data_5Y38 # _entry.id 5Y38 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5Y38 pdb_00005y38 10.2210/pdb5y38/pdb WWPDB D_1300004597 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5Y38 _pdbx_database_status.recvd_initial_deposition_date 2017-07-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, T.' 1 ? 'Ding, J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 1394 _citation.page_last 1394 _citation.title 'Structural basis for Ragulator functioning as a scaffold in membrane-anchoring of Rag GTPases and mTORC1' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-017-01567-4 _citation.pdbx_database_id_PubMed 29123114 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, T.' 1 ? primary 'Wang, R.' 2 ? primary 'Wang, Z.' 3 ? primary 'Wang, X.' 4 ? primary 'Wang, F.' 5 ? primary 'Ding, J.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5Y38 _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.541 _cell.length_a_esd ? _cell.length_b 58.541 _cell.length_b_esd ? _cell.length_c 90.012 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5Y38 _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ragulator complex protein LAMTOR5' 9622.900 1 ? ? 'Roadblock domain' ? 2 polymer man 'Ragulator complex protein LAMTOR4' 12012.636 1 ? ? 'Roadblock domain' ? 3 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 4 water nat water 18.015 10 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Hepatitis B virus X-interacting protein,HBX-interacting protein,Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5' 2 'Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHD GITVAVHKMAS ; ;MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHD GITVAVHKMAS ; A ? 2 'polypeptide(L)' no no ;MGMTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVT VSGQRVFVVKRQNRGREPIDVLEHHHHHH ; ;MGMTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVT VSGQRVFVVKRQNRGREPIDVLEHHHHHH ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ALA n 1 4 THR n 1 5 LEU n 1 6 GLU n 1 7 GLN n 1 8 HIS n 1 9 LEU n 1 10 GLU n 1 11 ASP n 1 12 THR n 1 13 MET n 1 14 LYS n 1 15 ASN n 1 16 PRO n 1 17 SER n 1 18 ILE n 1 19 VAL n 1 20 GLY n 1 21 VAL n 1 22 LEU n 1 23 CYS n 1 24 THR n 1 25 ASP n 1 26 SER n 1 27 GLN n 1 28 GLY n 1 29 LEU n 1 30 ASN n 1 31 LEU n 1 32 GLY n 1 33 CYS n 1 34 ARG n 1 35 GLY n 1 36 THR n 1 37 LEU n 1 38 SER n 1 39 ASP n 1 40 GLU n 1 41 HIS n 1 42 ALA n 1 43 GLY n 1 44 VAL n 1 45 ILE n 1 46 SER n 1 47 VAL n 1 48 LEU n 1 49 ALA n 1 50 GLN n 1 51 GLN n 1 52 ALA n 1 53 ALA n 1 54 LYS n 1 55 LEU n 1 56 THR n 1 57 SER n 1 58 ASP n 1 59 PRO n 1 60 THR n 1 61 ASP n 1 62 ILE n 1 63 PRO n 1 64 VAL n 1 65 VAL n 1 66 CYS n 1 67 LEU n 1 68 GLU n 1 69 SER n 1 70 ASP n 1 71 ASN n 1 72 GLY n 1 73 ASN n 1 74 ILE n 1 75 MET n 1 76 ILE n 1 77 GLN n 1 78 LYS n 1 79 HIS n 1 80 ASP n 1 81 GLY n 1 82 ILE n 1 83 THR n 1 84 VAL n 1 85 ALA n 1 86 VAL n 1 87 HIS n 1 88 LYS n 1 89 MET n 1 90 ALA n 1 91 SER n 2 1 MET n 2 2 GLY n 2 3 MET n 2 4 THR n 2 5 SER n 2 6 ALA n 2 7 LEU n 2 8 THR n 2 9 GLN n 2 10 GLY n 2 11 LEU n 2 12 GLU n 2 13 ARG n 2 14 ILE n 2 15 PRO n 2 16 ASP n 2 17 GLN n 2 18 LEU n 2 19 GLY n 2 20 TYR n 2 21 LEU n 2 22 VAL n 2 23 LEU n 2 24 SER n 2 25 GLU n 2 26 GLY n 2 27 ALA n 2 28 VAL n 2 29 LEU n 2 30 ALA n 2 31 SER n 2 32 SER n 2 33 GLY n 2 34 ASP n 2 35 LEU n 2 36 GLU n 2 37 ASN n 2 38 ASP n 2 39 GLU n 2 40 GLN n 2 41 ALA n 2 42 ALA n 2 43 SER n 2 44 ALA n 2 45 ILE n 2 46 SER n 2 47 GLU n 2 48 LEU n 2 49 VAL n 2 50 SER n 2 51 THR n 2 52 ALA n 2 53 CYS n 2 54 GLY n 2 55 PHE n 2 56 ARG n 2 57 LEU n 2 58 HIS n 2 59 ARG n 2 60 GLY n 2 61 MET n 2 62 ASN n 2 63 VAL n 2 64 PRO n 2 65 PHE n 2 66 LYS n 2 67 ARG n 2 68 LEU n 2 69 SER n 2 70 VAL n 2 71 VAL n 2 72 PHE n 2 73 GLY n 2 74 GLU n 2 75 HIS n 2 76 THR n 2 77 LEU n 2 78 LEU n 2 79 VAL n 2 80 THR n 2 81 VAL n 2 82 SER n 2 83 GLY n 2 84 GLN n 2 85 ARG n 2 86 VAL n 2 87 PHE n 2 88 VAL n 2 89 VAL n 2 90 LYS n 2 91 ARG n 2 92 GLN n 2 93 ASN n 2 94 ARG n 2 95 GLY n 2 96 ARG n 2 97 GLU n 2 98 PRO n 2 99 ILE n 2 100 ASP n 2 101 VAL n 2 102 LEU n 2 103 GLU n 2 104 HIS n 2 105 HIS n 2 106 HIS n 2 107 HIS n 2 108 HIS n 2 109 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 91 Human ? 'LAMTOR5, HBXIP, XIP' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3) codon plus' ? ? ? ? ? ? ? plasmid ? ? ? pET-Duet ? ? 2 1 sample 'Biological sequence' 1 109 Human ? 'LAMTOR4, C7orf59' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3) codon plus' ? ? ? ? ? ? ? plasmid ? ? ? pET28a ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP LTOR5_HUMAN O43504 ? 1 ;MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHD GITVAVHKMAS ; 1 2 UNP LTOR4_HUMAN Q0VGL1 ? 2 ;MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVS GQRVFVVKRQNRGREPIDV ; 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5Y38 A 1 ? 91 ? O43504 1 ? 91 ? 83 173 2 2 5Y38 B 3 ? 101 ? Q0VGL1 1 ? 99 ? 1 99 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 5Y38 MET B 1 ? UNP Q0VGL1 ? ? 'expression tag' -1 1 2 5Y38 GLY B 2 ? UNP Q0VGL1 ? ? 'expression tag' 0 2 2 5Y38 LEU B 102 ? UNP Q0VGL1 ? ? 'expression tag' 100 3 2 5Y38 GLU B 103 ? UNP Q0VGL1 ? ? 'expression tag' 101 4 2 5Y38 HIS B 104 ? UNP Q0VGL1 ? ? 'expression tag' 102 5 2 5Y38 HIS B 105 ? UNP Q0VGL1 ? ? 'expression tag' 103 6 2 5Y38 HIS B 106 ? UNP Q0VGL1 ? ? 'expression tag' 104 7 2 5Y38 HIS B 107 ? UNP Q0VGL1 ? ? 'expression tag' 105 8 2 5Y38 HIS B 108 ? UNP Q0VGL1 ? ? 'expression tag' 106 9 2 5Y38 HIS B 109 ? UNP Q0VGL1 ? ? 'expression tag' 107 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5Y38 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.16 M ammonium sulfate, 0.08 M sodium acetate trihydrate (pH 4.6), and 20% (w/v) PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX225HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-05-06 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5Y38 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.800 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4579 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.300 _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.403 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.800 2.900 ? ? ? ? ? ? ? 98.000 ? ? ? ? 0.477 ? ? ? ? ? ? ? ? 5.700 ? 1.128 ? ? ? ? ? 1 1 ? ? 2.900 3.020 ? ? ? ? ? ? ? 96.700 ? ? ? ? 0.326 ? ? ? ? ? ? ? ? 6.100 ? 1.140 ? ? ? ? ? 2 1 ? ? 3.020 3.150 ? ? ? ? ? ? ? 98.900 ? ? ? ? 0.267 ? ? ? ? ? ? ? ? 6.600 ? 1.250 ? ? ? ? ? 3 1 ? ? 3.150 3.320 ? ? ? ? ? ? ? 98.400 ? ? ? ? 0.186 ? ? ? ? ? ? ? ? 6.500 ? 1.162 ? ? ? ? ? 4 1 ? ? 3.320 3.530 ? ? ? ? ? ? ? 98.300 ? ? ? ? 0.137 ? ? ? ? ? ? ? ? 6.600 ? 1.243 ? ? ? ? ? 5 1 ? ? 3.530 3.800 ? ? ? ? ? ? ? 97.400 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 6.500 ? 1.910 ? ? ? ? ? 6 1 ? ? 3.800 4.180 ? ? ? ? ? ? ? 97.700 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 6.600 ? 1.489 ? ? ? ? ? 7 1 ? ? 4.180 4.790 ? ? ? ? ? ? ? 96.400 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 6.400 ? 2.041 ? ? ? ? ? 8 1 ? ? 4.790 6.030 ? ? ? ? ? ? ? 96.300 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 6.400 ? 1.315 ? ? ? ? ? 9 1 ? ? 6.030 50.000 ? ? ? ? ? ? ? 93.200 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 6.100 ? 1.305 ? ? ? ? ? 10 1 ? ? # _refine.aniso_B[1][1] -1.5500 _refine.aniso_B[1][2] -0.7700 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -1.5500 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 2.3200 _refine.B_iso_max 133.510 _refine.B_iso_mean 50.6740 _refine.B_iso_min 25.050 _refine.correlation_coeff_Fo_to_Fc 0.9290 _refine.correlation_coeff_Fo_to_Fc_free 0.9200 _refine.details 'U VALUES : WITH TLS ADDED' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5Y38 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8000 _refine.ls_d_res_low 50.0000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4370 _refine.ls_number_reflns_R_free 207 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.3800 _refine.ls_percent_reflns_R_free 4.5000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2168 _refine.ls_R_factor_R_free 0.2563 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2150 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3MS6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.3900 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 32.4850 _refine.overall_SU_ML 0.2770 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.8000 _refine_hist.d_res_low 50.0000 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 1230 _refine_hist.pdbx_number_residues_total 162 _refine_hist.pdbx_B_iso_mean_ligand 46.94 _refine_hist.pdbx_B_iso_mean_solvent 41.09 _refine_hist.pdbx_number_atoms_protein 1205 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.019 1230 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.075 1.971 1666 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 5.239 5.000 160 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.369 25.490 51 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 20.271 15.000 212 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.664 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.302 0.200 204 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.021 894 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 6.794 3.000 1230 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 11.466 5.000 6 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 5.083 5.000 1224 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.8000 _refine_ls_shell.d_res_low 2.8730 _refine_ls_shell.number_reflns_all 278 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 9 _refine_ls_shell.number_reflns_R_work 269 _refine_ls_shell.percent_reflns_obs 98.9300 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2460 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3600 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5Y38 _struct.title 'Crystal structure of C7orf59-HBXIP complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5Y38 _struct_keywords.text 'Ragulator, LAMTOR, HBXIP, C7orf59, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 7 ? LYS A 14 ? GLN A 89 LYS A 96 1 ? 8 HELX_P HELX_P2 AA2 SER A 38 ? GLU A 40 ? SER A 120 GLU A 122 5 ? 3 HELX_P HELX_P3 AA3 HIS A 41 ? LYS A 54 ? HIS A 123 LYS A 136 1 ? 14 HELX_P HELX_P4 AA4 ASP B 38 ? GLY B 54 ? ASP B 36 GLY B 52 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 62 _struct_mon_prot_cis.label_asym_id B _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 60 _struct_mon_prot_cis.auth_asym_id B _struct_mon_prot_cis.pdbx_label_comp_id_2 VAL _struct_mon_prot_cis.pdbx_label_seq_id_2 63 _struct_mon_prot_cis.pdbx_label_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 VAL _struct_mon_prot_cis.pdbx_auth_seq_id_2 61 _struct_mon_prot_cis.pdbx_auth_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.18 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 30 ? GLY A 35 ? ASN A 112 GLY A 117 AA1 2 ILE A 18 ? THR A 24 ? ILE A 100 THR A 106 AA1 3 ILE A 82 ? LYS A 88 ? ILE A 164 LYS A 170 AA1 4 ASN A 73 ? HIS A 79 ? ASN A 155 HIS A 161 AA1 5 VAL A 64 ? GLU A 68 ? VAL A 146 GLU A 150 AA1 6 ARG B 67 ? VAL B 71 ? ARG B 65 VAL B 69 AA1 7 HIS B 75 ? SER B 82 ? HIS B 73 SER B 80 AA1 8 ARG B 85 ? GLN B 92 ? ARG B 83 GLN B 90 AA1 9 GLN B 17 ? SER B 24 ? GLN B 15 SER B 22 AA1 10 ALA B 27 ? GLY B 33 ? ALA B 25 GLY B 31 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 31 ? O LEU A 113 N CYS A 23 ? N CYS A 105 AA1 2 3 N GLY A 20 ? N GLY A 102 O HIS A 87 ? O HIS A 169 AA1 3 4 O VAL A 84 ? O VAL A 166 N GLN A 77 ? N GLN A 159 AA1 4 5 O ILE A 76 ? O ILE A 158 N VAL A 65 ? N VAL A 147 AA1 5 6 N CYS A 66 ? N CYS A 148 O SER B 69 ? O SER B 67 AA1 6 7 N LEU B 68 ? N LEU B 66 O VAL B 79 ? O VAL B 77 AA1 7 8 N THR B 80 ? N THR B 78 O PHE B 87 ? O PHE B 85 AA1 8 9 O LYS B 90 ? O LYS B 88 N LEU B 18 ? N LEU B 16 AA1 9 10 N SER B 24 ? N SER B 22 O ALA B 27 ? O ALA B 25 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 201 ? 4 'binding site for residue SO4 A 201' AC2 Software A SO4 202 ? 7 'binding site for residue SO4 A 202' AC3 Software B SO4 201 ? 5 'binding site for residue SO4 B 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 SER A 26 ? SER A 108 . ? 1_555 ? 2 AC1 4 GLN A 50 ? GLN A 132 . ? 1_555 ? 3 AC1 4 LYS A 78 ? LYS A 160 . ? 1_555 ? 4 AC1 4 GLY A 81 ? GLY A 163 . ? 1_555 ? 5 AC2 7 MET A 13 ? MET A 95 . ? 1_555 ? 6 AC2 7 LYS A 14 ? LYS A 96 . ? 1_555 ? 7 AC2 7 ASN A 15 ? ASN A 97 . ? 1_555 ? 8 AC2 7 PRO A 16 ? PRO A 98 . ? 1_555 ? 9 AC2 7 ILE A 18 ? ILE A 100 . ? 1_555 ? 10 AC2 7 LEU A 29 ? LEU A 111 . ? 5_555 ? 11 AC2 7 ARG A 34 ? ARG A 116 . ? 1_555 ? 12 AC3 5 ALA A 53 ? ALA A 135 . ? 5_445 ? 13 AC3 5 THR A 56 ? THR A 138 . ? 5_445 ? 14 AC3 5 SER A 57 ? SER A 139 . ? 5_445 ? 15 AC3 5 ASP A 58 ? ASP A 140 . ? 5_445 ? 16 AC3 5 GLY B 83 ? GLY B 81 . ? 1_555 ? # _atom_sites.entry_id 5Y38 _atom_sites.fract_transf_matrix[1][1] 0.017082 _atom_sites.fract_transf_matrix[1][2] 0.009862 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019725 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011110 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 83 ? ? ? A . n A 1 2 GLU 2 84 ? ? ? A . n A 1 3 ALA 3 85 ? ? ? A . n A 1 4 THR 4 86 ? ? ? A . n A 1 5 LEU 5 87 ? ? ? A . n A 1 6 GLU 6 88 ? ? ? A . n A 1 7 GLN 7 89 89 GLN GLN A . n A 1 8 HIS 8 90 90 HIS HIS A . n A 1 9 LEU 9 91 91 LEU LEU A . n A 1 10 GLU 10 92 92 GLU GLU A . n A 1 11 ASP 11 93 93 ASP ASP A . n A 1 12 THR 12 94 94 THR THR A . n A 1 13 MET 13 95 95 MET MET A . n A 1 14 LYS 14 96 96 LYS LYS A . n A 1 15 ASN 15 97 97 ASN ASN A . n A 1 16 PRO 16 98 98 PRO PRO A . n A 1 17 SER 17 99 99 SER SER A . n A 1 18 ILE 18 100 100 ILE ILE A . n A 1 19 VAL 19 101 101 VAL VAL A . n A 1 20 GLY 20 102 102 GLY GLY A . n A 1 21 VAL 21 103 103 VAL VAL A . n A 1 22 LEU 22 104 104 LEU LEU A . n A 1 23 CYS 23 105 105 CYS CYS A . n A 1 24 THR 24 106 106 THR THR A . n A 1 25 ASP 25 107 107 ASP ASP A . n A 1 26 SER 26 108 108 SER SER A . n A 1 27 GLN 27 109 109 GLN GLN A . n A 1 28 GLY 28 110 110 GLY GLY A . n A 1 29 LEU 29 111 111 LEU LEU A . n A 1 30 ASN 30 112 112 ASN ASN A . n A 1 31 LEU 31 113 113 LEU LEU A . n A 1 32 GLY 32 114 114 GLY GLY A . n A 1 33 CYS 33 115 115 CYS CYS A . n A 1 34 ARG 34 116 116 ARG ARG A . n A 1 35 GLY 35 117 117 GLY GLY A . n A 1 36 THR 36 118 118 THR THR A . n A 1 37 LEU 37 119 119 LEU LEU A . n A 1 38 SER 38 120 120 SER SER A . n A 1 39 ASP 39 121 121 ASP ASP A . n A 1 40 GLU 40 122 122 GLU GLU A . n A 1 41 HIS 41 123 123 HIS HIS A . n A 1 42 ALA 42 124 124 ALA ALA A . n A 1 43 GLY 43 125 125 GLY GLY A . n A 1 44 VAL 44 126 126 VAL VAL A . n A 1 45 ILE 45 127 127 ILE ILE A . n A 1 46 SER 46 128 128 SER SER A . n A 1 47 VAL 47 129 129 VAL VAL A . n A 1 48 LEU 48 130 130 LEU LEU A . n A 1 49 ALA 49 131 131 ALA ALA A . n A 1 50 GLN 50 132 132 GLN GLN A . n A 1 51 GLN 51 133 133 GLN GLN A . n A 1 52 ALA 52 134 134 ALA ALA A . n A 1 53 ALA 53 135 135 ALA ALA A . n A 1 54 LYS 54 136 136 LYS LYS A . n A 1 55 LEU 55 137 137 LEU LEU A . n A 1 56 THR 56 138 138 THR THR A . n A 1 57 SER 57 139 139 SER SER A . n A 1 58 ASP 58 140 140 ASP ASP A . n A 1 59 PRO 59 141 141 PRO PRO A . n A 1 60 THR 60 142 142 THR THR A . n A 1 61 ASP 61 143 143 ASP ASP A . n A 1 62 ILE 62 144 144 ILE ILE A . n A 1 63 PRO 63 145 145 PRO PRO A . n A 1 64 VAL 64 146 146 VAL VAL A . n A 1 65 VAL 65 147 147 VAL VAL A . n A 1 66 CYS 66 148 148 CYS CYS A . n A 1 67 LEU 67 149 149 LEU LEU A . n A 1 68 GLU 68 150 150 GLU GLU A . n A 1 69 SER 69 151 151 SER SER A . n A 1 70 ASP 70 152 152 ASP ASP A . n A 1 71 ASN 71 153 153 ASN ASN A . n A 1 72 GLY 72 154 154 GLY GLY A . n A 1 73 ASN 73 155 155 ASN ASN A . n A 1 74 ILE 74 156 156 ILE ILE A . n A 1 75 MET 75 157 157 MET MET A . n A 1 76 ILE 76 158 158 ILE ILE A . n A 1 77 GLN 77 159 159 GLN GLN A . n A 1 78 LYS 78 160 160 LYS LYS A . n A 1 79 HIS 79 161 161 HIS HIS A . n A 1 80 ASP 80 162 162 ASP ASP A . n A 1 81 GLY 81 163 163 GLY GLY A . n A 1 82 ILE 82 164 164 ILE ILE A . n A 1 83 THR 83 165 165 THR THR A . n A 1 84 VAL 84 166 166 VAL VAL A . n A 1 85 ALA 85 167 167 ALA ALA A . n A 1 86 VAL 86 168 168 VAL VAL A . n A 1 87 HIS 87 169 169 HIS HIS A . n A 1 88 LYS 88 170 170 LYS LYS A . n A 1 89 MET 89 171 171 MET MET A . n A 1 90 ALA 90 172 172 ALA ALA A . n A 1 91 SER 91 173 ? ? ? A . n B 2 1 MET 1 -1 ? ? ? B . n B 2 2 GLY 2 0 ? ? ? B . n B 2 3 MET 3 1 ? ? ? B . n B 2 4 THR 4 2 ? ? ? B . n B 2 5 SER 5 3 ? ? ? B . n B 2 6 ALA 6 4 ? ? ? B . n B 2 7 LEU 7 5 ? ? ? B . n B 2 8 THR 8 6 ? ? ? B . n B 2 9 GLN 9 7 ? ? ? B . n B 2 10 GLY 10 8 ? ? ? B . n B 2 11 LEU 11 9 ? ? ? B . n B 2 12 GLU 12 10 ? ? ? B . n B 2 13 ARG 13 11 ? ? ? B . n B 2 14 ILE 14 12 ? ? ? B . n B 2 15 PRO 15 13 ? ? ? B . n B 2 16 ASP 16 14 14 ASP ASP B . n B 2 17 GLN 17 15 15 GLN GLN B . n B 2 18 LEU 18 16 16 LEU LEU B . n B 2 19 GLY 19 17 17 GLY GLY B . n B 2 20 TYR 20 18 18 TYR TYR B . n B 2 21 LEU 21 19 19 LEU LEU B . n B 2 22 VAL 22 20 20 VAL VAL B . n B 2 23 LEU 23 21 21 LEU LEU B . n B 2 24 SER 24 22 22 SER SER B . n B 2 25 GLU 25 23 23 GLU GLU B . n B 2 26 GLY 26 24 24 GLY GLY B . n B 2 27 ALA 27 25 25 ALA ALA B . n B 2 28 VAL 28 26 26 VAL VAL B . n B 2 29 LEU 29 27 27 LEU LEU B . n B 2 30 ALA 30 28 28 ALA ALA B . n B 2 31 SER 31 29 29 SER SER B . n B 2 32 SER 32 30 30 SER SER B . n B 2 33 GLY 33 31 31 GLY GLY B . n B 2 34 ASP 34 32 32 ASP ASP B . n B 2 35 LEU 35 33 33 LEU LEU B . n B 2 36 GLU 36 34 34 GLU GLU B . n B 2 37 ASN 37 35 35 ASN ASN B . n B 2 38 ASP 38 36 36 ASP ASP B . n B 2 39 GLU 39 37 37 GLU GLU B . n B 2 40 GLN 40 38 38 GLN GLN B . n B 2 41 ALA 41 39 39 ALA ALA B . n B 2 42 ALA 42 40 40 ALA ALA B . n B 2 43 SER 43 41 41 SER SER B . n B 2 44 ALA 44 42 42 ALA ALA B . n B 2 45 ILE 45 43 43 ILE ILE B . n B 2 46 SER 46 44 44 SER SER B . n B 2 47 GLU 47 45 45 GLU GLU B . n B 2 48 LEU 48 46 46 LEU LEU B . n B 2 49 VAL 49 47 47 VAL VAL B . n B 2 50 SER 50 48 48 SER SER B . n B 2 51 THR 51 49 49 THR THR B . n B 2 52 ALA 52 50 50 ALA ALA B . n B 2 53 CYS 53 51 51 CYS CYS B . n B 2 54 GLY 54 52 52 GLY GLY B . n B 2 55 PHE 55 53 53 PHE PHE B . n B 2 56 ARG 56 54 54 ARG ARG B . n B 2 57 LEU 57 55 55 LEU LEU B . n B 2 58 HIS 58 56 56 HIS HIS B . n B 2 59 ARG 59 57 57 ARG ARG B . n B 2 60 GLY 60 58 58 GLY GLY B . n B 2 61 MET 61 59 59 MET MET B . n B 2 62 ASN 62 60 60 ASN ASN B . n B 2 63 VAL 63 61 61 VAL VAL B . n B 2 64 PRO 64 62 62 PRO PRO B . n B 2 65 PHE 65 63 63 PHE PHE B . n B 2 66 LYS 66 64 64 LYS LYS B . n B 2 67 ARG 67 65 65 ARG ARG B . n B 2 68 LEU 68 66 66 LEU LEU B . n B 2 69 SER 69 67 67 SER SER B . n B 2 70 VAL 70 68 68 VAL VAL B . n B 2 71 VAL 71 69 69 VAL VAL B . n B 2 72 PHE 72 70 70 PHE PHE B . n B 2 73 GLY 73 71 71 GLY GLY B . n B 2 74 GLU 74 72 72 GLU GLU B . n B 2 75 HIS 75 73 73 HIS HIS B . n B 2 76 THR 76 74 74 THR THR B . n B 2 77 LEU 77 75 75 LEU LEU B . n B 2 78 LEU 78 76 76 LEU LEU B . n B 2 79 VAL 79 77 77 VAL VAL B . n B 2 80 THR 80 78 78 THR THR B . n B 2 81 VAL 81 79 79 VAL VAL B . n B 2 82 SER 82 80 80 SER SER B . n B 2 83 GLY 83 81 81 GLY GLY B . n B 2 84 GLN 84 82 82 GLN GLN B . n B 2 85 ARG 85 83 83 ARG ARG B . n B 2 86 VAL 86 84 84 VAL VAL B . n B 2 87 PHE 87 85 85 PHE PHE B . n B 2 88 VAL 88 86 86 VAL VAL B . n B 2 89 VAL 89 87 87 VAL VAL B . n B 2 90 LYS 90 88 88 LYS LYS B . n B 2 91 ARG 91 89 89 ARG ARG B . n B 2 92 GLN 92 90 90 GLN GLN B . n B 2 93 ASN 93 91 91 ASN ASN B . n B 2 94 ARG 94 92 ? ? ? B . n B 2 95 GLY 95 93 ? ? ? B . n B 2 96 ARG 96 94 ? ? ? B . n B 2 97 GLU 97 95 ? ? ? B . n B 2 98 PRO 98 96 ? ? ? B . n B 2 99 ILE 99 97 ? ? ? B . n B 2 100 ASP 100 98 ? ? ? B . n B 2 101 VAL 101 99 ? ? ? B . n B 2 102 LEU 102 100 ? ? ? B . n B 2 103 GLU 103 101 ? ? ? B . n B 2 104 HIS 104 102 ? ? ? B . n B 2 105 HIS 105 103 ? ? ? B . n B 2 106 HIS 106 104 ? ? ? B . n B 2 107 HIS 107 105 ? ? ? B . n B 2 108 HIS 108 106 ? ? ? B . n B 2 109 HIS 109 107 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 201 1 SO4 SO4 A . D 3 SO4 1 202 3 SO4 SO4 A . E 3 SO4 1 201 2 SO4 SO4 B . F 4 HOH 1 301 4 HOH HOH A . F 4 HOH 2 302 9 HOH HOH A . F 4 HOH 3 303 6 HOH HOH A . F 4 HOH 4 304 10 HOH HOH A . F 4 HOH 5 305 2 HOH HOH A . G 4 HOH 1 301 5 HOH HOH B . G 4 HOH 2 302 7 HOH HOH B . G 4 HOH 3 303 1 HOH HOH B . G 4 HOH 4 304 3 HOH HOH B . G 4 HOH 5 305 8 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2550 ? 1 MORE -54 ? 1 'SSA (A^2)' 8800 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-06 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 24.1519 -11.2694 11.5014 0.1404 0.1539 0.0903 -0.0106 -0.0081 -0.0068 1.3156 2.7392 0.4419 -1.2486 0.1391 -0.3054 -0.0287 0.0124 0.0163 0.0069 -0.1228 0.0035 -0.0169 -0.0901 0.0750 'X-RAY DIFFRACTION' 2 ? refined 19.8377 -29.0369 9.6399 0.1349 0.1361 0.0981 0.0121 -0.0051 -0.0109 3.0507 2.5808 1.0241 -0.2330 -0.7211 0.1331 -0.1032 0.0431 0.0601 0.0464 -0.1264 -0.0942 -0.1264 0.0324 -0.0160 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 89 A 172 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 B 14 B 91 ? ? ? ? ? ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.6.0117 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 153 ? ? -95.30 42.69 2 1 GLU B 23 ? ? 55.41 12.25 3 1 PHE B 70 ? ? -122.91 -153.40 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 83 ? A MET 1 2 1 Y 1 A GLU 84 ? A GLU 2 3 1 Y 1 A ALA 85 ? A ALA 3 4 1 Y 1 A THR 86 ? A THR 4 5 1 Y 1 A LEU 87 ? A LEU 5 6 1 Y 1 A GLU 88 ? A GLU 6 7 1 Y 1 A SER 173 ? A SER 91 8 1 Y 1 B MET -1 ? B MET 1 9 1 Y 1 B GLY 0 ? B GLY 2 10 1 Y 1 B MET 1 ? B MET 3 11 1 Y 1 B THR 2 ? B THR 4 12 1 Y 1 B SER 3 ? B SER 5 13 1 Y 1 B ALA 4 ? B ALA 6 14 1 Y 1 B LEU 5 ? B LEU 7 15 1 Y 1 B THR 6 ? B THR 8 16 1 Y 1 B GLN 7 ? B GLN 9 17 1 Y 1 B GLY 8 ? B GLY 10 18 1 Y 1 B LEU 9 ? B LEU 11 19 1 Y 1 B GLU 10 ? B GLU 12 20 1 Y 1 B ARG 11 ? B ARG 13 21 1 Y 1 B ILE 12 ? B ILE 14 22 1 Y 1 B PRO 13 ? B PRO 15 23 1 Y 1 B ARG 92 ? B ARG 94 24 1 Y 1 B GLY 93 ? B GLY 95 25 1 Y 1 B ARG 94 ? B ARG 96 26 1 Y 1 B GLU 95 ? B GLU 97 27 1 Y 1 B PRO 96 ? B PRO 98 28 1 Y 1 B ILE 97 ? B ILE 99 29 1 Y 1 B ASP 98 ? B ASP 100 30 1 Y 1 B VAL 99 ? B VAL 101 31 1 Y 1 B LEU 100 ? B LEU 102 32 1 Y 1 B GLU 101 ? B GLU 103 33 1 Y 1 B HIS 102 ? B HIS 104 34 1 Y 1 B HIS 103 ? B HIS 105 35 1 Y 1 B HIS 104 ? B HIS 106 36 1 Y 1 B HIS 105 ? B HIS 107 37 1 Y 1 B HIS 106 ? B HIS 108 38 1 Y 1 B HIS 107 ? B HIS 109 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TYR N N N N 326 TYR CA C N S 327 TYR C C N N 328 TYR O O N N 329 TYR CB C N N 330 TYR CG C Y N 331 TYR CD1 C Y N 332 TYR CD2 C Y N 333 TYR CE1 C Y N 334 TYR CE2 C Y N 335 TYR CZ C Y N 336 TYR OH O N N 337 TYR OXT O N N 338 TYR H H N N 339 TYR H2 H N N 340 TYR HA H N N 341 TYR HB2 H N N 342 TYR HB3 H N N 343 TYR HD1 H N N 344 TYR HD2 H N N 345 TYR HE1 H N N 346 TYR HE2 H N N 347 TYR HH H N N 348 TYR HXT H N N 349 VAL N N N N 350 VAL CA C N S 351 VAL C C N N 352 VAL O O N N 353 VAL CB C N N 354 VAL CG1 C N N 355 VAL CG2 C N N 356 VAL OXT O N N 357 VAL H H N N 358 VAL H2 H N N 359 VAL HA H N N 360 VAL HB H N N 361 VAL HG11 H N N 362 VAL HG12 H N N 363 VAL HG13 H N N 364 VAL HG21 H N N 365 VAL HG22 H N N 366 VAL HG23 H N N 367 VAL HXT H N N 368 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TYR N CA sing N N 310 TYR N H sing N N 311 TYR N H2 sing N N 312 TYR CA C sing N N 313 TYR CA CB sing N N 314 TYR CA HA sing N N 315 TYR C O doub N N 316 TYR C OXT sing N N 317 TYR CB CG sing N N 318 TYR CB HB2 sing N N 319 TYR CB HB3 sing N N 320 TYR CG CD1 doub Y N 321 TYR CG CD2 sing Y N 322 TYR CD1 CE1 sing Y N 323 TYR CD1 HD1 sing N N 324 TYR CD2 CE2 doub Y N 325 TYR CD2 HD2 sing N N 326 TYR CE1 CZ doub Y N 327 TYR CE1 HE1 sing N N 328 TYR CE2 CZ sing Y N 329 TYR CE2 HE2 sing N N 330 TYR CZ OH sing N N 331 TYR OH HH sing N N 332 TYR OXT HXT sing N N 333 VAL N CA sing N N 334 VAL N H sing N N 335 VAL N H2 sing N N 336 VAL CA C sing N N 337 VAL CA CB sing N N 338 VAL CA HA sing N N 339 VAL C O doub N N 340 VAL C OXT sing N N 341 VAL CB CG1 sing N N 342 VAL CB CG2 sing N N 343 VAL CB HB sing N N 344 VAL CG1 HG11 sing N N 345 VAL CG1 HG12 sing N N 346 VAL CG1 HG13 sing N N 347 VAL CG2 HG21 sing N N 348 VAL CG2 HG22 sing N N 349 VAL CG2 HG23 sing N N 350 VAL OXT HXT sing N N 351 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3MS6 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #