data_5Y0W # _entry.id 5Y0W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.284 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5Y0W WWPDB D_1300004481 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5Y0W _pdbx_database_status.recvd_initial_deposition_date 2017-07-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wu, Y.' 1 ? 'Gao, F.' 2 ? 'Qi, J.X.' 3 ? 'Chai, Y.' 4 ? 'Gao, G.F.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 114 _citation.language ? _citation.page_first E7564 _citation.page_last E7573 _citation.title 'Structures of phlebovirus glycoprotein Gn and identification of a neutralizing antibody epitope' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1705176114 _citation.pdbx_database_id_PubMed 28827346 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Wu, Y.' 1 primary 'Zhu, Y.H.' 2 primary 'Gao, F.' 3 primary 'Jiao, Y.J.' 4 primary 'Oladejo, B.O.' 5 primary 'Chai, Y.' 6 primary 'Bi, Y.H.' 7 primary 'Lu, S.' 8 primary 'Dong, M.Q.' 9 primary 'Zhang, C.' 10 primary 'Huang, G.M.' 11 primary 'Wong, G.' 12 primary 'Li, N.' 13 primary 'Zhang, Y.F.' 14 primary 'Li, Y.' 15 primary 'Feng, W.H.' 16 primary 'Shi, Y.' 17 primary 'Liang, M.F.' 18 primary 'Zhang, R.G.' 19 primary 'Qi, J.X.' 20 primary 'Gao, G.F.' 21 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5Y0W _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.571 _cell.length_a_esd ? _cell.length_b 73.874 _cell.length_b_esd ? _cell.length_c 98.125 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5Y0W _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man NSmGnGc 35769.699 1 ? ? 'UNP residues 154-469' ? 2 water nat water 18.015 60 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'glycoprotein N' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EDPHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLQS AHGNPCMKEKLVMKTHCPNDYQSAHYLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSK LKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTIDSGQTKRE LKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELSHHHH HH ; _entity_poly.pdbx_seq_one_letter_code_can ;EDPHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLQS AHGNPCMKEKLVMKTHCPNDYQSAHYLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSK LKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTIDSGQTKRE LKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELSHHHH HH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ASP n 1 3 PRO n 1 4 HIS n 1 5 LEU n 1 6 ARG n 1 7 ASN n 1 8 ARG n 1 9 PRO n 1 10 GLY n 1 11 LYS n 1 12 GLY n 1 13 HIS n 1 14 ASN n 1 15 TYR n 1 16 ILE n 1 17 ASP n 1 18 GLY n 1 19 MET n 1 20 THR n 1 21 GLN n 1 22 GLU n 1 23 ASP n 1 24 ALA n 1 25 THR n 1 26 CYS n 1 27 LYS n 1 28 PRO n 1 29 VAL n 1 30 THR n 1 31 TYR n 1 32 ALA n 1 33 GLY n 1 34 ALA n 1 35 CYS n 1 36 SER n 1 37 SER n 1 38 PHE n 1 39 ASP n 1 40 VAL n 1 41 LEU n 1 42 LEU n 1 43 GLU n 1 44 LYS n 1 45 GLY n 1 46 LYS n 1 47 PHE n 1 48 PRO n 1 49 LEU n 1 50 PHE n 1 51 GLN n 1 52 SER n 1 53 TYR n 1 54 ALA n 1 55 HIS n 1 56 HIS n 1 57 ARG n 1 58 THR n 1 59 LEU n 1 60 LEU n 1 61 GLU n 1 62 ALA n 1 63 VAL n 1 64 HIS n 1 65 ASP n 1 66 THR n 1 67 ILE n 1 68 ILE n 1 69 ALA n 1 70 LYS n 1 71 ALA n 1 72 ASP n 1 73 PRO n 1 74 PRO n 1 75 SER n 1 76 CYS n 1 77 ASP n 1 78 LEU n 1 79 GLN n 1 80 SER n 1 81 ALA n 1 82 HIS n 1 83 GLY n 1 84 ASN n 1 85 PRO n 1 86 CYS n 1 87 MET n 1 88 LYS n 1 89 GLU n 1 90 LYS n 1 91 LEU n 1 92 VAL n 1 93 MET n 1 94 LYS n 1 95 THR n 1 96 HIS n 1 97 CYS n 1 98 PRO n 1 99 ASN n 1 100 ASP n 1 101 TYR n 1 102 GLN n 1 103 SER n 1 104 ALA n 1 105 HIS n 1 106 TYR n 1 107 LEU n 1 108 ASN n 1 109 ASN n 1 110 ASP n 1 111 GLY n 1 112 LYS n 1 113 MET n 1 114 ALA n 1 115 SER n 1 116 VAL n 1 117 LYS n 1 118 CYS n 1 119 PRO n 1 120 PRO n 1 121 LYS n 1 122 TYR n 1 123 GLU n 1 124 LEU n 1 125 THR n 1 126 GLU n 1 127 ASP n 1 128 CYS n 1 129 ASN n 1 130 PHE n 1 131 CYS n 1 132 ARG n 1 133 GLN n 1 134 MET n 1 135 THR n 1 136 GLY n 1 137 ALA n 1 138 SER n 1 139 LEU n 1 140 LYS n 1 141 LYS n 1 142 GLY n 1 143 SER n 1 144 TYR n 1 145 PRO n 1 146 LEU n 1 147 GLN n 1 148 ASP n 1 149 LEU n 1 150 PHE n 1 151 CYS n 1 152 GLN n 1 153 SER n 1 154 SER n 1 155 GLU n 1 156 ASP n 1 157 ASP n 1 158 GLY n 1 159 SER n 1 160 LYS n 1 161 LEU n 1 162 LYS n 1 163 THR n 1 164 LYS n 1 165 MET n 1 166 LYS n 1 167 GLY n 1 168 VAL n 1 169 CYS n 1 170 GLU n 1 171 VAL n 1 172 GLY n 1 173 VAL n 1 174 GLN n 1 175 ALA n 1 176 LEU n 1 177 LYS n 1 178 LYS n 1 179 CYS n 1 180 ASP n 1 181 GLY n 1 182 GLN n 1 183 LEU n 1 184 SER n 1 185 THR n 1 186 ALA n 1 187 HIS n 1 188 GLU n 1 189 VAL n 1 190 VAL n 1 191 PRO n 1 192 PHE n 1 193 ALA n 1 194 VAL n 1 195 PHE n 1 196 LYS n 1 197 ASN n 1 198 SER n 1 199 LYS n 1 200 LYS n 1 201 VAL n 1 202 TYR n 1 203 LEU n 1 204 ASP n 1 205 LYS n 1 206 LEU n 1 207 ASP n 1 208 LEU n 1 209 LYS n 1 210 THR n 1 211 GLU n 1 212 GLU n 1 213 ASN n 1 214 LEU n 1 215 LEU n 1 216 PRO n 1 217 ASP n 1 218 SER n 1 219 PHE n 1 220 VAL n 1 221 CYS n 1 222 PHE n 1 223 GLU n 1 224 HIS n 1 225 LYS n 1 226 GLY n 1 227 GLN n 1 228 TYR n 1 229 LYS n 1 230 GLY n 1 231 THR n 1 232 ILE n 1 233 ASP n 1 234 SER n 1 235 GLY n 1 236 GLN n 1 237 THR n 1 238 LYS n 1 239 ARG n 1 240 GLU n 1 241 LEU n 1 242 LYS n 1 243 SER n 1 244 PHE n 1 245 ASP n 1 246 ILE n 1 247 SER n 1 248 GLN n 1 249 CYS n 1 250 PRO n 1 251 LYS n 1 252 ILE n 1 253 GLY n 1 254 GLY n 1 255 HIS n 1 256 GLY n 1 257 SER n 1 258 LYS n 1 259 LYS n 1 260 CYS n 1 261 THR n 1 262 GLY n 1 263 ASP n 1 264 ALA n 1 265 ALA n 1 266 PHE n 1 267 CYS n 1 268 SER n 1 269 ALA n 1 270 TYR n 1 271 GLU n 1 272 CYS n 1 273 THR n 1 274 ALA n 1 275 GLN n 1 276 TYR n 1 277 ALA n 1 278 ASN n 1 279 ALA n 1 280 TYR n 1 281 CYS n 1 282 SER n 1 283 HIS n 1 284 ALA n 1 285 ASN n 1 286 GLY n 1 287 SER n 1 288 GLY n 1 289 ILE n 1 290 VAL n 1 291 GLN n 1 292 ILE n 1 293 GLN n 1 294 VAL n 1 295 SER n 1 296 GLY n 1 297 VAL n 1 298 TRP n 1 299 LYS n 1 300 LYS n 1 301 PRO n 1 302 LEU n 1 303 CYS n 1 304 VAL n 1 305 GLY n 1 306 TYR n 1 307 GLU n 1 308 ARG n 1 309 VAL n 1 310 VAL n 1 311 VAL n 1 312 LYS n 1 313 ARG n 1 314 GLU n 1 315 LEU n 1 316 SER n 1 317 HIS n 1 318 HIS n 1 319 HIS n 1 320 HIS n 1 321 HIS n 1 322 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 322 _entity_src_gen.gene_src_common_name RVFV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rift valley fever virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11588 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Baculovirus expression vector pFastBac1-HM' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 274590 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code H9BSP3_RVFV _struct_ref.pdbx_db_accession H9BSP3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EDPHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLQS AHGNPCMKEKLVMKTHCPNDYQSAHYLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSK LKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTIDSGQTKRE LKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELS ; _struct_ref.pdbx_align_begin 154 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5Y0W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 316 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession H9BSP3 _struct_ref_seq.db_align_beg 154 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 469 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 316 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5Y0W HIS A 317 ? UNP H9BSP3 ? ? 'expression tag' 317 1 1 5Y0W HIS A 318 ? UNP H9BSP3 ? ? 'expression tag' 318 2 1 5Y0W HIS A 319 ? UNP H9BSP3 ? ? 'expression tag' 319 3 1 5Y0W HIS A 320 ? UNP H9BSP3 ? ? 'expression tag' 320 4 1 5Y0W HIS A 321 ? UNP H9BSP3 ? ? 'expression tag' 321 5 1 5Y0W HIS A 322 ? UNP H9BSP3 ? ? 'expression tag' 322 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5Y0W _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.61 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M ammonium sulfate, 0.1M MES, pH 6.5, 20% (w/v) PEG 8000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97853 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97853 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5Y0W _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13526 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.7 _reflns.pdbx_Rmerge_I_obs 0.104 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.59 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1286 _reflns_shell.percent_possible_all 96.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.774 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5Y0W _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5 _refine.ls_d_res_low 40.870 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12020 _refine.ls_number_reflns_R_free 597 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 88.30 _refine.ls_percent_reflns_R_free 4.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1994 _refine.ls_R_factor_R_free 0.2483 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1967 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.48 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.33 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2437 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 60 _refine_hist.number_atoms_total 2497 _refine_hist.d_res_high 2.5 _refine_hist.d_res_low 40.870 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 ? 2498 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.787 ? 3352 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.630 ? 935 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.097 ? 359 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 ? 437 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4945 2.7455 . . 90 1846 58.00 . . . 0.3694 . 0.2664 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7455 3.1427 . . 161 3006 95.00 . . . 0.2908 . 0.2480 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1427 3.9589 . . 180 3209 100.00 . . . 0.2697 . 0.2025 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9589 40.8756 . . 166 3362 100.00 . . . 0.1916 . 0.1595 . . . . . . . . . . # _struct.entry_id 5Y0W _struct.title 'The structure of RVFV Gn head domain' _struct.pdbx_descriptor NSmGnGc _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5Y0W _struct_keywords.text 'RVFV, Glycoprotein N (Gn), bunyavirus, phlebovirus, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 22 ? LYS A 27 ? GLU A 22 LYS A 27 1 ? 6 HELX_P HELX_P2 AA2 PHE A 38 ? GLU A 43 ? PHE A 38 GLU A 43 5 ? 6 HELX_P HELX_P3 AA3 PHE A 47 ? TYR A 53 ? PHE A 47 TYR A 53 1 ? 7 HELX_P HELX_P4 AA4 THR A 58 ? ASP A 65 ? THR A 58 ASP A 65 1 ? 8 HELX_P HELX_P5 AA5 GLY A 83 ? VAL A 92 ? GLY A 83 VAL A 92 1 ? 10 HELX_P HELX_P6 AA6 LEU A 215 ? ASP A 217 ? LEU A 215 ASP A 217 5 ? 3 HELX_P HELX_P7 AA7 ASP A 245 ? CYS A 249 ? ASP A 245 CYS A 249 5 ? 5 HELX_P HELX_P8 AA8 ASP A 263 ? TYR A 270 ? ASP A 263 TYR A 270 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 26 A CYS 35 1_555 ? ? ? ? ? ? ? 2.058 ? disulf2 disulf ? ? A CYS 76 SG ? ? ? 1_555 A CYS 86 SG ? ? A CYS 76 A CYS 86 1_555 ? ? ? ? ? ? ? 2.101 ? disulf3 disulf ? ? A CYS 97 SG ? ? ? 1_555 A CYS 128 SG ? ? A CYS 97 A CYS 128 1_555 ? ? ? ? ? ? ? 2.006 ? disulf4 disulf ? ? A CYS 118 SG ? ? ? 1_555 A CYS 131 SG ? ? A CYS 118 A CYS 131 1_555 ? ? ? ? ? ? ? 2.079 ? disulf5 disulf ? ? A CYS 151 SG ? ? ? 1_555 A CYS 303 SG ? ? A CYS 151 A CYS 303 1_555 ? ? ? ? ? ? ? 2.126 ? disulf6 disulf ? ? A CYS 169 SG ? ? ? 1_555 A CYS 179 SG ? ? A CYS 169 A CYS 179 1_555 ? ? ? ? ? ? ? 2.068 ? disulf7 disulf ? ? A CYS 221 SG ? ? ? 1_555 A CYS 281 SG ? ? A CYS 221 A CYS 281 1_555 ? ? ? ? ? ? ? 2.056 ? disulf8 disulf ? ? A CYS 249 SG ? ? ? 1_555 A CYS 260 SG ? ? A CYS 249 A CYS 260 1_555 ? ? ? ? ? ? ? 2.054 ? disulf9 disulf ? ? A CYS 267 SG ? ? ? 1_555 A CYS 272 SG ? ? A CYS 267 A CYS 272 1_555 ? ? ? ? ? ? ? 2.036 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 27 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 27 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 28 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 28 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 23.52 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? AA3 ? 4 ? AA4 ? 4 ? AA5 ? 3 ? AA6 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 76 ? ASP A 77 ? CYS A 76 ASP A 77 AA1 2 MET A 113 ? LYS A 117 ? MET A 113 LYS A 117 AA1 3 SER A 103 ? LEU A 107 ? SER A 103 LEU A 107 AA1 4 SER A 143 ? PRO A 145 ? SER A 143 PRO A 145 AA2 1 TYR A 122 ? LEU A 124 ? TYR A 122 LEU A 124 AA2 2 CYS A 131 ? GLN A 133 ? CYS A 131 GLN A 133 AA3 1 ASP A 148 ? CYS A 151 ? ASP A 148 CYS A 151 AA3 2 CYS A 303 ? GLU A 314 ? CYS A 303 GLU A 314 AA3 3 VAL A 168 ? VAL A 171 ? VAL A 168 VAL A 171 AA3 4 GLN A 174 ? ALA A 175 ? GLN A 174 ALA A 175 AA4 1 ASP A 148 ? CYS A 151 ? ASP A 148 CYS A 151 AA4 2 CYS A 303 ? GLU A 314 ? CYS A 303 GLU A 314 AA4 3 LEU A 183 ? VAL A 194 ? LEU A 183 VAL A 194 AA4 4 VAL A 201 ? TYR A 202 ? VAL A 201 TYR A 202 AA5 1 LEU A 208 ? GLU A 211 ? LEU A 208 GLU A 211 AA5 2 ILE A 289 ? VAL A 294 ? ILE A 289 VAL A 294 AA5 3 VAL A 297 ? LYS A 299 ? VAL A 297 LYS A 299 AA6 1 LEU A 241 ? PHE A 244 ? LEU A 241 PHE A 244 AA6 2 PHE A 219 ? HIS A 224 ? PHE A 219 HIS A 224 AA6 3 ALA A 279 ? HIS A 283 ? ALA A 279 HIS A 283 AA6 4 CYS A 260 ? GLY A 262 ? CYS A 260 GLY A 262 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N CYS A 76 ? N CYS A 76 O SER A 115 ? O SER A 115 AA1 2 3 O VAL A 116 ? O VAL A 116 N ALA A 104 ? N ALA A 104 AA1 3 4 N SER A 103 ? N SER A 103 O TYR A 144 ? O TYR A 144 AA2 1 2 N GLU A 123 ? N GLU A 123 O ARG A 132 ? O ARG A 132 AA3 1 2 N ASP A 148 ? N ASP A 148 O TYR A 306 ? O TYR A 306 AA3 2 3 O LYS A 312 ? O LYS A 312 N GLU A 170 ? N GLU A 170 AA3 3 4 N VAL A 171 ? N VAL A 171 O GLN A 174 ? O GLN A 174 AA4 1 2 N ASP A 148 ? N ASP A 148 O TYR A 306 ? O TYR A 306 AA4 2 3 O VAL A 311 ? O VAL A 311 N ALA A 186 ? N ALA A 186 AA4 3 4 N ALA A 193 ? N ALA A 193 O VAL A 201 ? O VAL A 201 AA5 1 2 N GLU A 211 ? N GLU A 211 O ILE A 289 ? O ILE A 289 AA5 2 3 N VAL A 294 ? N VAL A 294 O VAL A 297 ? O VAL A 297 AA6 1 2 O PHE A 244 ? O PHE A 244 N CYS A 221 ? N CYS A 221 AA6 2 3 N VAL A 220 ? N VAL A 220 O SER A 282 ? O SER A 282 AA6 3 4 O CYS A 281 ? O CYS A 281 N THR A 261 ? N THR A 261 # _atom_sites.entry_id 5Y0W _atom_sites.fract_transf_matrix[1][1] 0.019391 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013537 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010191 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 CYS 118 118 118 CYS CYS A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 CYS 131 131 131 CYS CYS A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 TYR 144 144 144 TYR TYR A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 CYS 151 151 151 CYS CYS A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 MET 165 165 165 MET MET A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 CYS 169 169 169 CYS CYS A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 CYS 179 179 179 CYS CYS A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 GLN 182 182 182 GLN GLN A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 PHE 195 195 195 PHE PHE A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 ASN 197 197 197 ASN ASN A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 LYS 199 199 199 LYS LYS A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 VAL 220 220 220 VAL VAL A . n A 1 221 CYS 221 221 221 CYS CYS A . n A 1 222 PHE 222 222 222 PHE PHE A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 HIS 224 224 224 HIS HIS A . n A 1 225 LYS 225 225 225 LYS LYS A . n A 1 226 GLY 226 226 226 GLY GLY A . n A 1 227 GLN 227 227 227 GLN GLN A . n A 1 228 TYR 228 228 228 TYR TYR A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 GLY 230 230 230 GLY GLY A . n A 1 231 THR 231 231 231 THR THR A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 ASP 233 233 233 ASP ASP A . n A 1 234 SER 234 234 234 SER SER A . n A 1 235 GLY 235 235 235 GLY GLY A . n A 1 236 GLN 236 236 236 GLN GLN A . n A 1 237 THR 237 237 237 THR THR A . n A 1 238 LYS 238 238 238 LYS LYS A . n A 1 239 ARG 239 239 239 ARG ARG A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 LYS 242 242 242 LYS LYS A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 PHE 244 244 244 PHE PHE A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 SER 247 247 247 SER SER A . n A 1 248 GLN 248 248 248 GLN GLN A . n A 1 249 CYS 249 249 249 CYS CYS A . n A 1 250 PRO 250 250 250 PRO PRO A . n A 1 251 LYS 251 251 251 LYS LYS A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 GLY 253 253 253 GLY GLY A . n A 1 254 GLY 254 254 254 GLY GLY A . n A 1 255 HIS 255 255 255 HIS HIS A . n A 1 256 GLY 256 256 256 GLY GLY A . n A 1 257 SER 257 257 257 SER SER A . n A 1 258 LYS 258 258 258 LYS LYS A . n A 1 259 LYS 259 259 259 LYS LYS A . n A 1 260 CYS 260 260 260 CYS CYS A . n A 1 261 THR 261 261 261 THR THR A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 ASP 263 263 263 ASP ASP A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 ALA 265 265 265 ALA ALA A . n A 1 266 PHE 266 266 266 PHE PHE A . n A 1 267 CYS 267 267 267 CYS CYS A . n A 1 268 SER 268 268 268 SER SER A . n A 1 269 ALA 269 269 269 ALA ALA A . n A 1 270 TYR 270 270 270 TYR TYR A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 CYS 272 272 272 CYS CYS A . n A 1 273 THR 273 273 273 THR THR A . n A 1 274 ALA 274 274 274 ALA ALA A . n A 1 275 GLN 275 275 275 GLN GLN A . n A 1 276 TYR 276 276 276 TYR TYR A . n A 1 277 ALA 277 277 277 ALA ALA A . n A 1 278 ASN 278 278 278 ASN ASN A . n A 1 279 ALA 279 279 279 ALA ALA A . n A 1 280 TYR 280 280 280 TYR TYR A . n A 1 281 CYS 281 281 281 CYS CYS A . n A 1 282 SER 282 282 282 SER SER A . n A 1 283 HIS 283 283 283 HIS HIS A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 ASN 285 285 285 ASN ASN A . n A 1 286 GLY 286 286 286 GLY GLY A . n A 1 287 SER 287 287 287 SER SER A . n A 1 288 GLY 288 288 288 GLY GLY A . n A 1 289 ILE 289 289 289 ILE ILE A . n A 1 290 VAL 290 290 290 VAL VAL A . n A 1 291 GLN 291 291 291 GLN GLN A . n A 1 292 ILE 292 292 292 ILE ILE A . n A 1 293 GLN 293 293 293 GLN GLN A . n A 1 294 VAL 294 294 294 VAL VAL A . n A 1 295 SER 295 295 295 SER SER A . n A 1 296 GLY 296 296 296 GLY GLY A . n A 1 297 VAL 297 297 297 VAL VAL A . n A 1 298 TRP 298 298 298 TRP TRP A . n A 1 299 LYS 299 299 299 LYS LYS A . n A 1 300 LYS 300 300 300 LYS LYS A . n A 1 301 PRO 301 301 301 PRO PRO A . n A 1 302 LEU 302 302 302 LEU LEU A . n A 1 303 CYS 303 303 303 CYS CYS A . n A 1 304 VAL 304 304 304 VAL VAL A . n A 1 305 GLY 305 305 305 GLY GLY A . n A 1 306 TYR 306 306 306 TYR TYR A . n A 1 307 GLU 307 307 307 GLU GLU A . n A 1 308 ARG 308 308 308 ARG ARG A . n A 1 309 VAL 309 309 309 VAL VAL A . n A 1 310 VAL 310 310 310 VAL VAL A . n A 1 311 VAL 311 311 311 VAL VAL A . n A 1 312 LYS 312 312 312 LYS LYS A . n A 1 313 ARG 313 313 313 ARG ARG A . n A 1 314 GLU 314 314 314 GLU GLU A . n A 1 315 LEU 315 315 315 LEU LEU A . n A 1 316 SER 316 316 316 SER SER A . n A 1 317 HIS 317 317 ? ? ? A . n A 1 318 HIS 318 318 ? ? ? A . n A 1 319 HIS 319 319 ? ? ? A . n A 1 320 HIS 320 320 ? ? ? A . n A 1 321 HIS 321 321 ? ? ? A . n A 1 322 HIS 322 322 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 27 HOH HOH A . B 2 HOH 2 402 59 HOH HOH A . B 2 HOH 3 403 25 HOH HOH A . B 2 HOH 4 404 39 HOH HOH A . B 2 HOH 5 405 5 HOH HOH A . B 2 HOH 6 406 36 HOH HOH A . B 2 HOH 7 407 43 HOH HOH A . B 2 HOH 8 408 3 HOH HOH A . B 2 HOH 9 409 4 HOH HOH A . B 2 HOH 10 410 34 HOH HOH A . B 2 HOH 11 411 37 HOH HOH A . B 2 HOH 12 412 29 HOH HOH A . B 2 HOH 13 413 41 HOH HOH A . B 2 HOH 14 414 1 HOH HOH A . B 2 HOH 15 415 24 HOH HOH A . B 2 HOH 16 416 2 HOH HOH A . B 2 HOH 17 417 42 HOH HOH A . B 2 HOH 18 418 58 HOH HOH A . B 2 HOH 19 419 40 HOH HOH A . B 2 HOH 20 420 48 HOH HOH A . B 2 HOH 21 421 56 HOH HOH A . B 2 HOH 22 422 18 HOH HOH A . B 2 HOH 23 423 51 HOH HOH A . B 2 HOH 24 424 22 HOH HOH A . B 2 HOH 25 425 26 HOH HOH A . B 2 HOH 26 426 35 HOH HOH A . B 2 HOH 27 427 19 HOH HOH A . B 2 HOH 28 428 57 HOH HOH A . B 2 HOH 29 429 21 HOH HOH A . B 2 HOH 30 430 20 HOH HOH A . B 2 HOH 31 431 30 HOH HOH A . B 2 HOH 32 432 10 HOH HOH A . B 2 HOH 33 433 64 HOH HOH A . B 2 HOH 34 434 31 HOH HOH A . B 2 HOH 35 435 38 HOH HOH A . B 2 HOH 36 436 12 HOH HOH A . B 2 HOH 37 437 8 HOH HOH A . B 2 HOH 38 438 28 HOH HOH A . B 2 HOH 39 439 50 HOH HOH A . B 2 HOH 40 440 23 HOH HOH A . B 2 HOH 41 441 45 HOH HOH A . B 2 HOH 42 442 11 HOH HOH A . B 2 HOH 43 443 49 HOH HOH A . B 2 HOH 44 444 61 HOH HOH A . B 2 HOH 45 445 54 HOH HOH A . B 2 HOH 46 446 6 HOH HOH A . B 2 HOH 47 447 17 HOH HOH A . B 2 HOH 48 448 53 HOH HOH A . B 2 HOH 49 449 32 HOH HOH A . B 2 HOH 50 450 33 HOH HOH A . B 2 HOH 51 451 44 HOH HOH A . B 2 HOH 52 452 62 HOH HOH A . B 2 HOH 53 453 52 HOH HOH A . B 2 HOH 54 454 13 HOH HOH A . B 2 HOH 55 455 55 HOH HOH A . B 2 HOH 56 456 60 HOH HOH A . B 2 HOH 57 457 65 HOH HOH A . B 2 HOH 58 458 46 HOH HOH A . B 2 HOH 59 459 47 HOH HOH A . B 2 HOH 60 460 63 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 15470 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-13 2 'Structure model' 1 1 2017-09-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 115.3989 228.9868 8.7591 0.2818 0.1679 0.1913 -0.0218 -0.0500 -0.0155 0.7496 2.0145 1.9447 -0.7254 0.4290 0.9081 -0.0385 -0.0379 0.0207 -0.2095 -0.0919 0.0179 -0.5817 -0.0382 0.0613 'X-RAY DIFFRACTION' 2 ? refined 121.1178 219.9461 9.4645 0.1192 0.1763 0.1856 -0.0226 -0.0205 -0.0008 0.3233 0.6999 2.0650 0.0800 -0.1776 0.6706 -0.0173 0.0126 -0.0085 -0.1431 -0.0122 -0.0534 -0.2024 0.1426 0.0465 'X-RAY DIFFRACTION' 3 ? refined 105.0975 239.4877 33.0748 0.2387 0.2114 0.2047 0.0484 -0.0503 -0.0202 1.4394 3.0847 1.3200 -1.5025 -0.4050 -0.9077 -0.0920 0.1116 -0.1842 -0.0074 -0.0099 0.2871 -0.3361 -0.1448 0.1041 'X-RAY DIFFRACTION' 4 ? refined 123.4516 211.1212 16.0238 0.1467 0.2133 0.2036 0.0459 -0.0252 0.0341 0.1962 0.9170 2.9024 0.2130 0.0911 0.9313 -0.0011 -0.1250 0.0588 0.2250 -0.1462 -0.2426 0.2883 -0.1193 -0.0028 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1 through 102 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 103 through 224 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 225 through 288 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 289 through 316 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 ND1 A HIS 64 ? ? O A HOH 401 ? ? 1.83 2 1 N A GLY 33 ? ? O A HOH 402 ? ? 1.90 3 1 N A GLY 181 ? ? O A HOH 403 ? ? 1.98 4 1 OG A SER 80 ? ? O A HOH 404 ? ? 2.06 5 1 O A ILE 232 ? ? O A HOH 405 ? ? 2.14 6 1 OG A SER 282 ? ? O A HOH 406 ? ? 2.14 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 441 ? ? 1_555 O A HOH 446 ? ? 2_9114 1.94 2 1 O A HOH 441 ? ? 1_555 O A HOH 454 ? ? 2_9114 1.95 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 72 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 73 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 73 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 106.43 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation -12.87 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 14 ? ? -108.80 71.04 2 1 GLN A 21 ? ? -61.55 0.02 3 1 THR A 30 ? ? -161.33 -169.54 4 1 ASP A 72 ? ? -54.52 -70.68 5 1 SER A 80 ? ? -64.13 -179.26 6 1 HIS A 82 ? ? -149.97 -65.55 7 1 ASP A 100 ? ? 84.21 11.00 8 1 ASP A 233 ? ? -146.29 29.87 9 1 LYS A 238 ? ? 39.65 52.44 10 1 SER A 295 ? ? 48.59 72.80 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 317 ? A HIS 317 2 1 Y 1 A HIS 318 ? A HIS 318 3 1 Y 1 A HIS 319 ? A HIS 319 4 1 Y 1 A HIS 320 ? A HIS 320 5 1 Y 1 A HIS 321 ? A HIS 321 6 1 Y 1 A HIS 322 ? A HIS 322 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #