 LEU CD2 C N N 278 LEU OXT O N N 279 LEU H H N N 280 LEU H2 H N N 281 LEU HA H N N 282 LEU HB2 H N N 283 LEU HB3 H N N 284 LEU HG H N N 285 LEU HD11 H N N 286 LEU HD12 H N N 287 LEU HD13 H N N 288 LEU HD21 H N N 289 LEU HD22 H N N 290 LEU HD23 H N N 291 LEU HXT H N N 292 LYS N N N N 293 LYS CA C N S 294 LYS C C N N 295 LYS O O N N 296 LYS CB C N N 297 LYS CG C N N 298 LYS CD C N N 299 LYS CE C N N 300 LYS NZ N N N 301 LYS OXT O N N 302 LYS H H N N 303 LYS H2 H N N 304 LYS HA H N N 305 LYS HB2 H N N 306 LYS HB3 H N N 307 LYS HG2 H N N 308 LYS HG3 H N N 309 LYS HD2 H N N 310 LYS HD3 H N N 311 LYS HE2 H N N 312 LYS HE3 H N N 313 LYS HZ1 H N N 314 LYS HZ2 H N N 315 LYS HZ3 H N N 316 LYS HXT H N N 317 MET N N N N 318 MET CA C N S 319 MET C C N N 320 MET O O N N 321 MET CB C N N 322 MET CG C N N 323 MET SD S N N 324 MET CE C N N 325 MET OXT O N N 326 MET H H N N 327 MET H2 H N N 328 MET HA H N N 329 MET HB2 H N N 330 MET HB3 H N N 331 MET HG2 H N N 332 MET HG3 H N N 333 MET HE1 H N N 334 MET HE2 H N N 335 MET HE3 H N N 336 MET HXT H N N 337 PHE N N N N 338 PHE CA C N S 339 PHE C C N N 340 PHE O O N N 341 PHE CB C N N 342 PHE CG C Y N 343 PHE CD1 C Y N 344 PHE CD2 C Y N 345 PHE CE1 C Y N 346 PHE CE2 C Y N 347 PHE CZ C Y N 348 PHE OXT O N N 349 PHE H H N N 350 PHE H2 H N N 351 PHE HA H N N 352 PHE HB2 H N N 353 PHE HB3 H N N 354 PHE HD1 H N N 355 PHE HD2 H N N 356 PHE HE1 H N N 357 PHE HE2 H N N 358 PHE HZ H N N 359 PHE HXT H N N 360 PRO N N N N 361 PRO CA C N S 362 PRO C C N N 363 PRO O O N N 364 PRO CB C N N 365 PRO CG C N N 366 PRO CD C N N 367 PRO OXT O N N 368 PRO H H N N 369 PRO HA H N N 370 PRO HB2 H N N 371 PRO HB3 H N N 372 PRO HG2 H N N 373 PRO HG3 H N N 374 PRO HD2 H N N 375 PRO HD3 H N N 376 PRO HXT H N N 377 SER N N N N 378 SER CA C N S 379 SER C C N N 380 SER O O N N 381 SER CB C N N 382 SER OG O N N 383 SER OXT O N N 384 SER H H N N 385 SER H2 H N N 386 SER HA H N N 387 SER HB2 H N N 388 SER HB3 H N N 389 SER HG H N N 390 SER HXT H N N 391 THR N N N N 392 THR CA C N S 393 THR C C N N 394 THR O O N N 395 THR CB C N R 396 THR OG1 O N N 397 THR CG2 C N N 398 THR OXT O N N 399 THR H H N N 400 THR H2 H N N 401 THR HA H N N 402 THR HB H N N 403 THR HG1 H N N 404 THR HG21 H N N 405 THR HG22 H N N 406 THR HG23 H N N 407 THR HXT H N N 408 TRP N N N N 409 TRP CA C N S 410 TRP C C N N 411 TRP O O N N 412 TRP CB C N N 413 TRP CG C Y N 414 TRP CD1 C Y N 415 TRP CD2 C Y N 416 TRP NE1 N Y N 417 TRP CE2 C Y N 418 TRP CE3 C Y N 419 TRP CZ2 C Y N 420 TRP CZ3 C Y N 421 TRP CH2 C Y N 422 TRP OXT O N N 423 TRP H H N N 424 TRP H2 H N N 425 TRP HA H N N 426 TRP HB2 H N N 427 TRP HB3 H N N 428 TRP HD1 H N N 429 TRP HE1 H N N 430 TRP HE3 H N N 431 TRP HZ2 H N N 432 TRP HZ3 H N N 433 TRP HH2 H N N 434 TRP HXT H N N 435 TYR N N N N 436 TYR CA C N S 437 TYR C C N N 438 TYR O O N N 439 TYR CB C N N 440 TYR CG C Y N 441 TYR CD1 C Y N 442 TYR CD2 C Y N 443 TYR CE1 C Y N 444 TYR CE2 C Y N 445 TYR CZ C Y N 446 TYR OH O N N 447 TYR OXT O N N 448 TYR H H N N 449 TYR H2 H N N 450 TYR HA H N N 451 TYR HB2 H N N 452 TYR HB3 H N N 453 TYR HD1 H N N 454 TYR HD2 H N N 455 TYR HE1 H N N 456 TYR HE2 H N N 457 TYR HH H N N 458 TYR HXT H N N 459 VAL N N N N 460 VAL CA C N S 461 VAL C C N N 462 VAL O O N N 463 VAL CB C N N 464 VAL CG1 C N N 465 VAL CG2 C N N 466 VAL OXT O N N 467 VAL H H N N 468 VAL H2 H N N 469 VAL HA H N N 470 VAL HB H N N 471 VAL HG11 H N N 472 VAL HG12 H N N 473 VAL HG13 H N N 474 VAL HG21 H N N 475 VAL HG22 H N N 476 VAL HG23 H N N 477 VAL HXT H N N 478 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 8J3 O02 C03 sing N N 1 8J3 C02 C03 sing N N 2 8J3 C02 C01 sing N N 3 8J3 C03 C04 sing N N 4 8J3 C01 O01 sing N N 5 8J3 C01 C10 sing N N 6 8J3 C04 C39 doub N N 7 8J3 C04 C05 sing N N 8 8J3 C10 C05 sing N N 9 8J3 C05 C06 doub N Z 10 8J3 C06 C07 sing N N 11 8J3 C07 C08 doub N E 12 8J3 C08 C09 sing N N 13 8J3 C08 C14 sing N N 14 8J3 C18 C13 sing N N 15 8J3 C15 C14 sing N N 16 8J3 C15 C16 sing N N 17 8J3 C09 C11 sing N N 18 8J3 C14 C13 sing N N 19 8J3 C38 C33 sing N N 20 8J3 C38 C35 sing N N 21 8J3 C16 C17 sing N N 22 8J3 C11 C12 sing N N 23 8J3 C13 C17 sing N N 24 8J3 C13 C12 sing N N 25 8J3 C33 C34 sing N N 26 8J3 C33 C32 sing N N 27 8J3 C34 C29 sing N N 28 8J3 C17 C20 sing N N 29 8J3 O03 C25 sing N N 30 8J3 C35 C37 sing N N 31 8J3 C35 C36 sing N N 32 8J3 C20 C22 sing N N 33 8J3 C20 C21 sing N N 34 8J3 C37 C29 sing N N 35 8J3 C32 C31 sing N N 36 8J3 C29 C25 sing N N 37 8J3 C29 C30 sing N N 38 8J3 C22 C23 sing N N 39 8J3 C23 C24 trip N N 40 8J3 C24 C25 sing N N 41 8J3 C36 C31 sing N N 42 8J3 C31 C30 sing N N 43 8J3 C01 H1 sing N N 44 8J3 O01 H2 sing N N 45 8J3 C02 H3 sing N N 46 8J3 C02 H4 sing N N 47 8J3 C03 H5 sing N N 48 8J3 C06 H6 sing N N 49 8J3 C07 H7 sing N N 50 8J3 C09 H8 sing N N 51 8J3 C09 H9 sing N N 52 8J3 C10 H10 sing N N 53 8J3 C10 H11 sing N N 54 8J3 C11 H12 sing N N 55 8J3 C11 H13 sing N N 56 8J3 C12 H14 sing N N 57 8J3 C12 H15 sing N N 58 8J3 C14 H16 sing N N 59 8J3 C15 H17 sing N N 60 8J3 C15 H18 sing N N 61 8J3 C16 H19 sing N N 62 8J3 C16 H20 sing N N 63 8J3 O02 H21 sing N N 64 8J3 C39 H22 sing N N 65 8J3 C39 H23 sing N N 66 8J3 C18 H24 sing N N 67 8J3 C18 H25 sing N N 68 8J3 C18 H26 sing N N 69 8J3 C17 H27 sing N N 70 8J3 C20 H28 sing N N 71 8J3 C21 H29 sing N N 72 8J3 C21 H30 sing N N 73 8J3 C21 H31 sing N N 74 8J3 C22 H32 sing N N 75 8J3 C22 H33 sing N N 76 8J3 C25 H34 sing N N 77 8J3 O03 H35 sing N N 78 8J3 C34 H36 sing N N 79 8J3 C34 H37 sing N N 80 8J3 C37 H38 sing N N 81 8J3 C37 H39 sing N N 82 8J3 C35 H40 sing N N 83 8J3 C38 H41 sing N N 84 8J3 C38 H42 sing N N 85 8J3 C33 H43 sing N N 86 8J3 C32 H44 sing N N 87 8J3 C32 H45 sing N N 88 8J3 C36 H46 sing N N 89 8J3 C36 H47 sing N N 90 8J3 C31 H48 sing N N 91 8J3 C30 H49 sing N N 92 8J3 C30 H50 sing N N 93 ALA N CA sing N N 94 ALA N H sing N N 95 ALA N H2 sing N N 96 ALA CA C sing N N 97 ALA CA CB sing N N 98 ALA CA HA sing N N 99 ALA C O doub N N 100 ALA C OXT sing N N 101 ALA CB HB1 sing N N 102 ALA CB HB2 sing N N 103 ALA CB HB3 sing N N 104 ALA OXT HXT sing N N 105 ARG N CA sing N N 106 ARG N H sing N N 107 ARG N H2 sing N N 108 ARG CA C sing N N 109 ARG CA CB sing N N 110 ARG CA HA sing N N 111 ARG C O doub N N 112 ARG C OXT sing N N 113 ARG CB CG sing N N 114 ARG CB HB2 sing N N 115 ARG CB HB3 sing N N 116 ARG CG CD sing N N 117 ARG CG HG2 sing N N 118 ARG CG HG3 sing N N 119 ARG CD NE sing N N 120 ARG CD HD2 sing N N 121 ARG CD HD3 sing N N 122 ARG NE CZ sing N N 123 ARG NE HE sing N N 124 ARG CZ NH1 sing N N 125 ARG CZ NH2 doub N N 126 ARG NH1 HH11 sing N N 127 ARG NH1 HH12 sing N N 128 ARG NH2 HH21 sing N N 129 ARG NH2 HH22 sing N N 130 ARG OXT HXT sing N N 131 ASN N CA sing N N 132 ASN N H sing N N 133 ASN N H2 sing N N 134 ASN CA C sing N N 135 ASN CA CB sing N N 136 ASN CA HA sing N N 137 ASN C O doub N N 138 ASN C OXT sing N N 139 ASN CB CG sing N N 140 ASN CB HB2 sing N N 141 ASN CB HB3 sing N N 142 ASN CG OD1 doub N N 143 ASN CG ND2 sing N N 144 ASN ND2 HD21 sing N N 145 ASN ND2 HD22 sing N N 146 ASN OXT HXT sing N N 147 ASP N CA sing N N 148 ASP N H sing N N 149 ASP N H2 sing N N 150 ASP CA C sing N N 151 ASP CA CB sing N N 152 ASP CA HA sing N N 153 ASP C O doub N N 154 ASP C OXT sing N N 155 ASP CB CG sing N N 156 ASP CB HB2 sing N N 157 ASP CB HB3 sing N N 158 ASP CG OD1 doub N N 159 ASP CG OD2 sing N N 160 ASP OD2 HD2 sing N N 161 ASP OXT HXT sing N N 162 CYS N CA sing N N 163 CYS N H sing N N 164 CYS N H2 sing N N 165 CYS CA C sing N N 166 CYS CA CB sing N N 167 CYS CA HA sing N N 168 CYS C O doub N N 169 CYS C OXT sing N N 170 CYS CB SG sing N N 171 CYS CB HB2 sing N N 172 CYS CB HB3 sing N N 173 CYS SG HG sing N N 174 CYS OXT HXT sing N N 175 GLN N CA sing N N 176 GLN N H sing N N 177 GLN N H2 sing N N 178 GLN CA C sing N N 179 GLN CA CB sing N N 180 GLN CA HA sing N N 181 GLN C O doub N N 182 GLN C OXT sing N N 183 GLN CB CG sing N N 184 GLN CB HB2 sing N N 185 GLN CB HB3 sing N N 186 GLN CG CD sing N N 187 GLN CG HG2 sing N N 188 GLN CG HG3 sing N N 189 GLN CD OE1 doub N N 190 GLN CD NE2 sing N N 191 GLN NE2 HE21 sing N N 192 GLN NE2 HE22 sing N N 193 GLN OXT HXT sing N N 194 GLU N CA sing N N 195 GLU N H sing N N 196 GLU N H2 sing N N 197 GLU CA C sing N N 198 GLU CA CB sing N N 199 GLU CA HA sing N N 200 GLU C O doub N N 201 GLU C OXT sing N N 202 GLU CB CG sing N N 203 GLU CB HB2 sing N N 204 GLU CB HB3 sing N N 205 GLU CG CD sing N N 206 GLU CG HG2 sing N N 207 GLU CG HG3 sing N N 208 GLU CD OE1 doub N N 209 GLU CD OE2 sing N N 210 GLU OE2 HE2 sing N N 211 GLU OXT HXT sing N N 212 GLY N CA sing N N 213 GLY N H sing N N 214 GLY N H2 sing N N 215 GLY CA C sing N N 216 GLY CA HA2 sing N N 217 GLY CA HA3 sing N N 218 GLY C O doub N N 219 GLY C OXT sing N N 220 GLY OXT HXT sing N N 221 HIS N CA sing N N 222 HIS N H sing N N 223 HIS N H2 sing N N 224 HIS CA C sing N N 225 HIS CA CB sing N N 226 HIS CA HA sing N N 227 HIS C O doub N N 228 HIS C OXT sing N N 229 HIS CB CG sing N N 230 HIS CB HB2 sing N N 231 HIS CB HB3 sing N N 232 HIS CG ND1 sing Y N 233 HIS CG CD2 doub Y N 234 HIS ND1 CE1 doub Y N 235 HIS ND1 HD1 sing N N 236 HIS CD2 NE2 sing Y N 237 HIS CD2 HD2 sing N N 238 HIS CE1 NE2 sing Y N 239 HIS CE1 HE1 sing N N 240 HIS NE2 HE2 sing N N 241 HIS OXT HXT sing N N 242 HOH O H1 sing N N 243 HOH O H2 sing N N 244 ILE N CA sing N N 245 ILE N H sing N N 246 ILE N H2 sing N N 247 ILE CA C sing N N 248 ILE CA CB sing N N 249 ILE CA HA sing N N 250 ILE C O doub N N 251 ILE C OXT sing N N 252 ILE CB CG1 sing N N 253 ILE CB CG2 sing N N 254 ILE CB HB sing N N 255 ILE CG1 CD1 sing N N 256 ILE CG1 HG12 sing N N 257 ILE CG1 HG13 sing N N 258 ILE CG2 HG21 sing N N 259 ILE CG2 HG22 sing N N 260 ILE CG2 HG23 sing N N 261 ILE CD1 HD11 sing N N 262 ILE CD1 HD12 sing N N 263 ILE CD1 HD13 sing N N 264 ILE OXT HXT sing N N 265 LEU N CA sing N N 266 LEU N H sing N N 267 LEU N H2 sing N N 268 LEU CA C sing N N 269 LEU CA CB sing N N 270 LEU CA HA sing N N 271 LEU C O doub N N 272 LEU C OXT sing N N 273 LEU CB CG sing N N 274 LEU CB HB2 sing N N 275 LEU CB HB3 sing N N 276 LEU CG CD1 sing N N 277 LEU CG CD2 sing N N 278 LEU CG HG sing N N 279 LEU CD1 HD11 sing N N 280 LEU CD1 HD12 sing N N 281 LEU CD1 HD13 sing N N 282 LEU CD2 HD21 sing N N 283 LEU CD2 HD22 sing N N 284 LEU CD2 HD23 sing N N 285 LEU OXT HXT sing N N 286 LYS N CA sing N N 287 LYS N H sing N N 288 LYS N H2 sing N N 289 LYS CA C sing N N 290 LYS CA CB sing N N 291 LYS CA HA sing N N 292 LYS C O doub N N 293 LYS C OXT sing N N 294 LYS CB CG sing N N 295 LYS CB HB2 sing N N 296 LYS CB HB3 sing N N 297 LYS CG CD sing N N 298 LYS CG HG2 sing N N 299 LYS CG HG3 sing N N 300 LYS CD CE sing N N 301 LYS CD HD2 sing N N 302 LYS CD HD3 sing N N 303 LYS CE NZ sing N N 304 LYS CE HE2 sing N N 305 LYS CE HE3 sing N N 306 LYS NZ HZ1 sing N N 307 LYS NZ HZ2 sing N N 308 LYS NZ HZ3 sing N N 309 LYS OXT HXT sing N N 310 MET N CA sing N N 311 MET N H sing N N 312 MET N H2 sing N N 313 MET CA C sing N N 314 MET CA CB sing N N 315 MET CA HA sing N N 316 MET C O doub N N 317 MET C OXT sing N N 318 MET CB CG sing N N 319 MET CB HB2 sing N N 320 MET CB HB3 sing N N 321 MET CG SD sing N N 322 MET CG HG2 sing N N 323 MET CG HG3 sing N N 324 MET SD CE sing N N 325 MET CE HE1 sing N N 326 MET CE HE2 sing N N 327 MET CE HE3 sing N N 328 MET OXT HXT sing N N 329 PHE N CA sing N N 330 PHE N H sing N N 331 PHE N H2 sing N N 332 PHE CA C sing N N 333 PHE CA CB sing N N 334 PHE CA HA sing N N 335 PHE C O doub N N 336 PHE C OXT sing N N 337 PHE CB CG sing N N 338 PHE CB HB2 sing N N 339 PHE CB HB3 sing N N 340 PHE CG CD1 doub Y N 341 PHE CG CD2 sing Y N 342 PHE CD1 CE1 sing Y N 343 PHE CD1 HD1 sing N N 344 PHE CD2 CE2 doub Y N 345 PHE CD2 HD2 sing N N 346 PHE CE1 CZ doub Y N 347 PHE CE1 HE1 sing N N 348 PHE CE2 CZ sing Y N 349 PHE CE2 HE2 sing N N 350 PHE CZ HZ sing N N 351 PHE OXT HXT sing N N 352 PRO N CA sing N N 353 PRO N CD sing N N 354 PRO N H sing N N 355 PRO CA C sing N N 356 PRO CA CB sing N N 357 PRO CA HA sing N N 358 PRO C O doub N N 359 PRO C OXT sing N N 360 PRO CB CG sing N N 361 PRO CB HB2 sing N N 362 PRO CB HB3 sing N N 363 PRO CG CD sing N N 364 PRO CG HG2 sing N N 365 PRO CG HG3 sing N N 366 PRO CD HD2 sing N N 367 PRO CD HD3 sing N N 368 PRO OXT HXT sing N N 369 SER N CA sing N N 370 SER N H sing N N 371 SER N H2 sing N N 372 SER CA C sing N N 373 SER CA CB sing N N 374 SER CA HA sing N N 375 SER C O doub N N 376 SER C OXT sing N N 377 SER CB OG sing N N 378 SER CB HB2 sing N N 379 SER CB HB3 sing N N 380 SER OG HG sing N N 381 SER OXT HXT sing N N 382 THR N CA sing N N 383 THR N H sing N N 384 THR N H2 sing N N 385 THR CA C sing N N 386 THR CA CB sing N N 387 THR CA HA sing N N 388 THR C O doub N N 389 THR C OXT sing N N 390 THR CB OG1 sing N N 391 THR CB CG2 sing N N 392 THR CB HB sing N N 393 THR OG1 HG1 sing N N 394 THR CG2 HG21 sing N N 395 THR CG2 HG22 sing N N 396 THR CG2 HG23 sing N N 397 THR OXT HXT sing N N 398 TRP N CA sing N N 399 TRP N H sing N N 400 TRP N H2 sing N N 401 TRP CA C sing N N 402 TRP CA CB sing N N 403 TRP CA HA sing N N 404 TRP C O doub N N 405 TRP C OXT sing N N 406 TRP CB CG sing N N 407 TRP CB HB2 sing N N 408 TRP CB HB3 sing N N 409 TRP CG CD1 doub Y N 410 TRP CG CD2 sing Y N 411 TRP CD1 NE1 sing Y N 412 TRP CD1 HD1 sing N N 413 TRP CD2 CE2 doub Y N 414 TRP CD2 CE3 sing Y N 415 TRP NE1 CE2 sing Y N 416 TRP NE1 HE1 sing N N 417 TRP CE2 CZ2 sing Y N 418 TRP CE3 CZ3 doub Y N 419 TRP CE3 HE3 sing N N 420 TRP CZ2 CH2 doub Y N 421 TRP CZ2 HZ2 sing N N 422 TRP CZ3 CH2 sing Y N 423 TRP CZ3 HZ3 sing N N 424 TRP CH2 HH2 sing N N 425 TRP OXT HXT sing N N 426 TYR N CA sing N N 427 TYR N H sing N N 428 TYR N H2 sing N N 429 TYR CA C sing N N 430 TYR CA CB sing N N 431 TYR CA HA sing N N 432 TYR C O doub N N 433 TYR C OXT sing N N 434 TYR CB CG sing N N 435 TYR CB HB2 sing N N 436 TYR CB HB3 sing N N 437 TYR CG CD1 doub Y N 438 TYR CG CD2 sing Y N 439 TYR CD1 CE1 sing Y N 440 TYR CD1 HD1 sing N N 441 TYR CD2 CE2 doub Y N 442 TYR CD2 HD2 sing N N 443 TYR CE1 CZ doub Y N 444 TYR CE1 HE1 sing N N 445 TYR CE2 CZ sing Y N 446 TYR CE2 HE2 sing N N 447 TYR CZ OH sing N N 448 TYR OH HH sing N N 449 TYR OXT HXT sing N N 450 VAL N CA sing N N 451 VAL N H sing N N 452 VAL N H2 sing N N 453 VAL CA C sing N N 454 VAL CA CB sing N N 455 VAL CA HA sing N N 456 VAL C O doub N N 457 VAL C OXT sing N N 458 VAL CB CG1 sing N N 459 VAL CB CG2 sing N N 460 VAL CB HB sing N N 461 VAL CG1 HG11 sing N N 462 VAL CG1 HG12 sing N N 463 VAL CG1 HG13 sing N N 464 VAL CG2 HG21 sing N N 465 VAL CG2 HG22 sing N N 466 VAL CG2 HG23 sing N N 467 VAL OXT HXT sing N N 468 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 ;(1R,3S,5Z)-5-[(2E)-2-[(1R,3aS,7aR)-1-[(2R,6R)-6-(1-adamantyl)-6-oxidanyl-hex-4-yn-2-yl]-7a-methyl-2,3,3a,5,6,7-hexahydro-1H-inden-4-ylidene]ethylidene]-4-methylidene-cyclohexane-1,3-diol ; 8J3 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3W5P _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #