data_5XZI # _entry.id 5XZI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5XZI WWPDB D_1300004420 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5XZI _pdbx_database_status.recvd_initial_deposition_date 2017-07-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Song, W.J.' 1 ? 'Tezcan, F.A.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Am. Chem. Soc.' _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 139 _citation.language ? _citation.page_first 16772 _citation.page_last 16779 _citation.title 'Importance of Scaffold Flexibility/Rigidity in the Design and Directed Evolution of Artificial Metallo-beta-lactamases.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.7b08981 _citation.pdbx_database_id_PubMed 28992705 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Song, W.J.' 1 ? primary 'Yu, J.' 2 ? primary 'Tezcan, F.A.' 3 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5XZI _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.290 _cell.length_a_esd ? _cell.length_b 98.000 _cell.length_b_esd ? _cell.length_c 99.330 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5XZI _symmetry.cell_setting ? _symmetry.Int_Tables_number 22 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Soluble cytochrome b562' 11822.221 1 ? 'R34A, L38A, Q41W, K42S, K59H, D66W, V69I, D73H, K77H, E86D, A89E, Q93H, T96C, R98C, A100H, Y101C' ? ? 2 non-polymer syn 'HEME C' 618.503 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 5 water nat water 18.015 66 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytochrome b-562' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLAN EGKVKDAQEAAEHLKCTCNHCHQKYR ; _entity_poly.pdbx_seq_one_letter_code_can ;ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLAN EGKVKDAQEAAEHLKCTCNHCHQKYR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 LEU n 1 4 GLU n 1 5 ASP n 1 6 ASN n 1 7 MET n 1 8 GLU n 1 9 THR n 1 10 LEU n 1 11 ASN n 1 12 ASP n 1 13 ASN n 1 14 LEU n 1 15 LYS n 1 16 VAL n 1 17 ILE n 1 18 GLU n 1 19 LYS n 1 20 ALA n 1 21 ASP n 1 22 ASN n 1 23 ALA n 1 24 ALA n 1 25 GLN n 1 26 VAL n 1 27 LYS n 1 28 ASP n 1 29 ALA n 1 30 LEU n 1 31 THR n 1 32 LYS n 1 33 MET n 1 34 ALA n 1 35 ALA n 1 36 ALA n 1 37 ALA n 1 38 ALA n 1 39 ASP n 1 40 ALA n 1 41 TRP n 1 42 SER n 1 43 ALA n 1 44 THR n 1 45 PRO n 1 46 PRO n 1 47 LYS n 1 48 LEU n 1 49 GLU n 1 50 ASP n 1 51 LYS n 1 52 SER n 1 53 PRO n 1 54 ASP n 1 55 SER n 1 56 PRO n 1 57 GLU n 1 58 MET n 1 59 HIS n 1 60 ASP n 1 61 PHE n 1 62 ARG n 1 63 HIS n 1 64 GLY n 1 65 PHE n 1 66 TRP n 1 67 ILE n 1 68 LEU n 1 69 ILE n 1 70 GLY n 1 71 GLN n 1 72 ILE n 1 73 HIS n 1 74 ASP n 1 75 ALA n 1 76 LEU n 1 77 HIS n 1 78 LEU n 1 79 ALA n 1 80 ASN n 1 81 GLU n 1 82 GLY n 1 83 LYS n 1 84 VAL n 1 85 LYS n 1 86 ASP n 1 87 ALA n 1 88 GLN n 1 89 GLU n 1 90 ALA n 1 91 ALA n 1 92 GLU n 1 93 HIS n 1 94 LEU n 1 95 LYS n 1 96 CYS n 1 97 THR n 1 98 CYS n 1 99 ASN n 1 100 HIS n 1 101 CYS n 1 102 HIS n 1 103 GLN n 1 104 LYS n 1 105 TYR n 1 106 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 106 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene cybC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C562_ECOLX _struct_ref.pdbx_db_accession P0ABE7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN EGKVKEAQAAAEQLKTTRNAYHQKYR ; _struct_ref.pdbx_align_begin 23 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XZI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0ABE7 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 128 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 106 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5XZI ALA A 34 ? UNP P0ABE7 ARG 56 'engineered mutation' 34 1 1 5XZI ALA A 38 ? UNP P0ABE7 LEU 60 'engineered mutation' 38 2 1 5XZI TRP A 41 ? UNP P0ABE7 GLN 63 'engineered mutation' 41 3 1 5XZI SER A 42 ? UNP P0ABE7 LYS 64 'engineered mutation' 42 4 1 5XZI HIS A 59 ? UNP P0ABE7 LYS 81 'engineered mutation' 59 5 1 5XZI TRP A 66 ? UNP P0ABE7 ASP 88 'engineered mutation' 66 6 1 5XZI ILE A 69 ? UNP P0ABE7 VAL 91 'engineered mutation' 69 7 1 5XZI HIS A 73 ? UNP P0ABE7 ASP 95 'engineered mutation' 73 8 1 5XZI HIS A 77 ? UNP P0ABE7 LYS 99 'engineered mutation' 77 9 1 5XZI ASP A 86 ? UNP P0ABE7 GLU 108 'engineered mutation' 86 10 1 5XZI GLU A 89 ? UNP P0ABE7 ALA 111 'engineered mutation' 89 11 1 5XZI HIS A 93 ? UNP P0ABE7 GLN 115 'engineered mutation' 93 12 1 5XZI CYS A 96 ? UNP P0ABE7 THR 118 'engineered mutation' 96 13 1 5XZI CYS A 98 ? UNP P0ABE7 ARG 120 'engineered mutation' 98 14 1 5XZI HIS A 100 ? UNP P0ABE7 ALA 122 'engineered mutation' 100 15 1 5XZI CYS A 101 ? UNP P0ABE7 TYR 123 'engineered mutation' 101 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XZI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.59 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '31.5% 2-methyl-2,4-pentanediol 400, 0.1M HEPES, pH 7.5, 0.2M MgCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-05-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97950 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97950 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5XZI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.650 _reflns.d_resolution_low 49.665 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 3383 _reflns.number_obs 3383 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 91.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.800 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.039 _reflns.pdbx_netI_over_av_sigmaI 9.700 _reflns.pdbx_netI_over_sigmaI 25.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.045 _reflns.pdbx_Rpim_I_all 0.022 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 12901 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.650 2.790 ? 11.100 ? ? ? ? ? 82.400 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 3.800 0.055 ? ? ? 0.064 0.032 ? 1 1 ? ? 2.790 2.960 ? 11.900 ? ? ? ? ? 98.000 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 3.700 0.050 ? ? ? 0.059 0.030 ? 2 1 ? ? 2.960 3.170 ? 13.300 ? ? ? ? ? 95.400 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 3.600 0.044 ? ? ? 0.051 0.025 ? 3 1 ? ? 3.170 3.420 ? 16.600 ? ? ? ? ? 99.200 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 4.200 0.037 ? ? ? 0.042 0.021 ? 4 1 ? ? 3.420 3.750 ? 19.800 ? ? ? ? ? 77.100 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 4.100 0.032 ? ? ? 0.037 0.017 ? 5 1 ? ? 3.750 4.190 ? 20.300 ? ? ? ? ? 89.100 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 3.800 0.031 ? ? ? 0.036 0.017 ? 6 1 ? ? 4.190 4.840 ? 19.500 ? ? ? ? ? 93.100 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 3.500 0.031 ? ? ? 0.037 0.018 ? 7 1 ? ? 4.840 5.930 ? 20.000 ? ? ? ? ? 98.200 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 4.100 0.032 ? ? ? 0.036 0.017 ? 8 1 ? ? 5.930 8.380 ? 11.900 ? ? ? ? ? 94.600 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 3.700 0.037 ? ? ? 0.044 0.022 ? 9 1 ? ? 8.380 26.409 ? 8.900 ? ? ? ? ? 92.100 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 3.700 0.066 ? ? ? 0.077 0.038 ? 10 1 ? ? # _refine.aniso_B[1][1] 3.7000 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -0.6100 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -3.0900 _refine.B_iso_max 110.380 _refine.B_iso_mean 55.3170 _refine.B_iso_min 12.460 _refine.correlation_coeff_Fo_to_Fc 0.9420 _refine.correlation_coeff_Fo_to_Fc_free 0.8920 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5XZI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6500 _refine.ls_d_res_low 49.665 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3213 _refine.ls_number_reflns_R_free 170 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 90.8700 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1944 _refine.ls_R_factor_R_free 0.2632 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1902 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.3960 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 14.2870 _refine.overall_SU_ML 0.2920 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.6500 _refine_hist.d_res_low 49.665 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.number_atoms_solvent 66 _refine_hist.number_atoms_total 941 _refine_hist.pdbx_number_residues_total 106 _refine_hist.pdbx_B_iso_mean_ligand 57.44 _refine_hist.pdbx_B_iso_mean_solvent 42.06 _refine_hist.pdbx_number_atoms_protein 827 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.019 896 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 785 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.659 2.004 1224 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.061 3.002 1828 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.527 5.000 105 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 44.463 26.279 43 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 20.306 15.000 147 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.143 15.000 2 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.090 0.200 125 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1017 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 169 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.6500 _refine_ls_shell.d_res_low 2.7190 _refine_ls_shell.number_reflns_all 166 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 7 _refine_ls_shell.number_reflns_R_work 159 _refine_ls_shell.percent_reflns_obs 64.5900 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2850 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.0910 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5XZI _struct.title 'Crystal structure of the Zn-directed tetramer of the engineered cyt cb562 variant, AB5' _struct.pdbx_descriptor 'Soluble cytochrome b562' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XZI _struct_keywords.text 'de novo protein, ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? LYS A 19 ? ASP A 2 LYS A 19 1 ? 18 HELX_P HELX_P2 AA2 ASN A 22 ? SER A 42 ? ASN A 22 SER A 42 1 ? 21 HELX_P HELX_P3 AA3 PRO A 45 ? GLU A 49 ? PRO A 45 GLU A 49 5 ? 5 HELX_P HELX_P4 AA4 SER A 55 ? GLU A 81 ? SER A 55 GLU A 81 1 ? 27 HELX_P HELX_P5 AA5 LYS A 83 ? LEU A 94 ? LYS A 83 LEU A 94 1 ? 12 HELX_P HELX_P6 AA6 LEU A 94 ? ARG A 106 ? LEU A 94 ARG A 106 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 96 SG ? ? ? 1_555 A CYS 96 SG ? ? A CYS 96 A CYS 96 14_445 ? ? ? ? ? ? ? 2.356 ? metalc1 metalc ? ? A MET 7 SD ? ? ? 1_555 B HEC . FE ? ? A MET 7 A HEC 201 1_555 ? ? ? ? ? ? ? 2.200 ? metalc2 metalc ? ? A HIS 63 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 63 A ZN 202 1_555 ? ? ? ? ? ? ? 2.021 ? covale1 covale none ? A CYS 98 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 98 A HEC 201 1_555 ? ? ? ? ? ? ? 1.663 ? metalc3 metalc ? ? A HIS 100 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 100 A ZN 203 1_555 ? ? ? ? ? ? ? 2.136 ? covale2 covale none ? A CYS 101 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 101 A HEC 201 1_555 ? ? ? ? ? ? ? 1.672 ? metalc4 metalc ? ? A HIS 102 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 102 A HEC 201 1_555 ? ? ? ? ? ? ? 2.143 ? metalc5 metalc ? ? D ZN . ZN ? ? ? 1_555 H HOH . O ? ? A ZN 203 A HOH 345 1_555 ? ? ? ? ? ? ? 2.095 ? metalc6 metalc ? ? A HIS 73 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 73 A ZN 202 11_454 ? ? ? ? ? ? ? 1.819 ? metalc7 metalc ? ? A HIS 77 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 77 A ZN 202 11_454 ? ? ? ? ? ? ? 1.999 ? metalc8 metalc ? ? A GLU 89 OE2 ? ? ? 1_555 D ZN . ZN ? ? A GLU 89 A ZN 203 14_445 ? ? ? ? ? ? ? 2.184 ? metalc9 metalc ? ? A HIS 93 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 93 A ZN 203 14_445 ? ? ? ? ? ? ? 2.389 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? covale ? ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A HEC 201 ? 13 'binding site for residue HEC A 201' AC2 Software A ZN 202 ? 4 'binding site for residue ZN A 202' AC3 Software A ZN 203 ? 4 'binding site for residue ZN A 203' AC4 Software A CL 204 ? 5 'binding site for residue CL A 204' AC5 Software A CL 205 ? 1 'binding site for residue CL A 205' AC6 Software A CL 206 ? 1 'binding site for residue CL A 206' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 GLU A 4 ? GLU A 4 . ? 1_555 ? 2 AC1 13 MET A 7 ? MET A 7 . ? 1_555 ? 3 AC1 13 GLU A 8 ? GLU A 8 . ? 1_555 ? 4 AC1 13 ASN A 11 ? ASN A 11 . ? 1_555 ? 5 AC1 13 MET A 33 ? MET A 33 . ? 1_555 ? 6 AC1 13 PRO A 46 ? PRO A 46 . ? 1_555 ? 7 AC1 13 PHE A 61 ? PHE A 61 . ? 1_555 ? 8 AC1 13 PHE A 65 ? PHE A 65 . ? 1_555 ? 9 AC1 13 CYS A 98 ? CYS A 98 . ? 1_555 ? 10 AC1 13 CYS A 101 ? CYS A 101 . ? 1_555 ? 11 AC1 13 HIS A 102 ? HIS A 102 . ? 1_555 ? 12 AC1 13 TYR A 105 ? TYR A 105 . ? 1_555 ? 13 AC1 13 ARG A 106 ? ARG A 106 . ? 1_555 ? 14 AC2 4 HIS A 63 ? HIS A 63 . ? 1_555 ? 15 AC2 4 HIS A 73 ? HIS A 73 . ? 11_454 ? 16 AC2 4 HIS A 77 ? HIS A 77 . ? 11_454 ? 17 AC2 4 CL E . ? CL A 204 . ? 1_555 ? 18 AC3 4 GLU A 89 ? GLU A 89 . ? 14_445 ? 19 AC3 4 HIS A 93 ? HIS A 93 . ? 14_445 ? 20 AC3 4 HIS A 100 ? HIS A 100 . ? 1_555 ? 21 AC3 4 HOH H . ? HOH A 345 . ? 1_555 ? 22 AC4 5 TRP A 41 ? TRP A 41 . ? 1_555 ? 23 AC4 5 HIS A 63 ? HIS A 63 . ? 1_555 ? 24 AC4 5 HIS A 73 ? HIS A 73 . ? 11_454 ? 25 AC4 5 HIS A 77 ? HIS A 77 . ? 11_454 ? 26 AC4 5 ZN C . ? ZN A 202 . ? 1_555 ? 27 AC5 1 HOH H . ? HOH A 363 . ? 1_555 ? 28 AC6 1 LEU A 76 ? LEU A 76 . ? 1_555 ? # _atom_sites.entry_id 5XZI _atom_sites.fract_transf_matrix[1][1] 0.019885 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010204 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010067 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL FE N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 TRP 66 66 66 TRP TRP A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 CYS 96 96 96 CYS CYS A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 ARG 106 106 106 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEC 1 201 150 HEC HEM A . C 3 ZN 1 202 1 ZN ZN A . D 3 ZN 1 203 2 ZN ZN A . E 4 CL 1 204 1 CL CL A . F 4 CL 1 205 2 CL CL A . G 4 CL 1 206 3 CL CL A . H 5 HOH 1 301 2 HOH HOH A . H 5 HOH 2 302 45 HOH HOH A . H 5 HOH 3 303 11 HOH HOH A . H 5 HOH 4 304 51 HOH HOH A . H 5 HOH 5 305 22 HOH HOH A . H 5 HOH 6 306 21 HOH HOH A . H 5 HOH 7 307 34 HOH HOH A . H 5 HOH 8 308 18 HOH HOH A . H 5 HOH 9 309 60 HOH HOH A . H 5 HOH 10 310 6 HOH HOH A . H 5 HOH 11 311 29 HOH HOH A . H 5 HOH 12 312 31 HOH HOH A . H 5 HOH 13 313 5 HOH HOH A . H 5 HOH 14 314 52 HOH HOH A . H 5 HOH 15 315 10 HOH HOH A . H 5 HOH 16 316 57 HOH HOH A . H 5 HOH 17 317 4 HOH HOH A . H 5 HOH 18 318 14 HOH HOH A . H 5 HOH 19 319 7 HOH HOH A . H 5 HOH 20 320 63 HOH HOH A . H 5 HOH 21 321 65 HOH HOH A . H 5 HOH 22 322 3 HOH HOH A . H 5 HOH 23 323 62 HOH HOH A . H 5 HOH 24 324 24 HOH HOH A . H 5 HOH 25 325 59 HOH HOH A . H 5 HOH 26 326 28 HOH HOH A . H 5 HOH 27 327 2 HOH HOH A . H 5 HOH 28 328 16 HOH HOH A . H 5 HOH 29 329 36 HOH HOH A . H 5 HOH 30 330 42 HOH HOH A . H 5 HOH 31 331 50 HOH HOH A . H 5 HOH 32 332 41 HOH HOH A . H 5 HOH 33 333 40 HOH HOH A . H 5 HOH 34 334 1 HOH HOH A . H 5 HOH 35 335 53 HOH HOH A . H 5 HOH 36 336 32 HOH HOH A . H 5 HOH 37 337 64 HOH HOH A . H 5 HOH 38 338 39 HOH HOH A . H 5 HOH 39 339 33 HOH HOH A . H 5 HOH 40 340 58 HOH HOH A . H 5 HOH 41 341 9 HOH HOH A . H 5 HOH 42 342 43 HOH HOH A . H 5 HOH 43 343 23 HOH HOH A . H 5 HOH 44 344 48 HOH HOH A . H 5 HOH 45 345 8 HOH HOH A . H 5 HOH 46 346 46 HOH HOH A . H 5 HOH 47 347 17 HOH HOH A . H 5 HOH 48 348 13 HOH HOH A . H 5 HOH 49 349 12 HOH HOH A . H 5 HOH 50 350 20 HOH HOH A . H 5 HOH 51 351 30 HOH HOH A . H 5 HOH 52 352 44 HOH HOH A . H 5 HOH 53 353 47 HOH HOH A . H 5 HOH 54 354 15 HOH HOH A . H 5 HOH 55 355 61 HOH HOH A . H 5 HOH 56 356 26 HOH HOH A . H 5 HOH 57 357 27 HOH HOH A . H 5 HOH 58 358 49 HOH HOH A . H 5 HOH 59 359 19 HOH HOH A . H 5 HOH 60 360 56 HOH HOH A . H 5 HOH 61 361 25 HOH HOH A . H 5 HOH 62 362 54 HOH HOH A . H 5 HOH 63 363 38 HOH HOH A . H 5 HOH 64 364 55 HOH HOH A . H 5 HOH 65 365 37 HOH HOH A . H 5 HOH 66 366 35 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 10070 ? 1 MORE -499 ? 1 'SSA (A^2)' 21540 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_544 x,-y-1/2,-z-1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -49.0000000000 0.0000000000 0.0000000000 -1.0000000000 -49.6650000000 3 'crystal symmetry operation' 11_454 -x-1/2,y,-z-1/2 -1.0000000000 0.0000000000 0.0000000000 -25.1450000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -49.6650000000 4 'crystal symmetry operation' 14_445 -x-1/2,-y-1/2,z -1.0000000000 0.0000000000 0.0000000000 -25.1450000000 0.0000000000 -1.0000000000 0.0000000000 -49.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SD ? A MET 7 ? A MET 7 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NA ? B HEC . ? A HEC 201 ? 1_555 93.9 ? 2 SD ? A MET 7 ? A MET 7 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NB ? B HEC . ? A HEC 201 ? 1_555 88.5 ? 3 NA ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NB ? B HEC . ? A HEC 201 ? 1_555 89.7 ? 4 SD ? A MET 7 ? A MET 7 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NC ? B HEC . ? A HEC 201 ? 1_555 86.3 ? 5 NA ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NC ? B HEC . ? A HEC 201 ? 1_555 178.8 ? 6 NB ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NC ? B HEC . ? A HEC 201 ? 1_555 89.1 ? 7 SD ? A MET 7 ? A MET 7 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 ND ? B HEC . ? A HEC 201 ? 1_555 91.0 ? 8 NA ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 ND ? B HEC . ? A HEC 201 ? 1_555 90.6 ? 9 NB ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 ND ? B HEC . ? A HEC 201 ? 1_555 179.4 ? 10 NC ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 ND ? B HEC . ? A HEC 201 ? 1_555 90.5 ? 11 SD ? A MET 7 ? A MET 7 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 176.7 ? 12 NA ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 85.4 ? 13 NB ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 94.7 ? 14 NC ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 94.5 ? 15 ND ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 85.8 ? 16 ND1 ? A HIS 63 ? A HIS 63 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 73 ? A HIS 73 ? 1_555 81.4 ? 17 ND1 ? A HIS 63 ? A HIS 63 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 77 ? A HIS 77 ? 1_555 78.4 ? 18 NE2 ? A HIS 73 ? A HIS 73 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 77 ? A HIS 77 ? 1_555 3.3 ? 19 ND1 ? A HIS 100 ? A HIS 100 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 O ? H HOH . ? A HOH 345 ? 1_555 115.9 ? 20 ND1 ? A HIS 100 ? A HIS 100 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 89 ? A GLU 89 ? 1_555 71.3 ? 21 O ? H HOH . ? A HOH 345 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 89 ? A GLU 89 ? 1_555 75.6 ? 22 ND1 ? A HIS 100 ? A HIS 100 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 67.8 ? 23 O ? H HOH . ? A HOH 345 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 77.8 ? 24 OE2 ? A GLU 89 ? A GLU 89 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 3.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-20 2 'Structure model' 2 0 2019-10-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Non-polymer description' 5 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' chem_comp 3 2 'Structure model' entity 4 2 'Structure model' pdbx_entity_nonpoly 5 2 'Structure model' pdbx_nonpoly_scheme 6 2 'Structure model' pdbx_struct_conn_angle 7 2 'Structure model' struct_conn 8 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.B_iso_or_equiv' 2 2 'Structure model' '_atom_site.Cartn_x' 3 2 'Structure model' '_atom_site.Cartn_y' 4 2 'Structure model' '_atom_site.Cartn_z' 5 2 'Structure model' '_atom_site.auth_atom_id' 6 2 'Structure model' '_atom_site.auth_comp_id' 7 2 'Structure model' '_atom_site.label_atom_id' 8 2 'Structure model' '_atom_site.label_comp_id' 9 2 'Structure model' '_atom_site.type_symbol' 10 2 'Structure model' '_chem_comp.formula' 11 2 'Structure model' '_chem_comp.formula_weight' 12 2 'Structure model' '_chem_comp.id' 13 2 'Structure model' '_chem_comp.name' 14 2 'Structure model' '_chem_comp.pdbx_synonyms' 15 2 'Structure model' '_entity.formula_weight' 16 2 'Structure model' '_entity.pdbx_description' 17 2 'Structure model' '_pdbx_entity_nonpoly.comp_id' 18 2 'Structure model' '_pdbx_entity_nonpoly.name' 19 2 'Structure model' '_pdbx_nonpoly_scheme.mon_id' 20 2 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id' 21 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 22 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 23 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 24 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 25 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 26 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 27 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 28 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 2 'Structure model' '_struct_site.details' 30 2 'Structure model' '_struct_site.pdbx_auth_comp_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.22 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 342 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 348 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.03 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 359 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 359 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_455 _pdbx_validate_symm_contact.dist 2.04 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 98 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 98 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 SG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 98 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 120.89 _pdbx_validate_rmsd_angle.angle_target_value 114.20 _pdbx_validate_rmsd_angle.angle_deviation 6.69 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -45.39 150.52 2 1 ALA A 43 ? ? -170.39 140.64 3 1 TYR A 105 ? ? -153.61 23.30 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'HEME C' HEC 3 'ZINC ION' ZN 4 'CHLORIDE ION' CL 5 water HOH # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' 'size exclusion chromatography' 2 1 'equilibrium centrifugation' 'analytical ultracentrifugation (AUC)' #