data_5Y8R # _entry.id 5Y8R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5Y8R pdb_00005y8r 10.2210/pdb5y8r/pdb WWPDB D_1300004841 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5Y8R _pdbx_database_status.recvd_initial_deposition_date 2017-08-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bae, J.E.' 1 ? 'Kim, I.J.' 2 ? 'Nam, K.H.' 3 0000-0003-3268-354X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochem. Biophys. Res. Commun.' _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 493 _citation.language ? _citation.page_first 562 _citation.page_last 567 _citation.title ;Disruption of the hydrogen bonding network determines the pH-induced non-fluorescent state of the fluorescent protein ZsYellow by protonation of Glu221. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2017.08.152 _citation.pdbx_database_id_PubMed 28867188 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bae, J.E.' 1 ? primary 'Kim, I.J.' 2 ? primary 'Nam, K.H.' 3 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5Y8R _cell.details ? _cell.formula_units_Z ? _cell.length_a 111.178 _cell.length_a_esd ? _cell.length_b 111.178 _cell.length_b_esd ? _cell.length_c 103.751 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5Y8R _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GFP-like fluorescent chromoprotein FP538' 26416.412 1 ? M129V ? ? 2 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name zFP538 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSHMAHSKHGLKEEMTMKYHMEGCVNGHKFVITGEGIGYPFKGKQTINLCVIEGGPLPFSEDILSAG(NFA)(CH7)DRI FTEYPQDIVDYFKNSCPAGYTWGRSFLFEDGAVCICNVDITVSVKENCIYHKSIFNGVNFPADGPVMKKMTTNWEASCEK IMPVPKQGILKGDVSMYLLLKDGGRYRCQFDTVYKAKSVPSKMPEWHFIQHKLLREDRSDAKNQKWQLTEHAIAFPSALA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMAHSKHGLKEEMTMKYHMEGCVNGHKFVITGEGIGYPFKGKQTINLCVIEGGPLPFSEDILSAGFKYGDRIFTEYPQ DIVDYFKNSCPAGYTWGRSFLFEDGAVCICNVDITVSVKENCIYHKSIFNGVNFPADGPVMKKMTTNWEASCEKIMPVPK QGILKGDVSMYLLLKDGGRYRCQFDTVYKAKSVPSKMPEWHFIQHKLLREDRSDAKNQKWQLTEHAIAFPSALA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 HIS n 1 7 SER n 1 8 LYS n 1 9 HIS n 1 10 GLY n 1 11 LEU n 1 12 LYS n 1 13 GLU n 1 14 GLU n 1 15 MET n 1 16 THR n 1 17 MET n 1 18 LYS n 1 19 TYR n 1 20 HIS n 1 21 MET n 1 22 GLU n 1 23 GLY n 1 24 CYS n 1 25 VAL n 1 26 ASN n 1 27 GLY n 1 28 HIS n 1 29 LYS n 1 30 PHE n 1 31 VAL n 1 32 ILE n 1 33 THR n 1 34 GLY n 1 35 GLU n 1 36 GLY n 1 37 ILE n 1 38 GLY n 1 39 TYR n 1 40 PRO n 1 41 PHE n 1 42 LYS n 1 43 GLY n 1 44 LYS n 1 45 GLN n 1 46 THR n 1 47 ILE n 1 48 ASN n 1 49 LEU n 1 50 CYS n 1 51 VAL n 1 52 ILE n 1 53 GLU n 1 54 GLY n 1 55 GLY n 1 56 PRO n 1 57 LEU n 1 58 PRO n 1 59 PHE n 1 60 SER n 1 61 GLU n 1 62 ASP n 1 63 ILE n 1 64 LEU n 1 65 SER n 1 66 ALA n 1 67 GLY n 1 68 NFA n 1 69 CH7 n 1 70 ASP n 1 71 ARG n 1 72 ILE n 1 73 PHE n 1 74 THR n 1 75 GLU n 1 76 TYR n 1 77 PRO n 1 78 GLN n 1 79 ASP n 1 80 ILE n 1 81 VAL n 1 82 ASP n 1 83 TYR n 1 84 PHE n 1 85 LYS n 1 86 ASN n 1 87 SER n 1 88 CYS n 1 89 PRO n 1 90 ALA n 1 91 GLY n 1 92 TYR n 1 93 THR n 1 94 TRP n 1 95 GLY n 1 96 ARG n 1 97 SER n 1 98 PHE n 1 99 LEU n 1 100 PHE n 1 101 GLU n 1 102 ASP n 1 103 GLY n 1 104 ALA n 1 105 VAL n 1 106 CYS n 1 107 ILE n 1 108 CYS n 1 109 ASN n 1 110 VAL n 1 111 ASP n 1 112 ILE n 1 113 THR n 1 114 VAL n 1 115 SER n 1 116 VAL n 1 117 LYS n 1 118 GLU n 1 119 ASN n 1 120 CYS n 1 121 ILE n 1 122 TYR n 1 123 HIS n 1 124 LYS n 1 125 SER n 1 126 ILE n 1 127 PHE n 1 128 ASN n 1 129 GLY n 1 130 VAL n 1 131 ASN n 1 132 PHE n 1 133 PRO n 1 134 ALA n 1 135 ASP n 1 136 GLY n 1 137 PRO n 1 138 VAL n 1 139 MET n 1 140 LYS n 1 141 LYS n 1 142 MET n 1 143 THR n 1 144 THR n 1 145 ASN n 1 146 TRP n 1 147 GLU n 1 148 ALA n 1 149 SER n 1 150 CYS n 1 151 GLU n 1 152 LYS n 1 153 ILE n 1 154 MET n 1 155 PRO n 1 156 VAL n 1 157 PRO n 1 158 LYS n 1 159 GLN n 1 160 GLY n 1 161 ILE n 1 162 LEU n 1 163 LYS n 1 164 GLY n 1 165 ASP n 1 166 VAL n 1 167 SER n 1 168 MET n 1 169 TYR n 1 170 LEU n 1 171 LEU n 1 172 LEU n 1 173 LYS n 1 174 ASP n 1 175 GLY n 1 176 GLY n 1 177 ARG n 1 178 TYR n 1 179 ARG n 1 180 CYS n 1 181 GLN n 1 182 PHE n 1 183 ASP n 1 184 THR n 1 185 VAL n 1 186 TYR n 1 187 LYS n 1 188 ALA n 1 189 LYS n 1 190 SER n 1 191 VAL n 1 192 PRO n 1 193 SER n 1 194 LYS n 1 195 MET n 1 196 PRO n 1 197 GLU n 1 198 TRP n 1 199 HIS n 1 200 PHE n 1 201 ILE n 1 202 GLN n 1 203 HIS n 1 204 LYS n 1 205 LEU n 1 206 LEU n 1 207 ARG n 1 208 GLU n 1 209 ASP n 1 210 ARG n 1 211 SER n 1 212 ASP n 1 213 ALA n 1 214 LYS n 1 215 ASN n 1 216 GLN n 1 217 LYS n 1 218 TRP n 1 219 GLN n 1 220 LEU n 1 221 THR n 1 222 GLU n 1 223 HIS n 1 224 ALA n 1 225 ILE n 1 226 ALA n 1 227 PHE n 1 228 PRO n 1 229 SER n 1 230 ALA n 1 231 LEU n 1 232 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 232 _entity_src_gen.gene_src_common_name 'Green polyp' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Zoanthus sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 105402 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GFPL2_ZOASP _struct_ref.pdbx_db_accession Q9U6Y4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAHSKHGLKEEMTMKYHMEGCVNGHKFVITGEGIGYPFKGKQTINLCVIEGGPLPFSEDILSAGFKYGDRIFTEYPQDIV DYFKNSCPAGYTWGRSFLFEDGAVCICNVDITVSVKENCIYHKSIFNGMNFPADGPVMKKMTTNWEASCEKIMPVPKQGI LKGDVSMYLLLKDGGRYRCQFDTVYKAKSVPSKMPEWHFIQHKLLREDRSDAKNQKWQLTEHAIAFPSALA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5Y8R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 232 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9U6Y4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 231 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5Y8R GLY A 1 ? UNP Q9U6Y4 ? ? 'expression tag' -2 1 1 5Y8R SER A 2 ? UNP Q9U6Y4 ? ? 'expression tag' -1 2 1 5Y8R HIS A 3 ? UNP Q9U6Y4 ? ? 'expression tag' 0 3 1 5Y8R CH7 A 69 ? UNP Q9U6Y4 LYS 66 chromophore 66 4 1 5Y8R CH7 A 69 ? UNP Q9U6Y4 TYR 67 chromophore 66 5 1 5Y8R CH7 A 69 ? UNP Q9U6Y4 GLY 68 chromophore 66 6 1 5Y8R VAL A 130 ? UNP Q9U6Y4 MET 129 'engineered mutation' 129 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CH7 'L-peptide linking' n '[(4Z)-4-(4-HYDROXYBENZYLIDENE)-5-OXO-2-(3,4,5,6-TETRAHYDROPYRIDIN-2-YL)-4,5-DIHYDRO-1H-IMIDAZOL-1-YL]ACETIC ACID' 'CHROMOPHORE (LYS-TYR-GLY)' 'C17 H17 N3 O4' 327.335 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NFA 'L-peptide linking' n 'PHENYLALANINE AMIDE' ? 'C9 H12 N2 O' 164.204 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5Y8R _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295.5 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Na-citrate, NaCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-11-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5Y8R _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 20.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13860 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 39.421 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -2.2000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -2.2000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 4.4000 _refine.B_iso_max 151.860 _refine.B_iso_mean 68.3600 _refine.B_iso_min 35.760 _refine.correlation_coeff_Fo_to_Fc 0.9600 _refine.correlation_coeff_Fo_to_Fc_free 0.9390 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5Y8R _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3000 _refine.ls_d_res_low 19.1600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13171 _refine.ls_number_reflns_R_free 662 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.8300 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2080 _refine.ls_R_factor_R_free 0.2575 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2056 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2OGR _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2710 _refine.pdbx_overall_ESU_R_Free 0.2280 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.5640 _refine.overall_SU_ML 0.1940 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.3000 _refine_hist.d_res_low 19.1600 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 1811 _refine_hist.pdbx_number_residues_total 223 _refine_hist.pdbx_B_iso_mean_solvent 55.49 _refine_hist.pdbx_number_atoms_protein 1790 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.016 0.019 1839 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1734 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.981 1.972 2474 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.833 3.000 4012 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.090 5.000 218 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.596 24.430 79 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.561 15.000 319 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.513 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.112 0.200 255 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.021 2041 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 428 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.3010 _refine_ls_shell.d_res_low 2.3600 _refine_ls_shell.number_reflns_all 968 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 49 _refine_ls_shell.number_reflns_R_work 919 _refine_ls_shell.percent_reflns_obs 91.2300 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4390 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.4030 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5Y8R _struct.title 'ZsYellow at pH 3.5' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5Y8R _struct_keywords.text 'ZsYellow, pH, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 60 ? SER A 65 ? SER A 57 SER A 62 5 ? 6 HELX_P HELX_P2 AA2 ASP A 70 ? THR A 74 ? ASP A 69 THR A 73 5 ? 5 HELX_P HELX_P3 AA3 ASP A 82 ? SER A 87 ? ASP A 81 SER A 86 1 ? 6 HELX_P HELX_P4 AA4 PRO A 157 ? GLN A 159 ? PRO A 156 GLN A 158 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLY 67 C ? ? ? 1_555 A NFA 68 N ? ? A GLY 64 A NFA 65 1_555 ? ? ? ? ? ? ? 1.283 ? ? covale2 covale both ? A CH7 69 C3 ? ? ? 1_555 A ASP 70 N ? ? A CH7 66 A ASP 69 1_555 ? ? ? ? ? ? ? 1.275 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 55 A . ? GLY 52 A PRO 56 A ? PRO 53 A 1 -0.53 2 CYS 88 A . ? CYS 87 A PRO 89 A ? PRO 88 A 1 13.82 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 13 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel AA1 12 13 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 143 ? TRP A 146 ? THR A 142 TRP A 145 AA1 2 ILE A 161 ? LEU A 172 ? ILE A 160 LEU A 171 AA1 3 ARG A 177 ? ALA A 188 ? ARG A 176 ALA A 187 AA1 4 TYR A 92 ? PHE A 100 ? TYR A 91 PHE A 99 AA1 5 VAL A 105 ? SER A 115 ? VAL A 104 SER A 114 AA1 6 CYS A 120 ? VAL A 130 ? CYS A 119 VAL A 129 AA1 7 MET A 15 ? VAL A 25 ? MET A 12 VAL A 22 AA1 8 HIS A 28 ? GLY A 38 ? HIS A 25 GLY A 35 AA1 9 LYS A 44 ? GLU A 53 ? LYS A 41 GLU A 50 AA1 10 LYS A 217 ? PRO A 228 ? LYS A 216 PRO A 227 AA1 11 HIS A 199 ? ASP A 209 ? HIS A 198 ASP A 208 AA1 12 SER A 149 ? PRO A 155 ? SER A 148 PRO A 154 AA1 13 ILE A 161 ? LEU A 172 ? ILE A 160 LEU A 171 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 145 ? N ASN A 144 O LEU A 171 ? O LEU A 170 AA1 2 3 N LEU A 162 ? N LEU A 161 O TYR A 186 ? O TYR A 185 AA1 3 4 O LYS A 187 ? O LYS A 186 N THR A 93 ? N THR A 92 AA1 4 5 N PHE A 98 ? N PHE A 97 O CYS A 106 ? O CYS A 105 AA1 5 6 N SER A 115 ? N SER A 114 O CYS A 120 ? O CYS A 119 AA1 6 7 O SER A 125 ? O SER A 124 N HIS A 20 ? N HIS A 17 AA1 7 8 N MET A 21 ? N MET A 18 O ILE A 32 ? O ILE A 29 AA1 8 9 N GLU A 35 ? N GLU A 32 O ASN A 48 ? O ASN A 45 AA1 9 10 N LEU A 49 ? N LEU A 46 O TRP A 218 ? O TRP A 217 AA1 10 11 O ILE A 225 ? O ILE A 224 N GLN A 202 ? N GLN A 201 AA1 11 12 O HIS A 199 ? O HIS A 198 N ILE A 153 ? N ILE A 152 AA1 12 13 N MET A 154 ? N MET A 153 O LYS A 163 ? O LYS A 162 # _atom_sites.entry_id 5Y8R _atom_sites.fract_transf_matrix[1][1] 0.008995 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008995 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009638 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 ALA 5 2 ? ? ? A . n A 1 6 HIS 6 3 ? ? ? A . n A 1 7 SER 7 4 ? ? ? A . n A 1 8 LYS 8 5 5 LYS LYS A . n A 1 9 HIS 9 6 6 HIS HIS A . n A 1 10 GLY 10 7 7 GLY GLY A . n A 1 11 LEU 11 8 8 LEU LEU A . n A 1 12 LYS 12 9 9 LYS LYS A . n A 1 13 GLU 13 10 10 GLU GLU A . n A 1 14 GLU 14 11 11 GLU GLU A . n A 1 15 MET 15 12 12 MET MET A . n A 1 16 THR 16 13 13 THR THR A . n A 1 17 MET 17 14 14 MET MET A . n A 1 18 LYS 18 15 15 LYS LYS A . n A 1 19 TYR 19 16 16 TYR TYR A . n A 1 20 HIS 20 17 17 HIS HIS A . n A 1 21 MET 21 18 18 MET MET A . n A 1 22 GLU 22 19 19 GLU GLU A . n A 1 23 GLY 23 20 20 GLY GLY A . n A 1 24 CYS 24 21 21 CYS CYS A . n A 1 25 VAL 25 22 22 VAL VAL A . n A 1 26 ASN 26 23 23 ASN ASN A . n A 1 27 GLY 27 24 24 GLY GLY A . n A 1 28 HIS 28 25 25 HIS HIS A . n A 1 29 LYS 29 26 26 LYS LYS A . n A 1 30 PHE 30 27 27 PHE PHE A . n A 1 31 VAL 31 28 28 VAL VAL A . n A 1 32 ILE 32 29 29 ILE ILE A . n A 1 33 THR 33 30 30 THR THR A . n A 1 34 GLY 34 31 31 GLY GLY A . n A 1 35 GLU 35 32 32 GLU GLU A . n A 1 36 GLY 36 33 33 GLY GLY A . n A 1 37 ILE 37 34 34 ILE ILE A . n A 1 38 GLY 38 35 35 GLY GLY A . n A 1 39 TYR 39 36 36 TYR TYR A . n A 1 40 PRO 40 37 37 PRO PRO A . n A 1 41 PHE 41 38 38 PHE PHE A . n A 1 42 LYS 42 39 39 LYS LYS A . n A 1 43 GLY 43 40 40 GLY GLY A . n A 1 44 LYS 44 41 41 LYS LYS A . n A 1 45 GLN 45 42 42 GLN GLN A . n A 1 46 THR 46 43 43 THR THR A . n A 1 47 ILE 47 44 44 ILE ILE A . n A 1 48 ASN 48 45 45 ASN ASN A . n A 1 49 LEU 49 46 46 LEU LEU A . n A 1 50 CYS 50 47 47 CYS CYS A . n A 1 51 VAL 51 48 48 VAL VAL A . n A 1 52 ILE 52 49 49 ILE ILE A . n A 1 53 GLU 53 50 50 GLU GLU A . n A 1 54 GLY 54 51 51 GLY GLY A . n A 1 55 GLY 55 52 52 GLY GLY A . n A 1 56 PRO 56 53 53 PRO PRO A . n A 1 57 LEU 57 54 54 LEU LEU A . n A 1 58 PRO 58 55 55 PRO PRO A . n A 1 59 PHE 59 56 56 PHE PHE A . n A 1 60 SER 60 57 57 SER SER A . n A 1 61 GLU 61 58 58 GLU GLU A . n A 1 62 ASP 62 59 59 ASP ASP A . n A 1 63 ILE 63 60 60 ILE ILE A . n A 1 64 LEU 64 61 61 LEU LEU A . n A 1 65 SER 65 62 62 SER SER A . n A 1 66 ALA 66 63 63 ALA ALA A . n A 1 67 GLY 67 64 64 GLY GLY A . n A 1 68 NFA 68 65 65 NFA NFA A . n A 1 69 CH7 69 66 66 CH7 CH7 A . n A 1 70 ASP 70 69 69 ASP ASP A . n A 1 71 ARG 71 70 70 ARG ARG A . n A 1 72 ILE 72 71 71 ILE ILE A . n A 1 73 PHE 73 72 72 PHE PHE A . n A 1 74 THR 74 73 73 THR THR A . n A 1 75 GLU 75 74 74 GLU GLU A . n A 1 76 TYR 76 75 75 TYR TYR A . n A 1 77 PRO 77 76 76 PRO PRO A . n A 1 78 GLN 78 77 77 GLN GLN A . n A 1 79 ASP 79 78 78 ASP ASP A . n A 1 80 ILE 80 79 79 ILE ILE A . n A 1 81 VAL 81 80 80 VAL VAL A . n A 1 82 ASP 82 81 81 ASP ASP A . n A 1 83 TYR 83 82 82 TYR TYR A . n A 1 84 PHE 84 83 83 PHE PHE A . n A 1 85 LYS 85 84 84 LYS LYS A . n A 1 86 ASN 86 85 85 ASN ASN A . n A 1 87 SER 87 86 86 SER SER A . n A 1 88 CYS 88 87 87 CYS CYS A . n A 1 89 PRO 89 88 88 PRO PRO A . n A 1 90 ALA 90 89 89 ALA ALA A . n A 1 91 GLY 91 90 90 GLY GLY A . n A 1 92 TYR 92 91 91 TYR TYR A . n A 1 93 THR 93 92 92 THR THR A . n A 1 94 TRP 94 93 93 TRP TRP A . n A 1 95 GLY 95 94 94 GLY GLY A . n A 1 96 ARG 96 95 95 ARG ARG A . n A 1 97 SER 97 96 96 SER SER A . n A 1 98 PHE 98 97 97 PHE PHE A . n A 1 99 LEU 99 98 98 LEU LEU A . n A 1 100 PHE 100 99 99 PHE PHE A . n A 1 101 GLU 101 100 100 GLU GLU A . n A 1 102 ASP 102 101 101 ASP ASP A . n A 1 103 GLY 103 102 102 GLY GLY A . n A 1 104 ALA 104 103 103 ALA ALA A . n A 1 105 VAL 105 104 104 VAL VAL A . n A 1 106 CYS 106 105 105 CYS CYS A . n A 1 107 ILE 107 106 106 ILE ILE A . n A 1 108 CYS 108 107 107 CYS CYS A . n A 1 109 ASN 109 108 108 ASN ASN A . n A 1 110 VAL 110 109 109 VAL VAL A . n A 1 111 ASP 111 110 110 ASP ASP A . n A 1 112 ILE 112 111 111 ILE ILE A . n A 1 113 THR 113 112 112 THR THR A . n A 1 114 VAL 114 113 113 VAL VAL A . n A 1 115 SER 115 114 114 SER SER A . n A 1 116 VAL 116 115 115 VAL VAL A . n A 1 117 LYS 117 116 116 LYS LYS A . n A 1 118 GLU 118 117 117 GLU GLU A . n A 1 119 ASN 119 118 118 ASN ASN A . n A 1 120 CYS 120 119 119 CYS CYS A . n A 1 121 ILE 121 120 120 ILE ILE A . n A 1 122 TYR 122 121 121 TYR TYR A . n A 1 123 HIS 123 122 122 HIS HIS A . n A 1 124 LYS 124 123 123 LYS LYS A . n A 1 125 SER 125 124 124 SER SER A . n A 1 126 ILE 126 125 125 ILE ILE A . n A 1 127 PHE 127 126 126 PHE PHE A . n A 1 128 ASN 128 127 127 ASN ASN A . n A 1 129 GLY 129 128 128 GLY GLY A . n A 1 130 VAL 130 129 129 VAL VAL A . n A 1 131 ASN 131 130 130 ASN ASN A . n A 1 132 PHE 132 131 131 PHE PHE A . n A 1 133 PRO 133 132 132 PRO PRO A . n A 1 134 ALA 134 133 133 ALA ALA A . n A 1 135 ASP 135 134 134 ASP ASP A . n A 1 136 GLY 136 135 135 GLY GLY A . n A 1 137 PRO 137 136 136 PRO PRO A . n A 1 138 VAL 138 137 137 VAL VAL A . n A 1 139 MET 139 138 138 MET MET A . n A 1 140 LYS 140 139 139 LYS LYS A . n A 1 141 LYS 141 140 140 LYS LYS A . n A 1 142 MET 142 141 141 MET MET A . n A 1 143 THR 143 142 142 THR THR A . n A 1 144 THR 144 143 143 THR THR A . n A 1 145 ASN 145 144 144 ASN ASN A . n A 1 146 TRP 146 145 145 TRP TRP A . n A 1 147 GLU 147 146 146 GLU GLU A . n A 1 148 ALA 148 147 147 ALA ALA A . n A 1 149 SER 149 148 148 SER SER A . n A 1 150 CYS 150 149 149 CYS CYS A . n A 1 151 GLU 151 150 150 GLU GLU A . n A 1 152 LYS 152 151 151 LYS LYS A . n A 1 153 ILE 153 152 152 ILE ILE A . n A 1 154 MET 154 153 153 MET MET A . n A 1 155 PRO 155 154 154 PRO PRO A . n A 1 156 VAL 156 155 155 VAL VAL A . n A 1 157 PRO 157 156 156 PRO PRO A . n A 1 158 LYS 158 157 157 LYS LYS A . n A 1 159 GLN 159 158 158 GLN GLN A . n A 1 160 GLY 160 159 159 GLY GLY A . n A 1 161 ILE 161 160 160 ILE ILE A . n A 1 162 LEU 162 161 161 LEU LEU A . n A 1 163 LYS 163 162 162 LYS LYS A . n A 1 164 GLY 164 163 163 GLY GLY A . n A 1 165 ASP 165 164 164 ASP ASP A . n A 1 166 VAL 166 165 165 VAL VAL A . n A 1 167 SER 167 166 166 SER SER A . n A 1 168 MET 168 167 167 MET MET A . n A 1 169 TYR 169 168 168 TYR TYR A . n A 1 170 LEU 170 169 169 LEU LEU A . n A 1 171 LEU 171 170 170 LEU LEU A . n A 1 172 LEU 172 171 171 LEU LEU A . n A 1 173 LYS 173 172 172 LYS LYS A . n A 1 174 ASP 174 173 173 ASP ASP A . n A 1 175 GLY 175 174 174 GLY GLY A . n A 1 176 GLY 176 175 175 GLY GLY A . n A 1 177 ARG 177 176 176 ARG ARG A . n A 1 178 TYR 178 177 177 TYR TYR A . n A 1 179 ARG 179 178 178 ARG ARG A . n A 1 180 CYS 180 179 179 CYS CYS A . n A 1 181 GLN 181 180 180 GLN GLN A . n A 1 182 PHE 182 181 181 PHE PHE A . n A 1 183 ASP 183 182 182 ASP ASP A . n A 1 184 THR 184 183 183 THR THR A . n A 1 185 VAL 185 184 184 VAL VAL A . n A 1 186 TYR 186 185 185 TYR TYR A . n A 1 187 LYS 187 186 186 LYS LYS A . n A 1 188 ALA 188 187 187 ALA ALA A . n A 1 189 LYS 189 188 188 LYS LYS A . n A 1 190 SER 190 189 189 SER SER A . n A 1 191 VAL 191 190 190 VAL VAL A . n A 1 192 PRO 192 191 191 PRO PRO A . n A 1 193 SER 193 192 192 SER SER A . n A 1 194 LYS 194 193 193 LYS LYS A . n A 1 195 MET 195 194 194 MET MET A . n A 1 196 PRO 196 195 195 PRO PRO A . n A 1 197 GLU 197 196 196 GLU GLU A . n A 1 198 TRP 198 197 197 TRP TRP A . n A 1 199 HIS 199 198 198 HIS HIS A . n A 1 200 PHE 200 199 199 PHE PHE A . n A 1 201 ILE 201 200 200 ILE ILE A . n A 1 202 GLN 202 201 201 GLN GLN A . n A 1 203 HIS 203 202 202 HIS HIS A . n A 1 204 LYS 204 203 203 LYS LYS A . n A 1 205 LEU 205 204 204 LEU LEU A . n A 1 206 LEU 206 205 205 LEU LEU A . n A 1 207 ARG 207 206 206 ARG ARG A . n A 1 208 GLU 208 207 207 GLU GLU A . n A 1 209 ASP 209 208 208 ASP ASP A . n A 1 210 ARG 210 209 209 ARG ARG A . n A 1 211 SER 211 210 ? ? ? A . n A 1 212 ASP 212 211 ? ? ? A . n A 1 213 ALA 213 212 212 ALA ALA A . n A 1 214 LYS 214 213 213 LYS LYS A . n A 1 215 ASN 215 214 214 ASN ASN A . n A 1 216 GLN 216 215 215 GLN GLN A . n A 1 217 LYS 217 216 216 LYS LYS A . n A 1 218 TRP 218 217 217 TRP TRP A . n A 1 219 GLN 219 218 218 GLN GLN A . n A 1 220 LEU 220 219 219 LEU LEU A . n A 1 221 THR 221 220 220 THR THR A . n A 1 222 GLU 222 221 221 GLU GLU A . n A 1 223 HIS 223 222 222 HIS HIS A . n A 1 224 ALA 224 223 223 ALA ALA A . n A 1 225 ILE 225 224 224 ILE ILE A . n A 1 226 ALA 226 225 225 ALA ALA A . n A 1 227 PHE 227 226 226 PHE PHE A . n A 1 228 PRO 228 227 227 PRO PRO A . n A 1 229 SER 229 228 228 SER SER A . n A 1 230 ALA 230 229 229 ALA ALA A . n A 1 231 LEU 231 230 230 LEU LEU A . n A 1 232 ALA 232 231 231 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 35 HOH HOH A . B 2 HOH 2 302 10 HOH HOH A . B 2 HOH 3 303 18 HOH HOH A . B 2 HOH 4 304 1 HOH HOH A . B 2 HOH 5 305 37 HOH HOH A . B 2 HOH 6 306 3 HOH HOH A . B 2 HOH 7 307 33 HOH HOH A . B 2 HOH 8 308 6 HOH HOH A . B 2 HOH 9 309 2 HOH HOH A . B 2 HOH 10 310 12 HOH HOH A . B 2 HOH 11 311 36 HOH HOH A . B 2 HOH 12 312 17 HOH HOH A . B 2 HOH 13 313 5 HOH HOH A . B 2 HOH 14 314 8 HOH HOH A . B 2 HOH 15 315 14 HOH HOH A . B 2 HOH 16 316 21 HOH HOH A . B 2 HOH 17 317 24 HOH HOH A . B 2 HOH 18 318 38 HOH HOH A . B 2 HOH 19 319 7 HOH HOH A . B 2 HOH 20 320 4 HOH HOH A . B 2 HOH 21 321 15 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A NFA 68 A NFA 65 ? PHE 'modified residue' 2 A CH7 69 A CH7 66 ? GLY chromophore # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9280 ? 1 MORE -44 ? 1 'SSA (A^2)' 34900 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 10_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 15_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 303 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-13 2 'Structure model' 1 1 2018-11-28 3 'Structure model' 1 2 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0032 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 6 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 7 # _pdbx_entry_details.compound_details ? _pdbx_entry_details.entry_id 5Y8R _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;Residue LYS 66, TYR 67 and GLY 68 are modified to make chromophore (CH7 66). ZsYellow chromophore has a three-ring feature by hetero-cyclization of the Lys66 residue, resulting in backbone cleavage between Phe65 and Lys66. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A GLY 64 ? ? C A GLY 64 ? ? N A NFA 65 ? ? 133.75 117.20 16.55 2.20 Y 2 1 O A GLY 64 ? ? C A GLY 64 ? ? N A NFA 65 ? ? 106.50 122.70 -16.20 1.60 Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A ALA 2 ? A ALA 5 6 1 Y 1 A HIS 3 ? A HIS 6 7 1 Y 1 A SER 4 ? A SER 7 8 1 Y 1 A SER 210 ? A SER 211 9 1 Y 1 A ASP 211 ? A ASP 212 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CH7 NZ N N N 74 CH7 CA1 C N N 75 CH7 CB C N N 76 CH7 CG C N N 77 CH7 CD C N N 78 CH7 CE C N N 79 CH7 C1 C N N 80 CH7 N2 N N N 81 CH7 OH O N N 82 CH7 CD2 C Y N 83 CH7 CE2 C Y N 84 CH7 CZ C Y N 85 CH7 CE1 C Y N 86 CH7 CD1 C Y N 87 CH7 CG2 C Y N 88 CH7 CB2 C N N 89 CH7 CA2 C N N 90 CH7 C2 C N N 91 CH7 O2 O N N 92 CH7 N3 N N N 93 CH7 CA3 C N N 94 CH7 C3 C N N 95 CH7 O3 O N N 96 CH7 OXT O N N 97 CH7 HB1 H N N 98 CH7 HB2A H N N 99 CH7 HG1 H N N 100 CH7 HG2 H N N 101 CH7 HD1A H N N 102 CH7 HD2A H N N 103 CH7 HE1A H N N 104 CH7 HE2A H N N 105 CH7 HOH H N N 106 CH7 HD2 H N N 107 CH7 HE2 H N N 108 CH7 HE1 H N N 109 CH7 HD1 H N N 110 CH7 HB2 H N N 111 CH7 HA31 H N N 112 CH7 HA32 H N N 113 CH7 HXT H N N 114 CYS N N N N 115 CYS CA C N R 116 CYS C C N N 117 CYS O O N N 118 CYS CB C N N 119 CYS SG S N N 120 CYS OXT O N N 121 CYS H H N N 122 CYS H2 H N N 123 CYS HA H N N 124 CYS HB2 H N N 125 CYS HB3 H N N 126 CYS HG H N N 127 CYS HXT H N N 128 GLN N N N N 129 GLN CA C N S 130 GLN C C N N 131 GLN O O N N 132 GLN CB C N N 133 GLN CG C N N 134 GLN CD C N N 135 GLN OE1 O N N 136 GLN NE2 N N N 137 GLN OXT O N N 138 GLN H H N N 139 GLN H2 H N N 140 GLN HA H N N 141 GLN HB2 H N N 142 GLN HB3 H N N 143 GLN HG2 H N N 144 GLN HG3 H N N 145 GLN HE21 H N N 146 GLN HE22 H N N 147 GLN HXT H N N 148 GLU N N N N 149 GLU CA C N S 150 GLU C C N N 151 GLU O O N N 152 GLU CB C N N 153 GLU CG C N N 154 GLU CD C N N 155 GLU OE1 O N N 156 GLU OE2 O N N 157 GLU OXT O N N 158 GLU H H N N 159 GLU H2 H N N 160 GLU HA H N N 161 GLU HB2 H N N 162 GLU HB3 H N N 163 GLU HG2 H N N 164 GLU HG3 H N N 165 GLU HE2 H N N 166 GLU HXT H N N 167 GLY N N N N 168 GLY CA C N N 169 GLY C C N N 170 GLY O O N N 171 GLY OXT O N N 172 GLY H H N N 173 GLY H2 H N N 174 GLY HA2 H N N 175 GLY HA3 H N N 176 GLY HXT H N N 177 HIS N N N N 178 HIS CA C N S 179 HIS C C N N 180 HIS O O N N 181 HIS CB C N N 182 HIS CG C Y N 183 HIS ND1 N Y N 184 HIS CD2 C Y N 185 HIS CE1 C Y N 186 HIS NE2 N Y N 187 HIS OXT O N N 188 HIS H H N N 189 HIS H2 H N N 190 HIS HA H N N 191 HIS HB2 H N N 192 HIS HB3 H N N 193 HIS HD1 H N N 194 HIS HD2 H N N 195 HIS HE1 H N N 196 HIS HE2 H N N 197 HIS HXT H N N 198 HOH O O N N 199 HOH H1 H N N 200 HOH H2 H N N 201 ILE N N N N 202 ILE CA C N S 203 ILE C C N N 204 ILE O O N N 205 ILE CB C N S 206 ILE CG1 C N N 207 ILE CG2 C N N 208 ILE CD1 C N N 209 ILE OXT O N N 210 ILE H H N N 211 ILE H2 H N N 212 ILE HA H N N 213 ILE HB H N N 214 ILE HG12 H N N 215 ILE HG13 H N N 216 ILE HG21 H N N 217 ILE HG22 H N N 218 ILE HG23 H N N 219 ILE HD11 H N N 220 ILE HD12 H N N 221 ILE HD13 H N N 222 ILE HXT H N N 223 LEU N N N N 224 LEU CA C N S 225 LEU C C N N 226 LEU O O N N 227 LEU CB C N N 228 LEU CG C N N 229 LEU CD1 C N N 230 LEU CD2 C N N 231 LEU OXT O N N 232 LEU H H N N 233 LEU H2 H N N 234 LEU HA H N N 235 LEU HB2 H N N 236 LEU HB3 H N N 237 LEU HG H N N 238 LEU HD11 H N N 239 LEU HD12 H N N 240 LEU HD13 H N N 241 LEU HD21 H N N 242 LEU HD22 H N N 243 LEU HD23 H N N 244 LEU HXT H N N 245 LYS N N N N 246 LYS CA C N S 247 LYS C C N N 248 LYS O O N N 249 LYS CB C N N 250 LYS CG C N N 251 LYS CD C N N 252 LYS CE C N N 253 LYS NZ N N N 254 LYS OXT O N N 255 LYS H H N N 256 LYS H2 H N N 257 LYS HA H N N 258 LYS HB2 H N N 259 LYS HB3 H N N 260 LYS HG2 H N N 261 LYS HG3 H N N 262 LYS HD2 H N N 263 LYS HD3 H N N 264 LYS HE2 H N N 265 LYS HE3 H N N 266 LYS HZ1 H N N 267 LYS HZ2 H N N 268 LYS HZ3 H N N 269 LYS HXT H N N 270 MET N N N N 271 MET CA C N S 272 MET C C N N 273 MET O O N N 274 MET CB C N N 275 MET CG C N N 276 MET SD S N N 277 MET CE C N N 278 MET OXT O N N 279 MET H H N N 280 MET H2 H N N 281 MET HA H N N 282 MET HB2 H N N 283 MET HB3 H N N 284 MET HG2 H N N 285 MET HG3 H N N 286 MET HE1 H N N 287 MET HE2 H N N 288 MET HE3 H N N 289 MET HXT H N N 290 NFA N N N N 291 NFA CA C N S 292 NFA C C N N 293 NFA O O N N 294 NFA CB C N N 295 NFA CG C Y N 296 NFA CD1 C Y N 297 NFA CD2 C Y N 298 NFA CE1 C Y N 299 NFA CE2 C Y N 300 NFA CZ C Y N 301 NFA NXT N N N 302 NFA H H N N 303 NFA H2 H N N 304 NFA HA H N N 305 NFA HB2 H N N 306 NFA HB3 H N N 307 NFA HD1 H N N 308 NFA HD2 H N N 309 NFA HE1 H N N 310 NFA HE2 H N N 311 NFA HZ H N N 312 NFA HXT1 H N N 313 NFA HXT2 H N N 314 PHE N N N N 315 PHE CA C N S 316 PHE C C N N 317 PHE O O N N 318 PHE CB C N N 319 PHE CG C Y N 320 PHE CD1 C Y N 321 PHE CD2 C Y N 322 PHE CE1 C Y N 323 PHE CE2 C Y N 324 PHE CZ C Y N 325 PHE OXT O N N 326 PHE H H N N 327 PHE H2 H N N 328 PHE HA H N N 329 PHE HB2 H N N 330 PHE HB3 H N N 331 PHE HD1 H N N 332 PHE HD2 H N N 333 PHE HE1 H N N 334 PHE HE2 H N N 335 PHE HZ H N N 336 PHE HXT H N N 337 PRO N N N N 338 PRO CA C N S 339 PRO C C N N 340 PRO O O N N 341 PRO CB C N N 342 PRO CG C N N 343 PRO CD C N N 344 PRO OXT O N N 345 PRO H H N N 346 PRO HA H N N 347 PRO HB2 H N N 348 PRO HB3 H N N 349 PRO HG2 H N N 350 PRO HG3 H N N 351 PRO HD2 H N N 352 PRO HD3 H N N 353 PRO HXT H N N 354 SER N N N N 355 SER CA C N S 356 SER C C N N 357 SER O O N N 358 SER CB C N N 359 SER OG O N N 360 SER OXT O N N 361 SER H H N N 362 SER H2 H N N 363 SER HA H N N 364 SER HB2 H N N 365 SER HB3 H N N 366 SER HG H N N 367 SER HXT H N N 368 THR N N N N 369 THR CA C N S 370 THR C C N N 371 THR O O N N 372 THR CB C N R 373 THR OG1 O N N 374 THR CG2 C N N 375 THR OXT O N N 376 THR H H N N 377 THR H2 H N N 378 THR HA H N N 379 THR HB H N N 380 THR HG1 H N N 381 THR HG21 H N N 382 THR HG22 H N N 383 THR HG23 H N N 384 THR HXT H N N 385 TRP N N N N 386 TRP CA C N S 387 TRP C C N N 388 TRP O O N N 389 TRP CB C N N 390 TRP CG C Y N 391 TRP CD1 C Y N 392 TRP CD2 C Y N 393 TRP NE1 N Y N 394 TRP CE2 C Y N 395 TRP CE3 C Y N 396 TRP CZ2 C Y N 397 TRP CZ3 C Y N 398 TRP CH2 C Y N 399 TRP OXT O N N 400 TRP H H N N 401 TRP H2 H N N 402 TRP HA H N N 403 TRP HB2 H N N 404 TRP HB3 H N N 405 TRP HD1 H N N 406 TRP HE1 H N N 407 TRP HE3 H N N 408 TRP HZ2 H N N 409 TRP HZ3 H N N 410 TRP HH2 H N N 411 TRP HXT H N N 412 TYR N N N N 413 TYR CA C N S 414 TYR C C N N 415 TYR O O N N 416 TYR CB C N N 417 TYR CG C Y N 418 TYR CD1 C Y N 419 TYR CD2 C Y N 420 TYR CE1 C Y N 421 TYR CE2 C Y N 422 TYR CZ C Y N 423 TYR OH O N N 424 TYR OXT O N N 425 TYR H H N N 426 TYR H2 H N N 427 TYR HA H N N 428 TYR HB2 H N N 429 TYR HB3 H N N 430 TYR HD1 H N N 431 TYR HD2 H N N 432 TYR HE1 H N N 433 TYR HE2 H N N 434 TYR HH H N N 435 TYR HXT H N N 436 VAL N N N N 437 VAL CA C N S 438 VAL C C N N 439 VAL O O N N 440 VAL CB C N N 441 VAL CG1 C N N 442 VAL CG2 C N N 443 VAL OXT O N N 444 VAL H H N N 445 VAL H2 H N N 446 VAL HA H N N 447 VAL HB H N N 448 VAL HG11 H N N 449 VAL HG12 H N N 450 VAL HG13 H N N 451 VAL HG21 H N N 452 VAL HG22 H N N 453 VAL HG23 H N N 454 VAL HXT H N N 455 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CH7 NZ CA1 doub N N 70 CH7 NZ CE sing N N 71 CH7 CA1 CB sing N N 72 CH7 CA1 C1 sing N N 73 CH7 CB CG sing N N 74 CH7 CB HB1 sing N N 75 CH7 CB HB2A sing N N 76 CH7 CG CD sing N N 77 CH7 CG HG1 sing N N 78 CH7 CG HG2 sing N N 79 CH7 CD CE sing N N 80 CH7 CD HD1A sing N N 81 CH7 CD HD2A sing N N 82 CH7 CE HE1A sing N N 83 CH7 CE HE2A sing N N 84 CH7 C1 N2 doub N N 85 CH7 C1 N3 sing N N 86 CH7 N2 CA2 sing N N 87 CH7 OH CZ sing N N 88 CH7 OH HOH sing N N 89 CH7 CD2 CE2 sing Y N 90 CH7 CD2 CG2 doub Y N 91 CH7 CD2 HD2 sing N N 92 CH7 CE2 CZ doub Y N 93 CH7 CE2 HE2 sing N N 94 CH7 CZ CE1 sing Y N 95 CH7 CE1 CD1 doub Y N 96 CH7 CE1 HE1 sing N N 97 CH7 CD1 CG2 sing Y N 98 CH7 CD1 HD1 sing N N 99 CH7 CG2 CB2 sing N N 100 CH7 CB2 CA2 doub N Z 101 CH7 CB2 HB2 sing N N 102 CH7 CA2 C2 sing N N 103 CH7 C2 O2 doub N N 104 CH7 C2 N3 sing N N 105 CH7 N3 CA3 sing N N 106 CH7 CA3 C3 sing N N 107 CH7 CA3 HA31 sing N N 108 CH7 CA3 HA32 sing N N 109 CH7 C3 O3 doub N N 110 CH7 C3 OXT sing N N 111 CH7 OXT HXT sing N N 112 CYS N CA sing N N 113 CYS N H sing N N 114 CYS N H2 sing N N 115 CYS CA C sing N N 116 CYS CA CB sing N N 117 CYS CA HA sing N N 118 CYS C O doub N N 119 CYS C OXT sing N N 120 CYS CB SG sing N N 121 CYS CB HB2 sing N N 122 CYS CB HB3 sing N N 123 CYS SG HG sing N N 124 CYS OXT HXT sing N N 125 GLN N CA sing N N 126 GLN N H sing N N 127 GLN N H2 sing N N 128 GLN CA C sing N N 129 GLN CA CB sing N N 130 GLN CA HA sing N N 131 GLN C O doub N N 132 GLN C OXT sing N N 133 GLN CB CG sing N N 134 GLN CB HB2 sing N N 135 GLN CB HB3 sing N N 136 GLN CG CD sing N N 137 GLN CG HG2 sing N N 138 GLN CG HG3 sing N N 139 GLN CD OE1 doub N N 140 GLN CD NE2 sing N N 141 GLN NE2 HE21 sing N N 142 GLN NE2 HE22 sing N N 143 GLN OXT HXT sing N N 144 GLU N CA sing N N 145 GLU N H sing N N 146 GLU N H2 sing N N 147 GLU CA C sing N N 148 GLU CA CB sing N N 149 GLU CA HA sing N N 150 GLU C O doub N N 151 GLU C OXT sing N N 152 GLU CB CG sing N N 153 GLU CB HB2 sing N N 154 GLU CB HB3 sing N N 155 GLU CG CD sing N N 156 GLU CG HG2 sing N N 157 GLU CG HG3 sing N N 158 GLU CD OE1 doub N N 159 GLU CD OE2 sing N N 160 GLU OE2 HE2 sing N N 161 GLU OXT HXT sing N N 162 GLY N CA sing N N 163 GLY N H sing N N 164 GLY N H2 sing N N 165 GLY CA C sing N N 166 GLY CA HA2 sing N N 167 GLY CA HA3 sing N N 168 GLY C O doub N N 169 GLY C OXT sing N N 170 GLY OXT HXT sing N N 171 HIS N CA sing N N 172 HIS N H sing N N 173 HIS N H2 sing N N 174 HIS CA C sing N N 175 HIS CA CB sing N N 176 HIS CA HA sing N N 177 HIS C O doub N N 178 HIS C OXT sing N N 179 HIS CB CG sing N N 180 HIS CB HB2 sing N N 181 HIS CB HB3 sing N N 182 HIS CG ND1 sing Y N 183 HIS CG CD2 doub Y N 184 HIS ND1 CE1 doub Y N 185 HIS ND1 HD1 sing N N 186 HIS CD2 NE2 sing Y N 187 HIS CD2 HD2 sing N N 188 HIS CE1 NE2 sing Y N 189 HIS CE1 HE1 sing N N 190 HIS NE2 HE2 sing N N 191 HIS OXT HXT sing N N 192 HOH O H1 sing N N 193 HOH O H2 sing N N 194 ILE N CA sing N N 195 ILE N H sing N N 196 ILE N H2 sing N N 197 ILE CA C sing N N 198 ILE CA CB sing N N 199 ILE CA HA sing N N 200 ILE C O doub N N 201 ILE C OXT sing N N 202 ILE CB CG1 sing N N 203 ILE CB CG2 sing N N 204 ILE CB HB sing N N 205 ILE CG1 CD1 sing N N 206 ILE CG1 HG12 sing N N 207 ILE CG1 HG13 sing N N 208 ILE CG2 HG21 sing N N 209 ILE CG2 HG22 sing N N 210 ILE CG2 HG23 sing N N 211 ILE CD1 HD11 sing N N 212 ILE CD1 HD12 sing N N 213 ILE CD1 HD13 sing N N 214 ILE OXT HXT sing N N 215 LEU N CA sing N N 216 LEU N H sing N N 217 LEU N H2 sing N N 218 LEU CA C sing N N 219 LEU CA CB sing N N 220 LEU CA HA sing N N 221 LEU C O doub N N 222 LEU C OXT sing N N 223 LEU CB CG sing N N 224 LEU CB HB2 sing N N 225 LEU CB HB3 sing N N 226 LEU CG CD1 sing N N 227 LEU CG CD2 sing N N 228 LEU CG HG sing N N 229 LEU CD1 HD11 sing N N 230 LEU CD1 HD12 sing N N 231 LEU CD1 HD13 sing N N 232 LEU CD2 HD21 sing N N 233 LEU CD2 HD22 sing N N 234 LEU CD2 HD23 sing N N 235 LEU OXT HXT sing N N 236 LYS N CA sing N N 237 LYS N H sing N N 238 LYS N H2 sing N N 239 LYS CA C sing N N 240 LYS CA CB sing N N 241 LYS CA HA sing N N 242 LYS C O doub N N 243 LYS C OXT sing N N 244 LYS CB CG sing N N 245 LYS CB HB2 sing N N 246 LYS CB HB3 sing N N 247 LYS CG CD sing N N 248 LYS CG HG2 sing N N 249 LYS CG HG3 sing N N 250 LYS CD CE sing N N 251 LYS CD HD2 sing N N 252 LYS CD HD3 sing N N 253 LYS CE NZ sing N N 254 LYS CE HE2 sing N N 255 LYS CE HE3 sing N N 256 LYS NZ HZ1 sing N N 257 LYS NZ HZ2 sing N N 258 LYS NZ HZ3 sing N N 259 LYS OXT HXT sing N N 260 MET N CA sing N N 261 MET N H sing N N 262 MET N H2 sing N N 263 MET CA C sing N N 264 MET CA CB sing N N 265 MET CA HA sing N N 266 MET C O doub N N 267 MET C OXT sing N N 268 MET CB CG sing N N 269 MET CB HB2 sing N N 270 MET CB HB3 sing N N 271 MET CG SD sing N N 272 MET CG HG2 sing N N 273 MET CG HG3 sing N N 274 MET SD CE sing N N 275 MET CE HE1 sing N N 276 MET CE HE2 sing N N 277 MET CE HE3 sing N N 278 MET OXT HXT sing N N 279 NFA N CA sing N N 280 NFA N H sing N N 281 NFA N H2 sing N N 282 NFA CA C sing N N 283 NFA CA CB sing N N 284 NFA CA HA sing N N 285 NFA C O doub N N 286 NFA C NXT sing N N 287 NFA CB CG sing N N 288 NFA CB HB2 sing N N 289 NFA CB HB3 sing N N 290 NFA CG CD1 doub Y N 291 NFA CG CD2 sing Y N 292 NFA CD1 CE1 sing Y N 293 NFA CD1 HD1 sing N N 294 NFA CD2 CE2 doub Y N 295 NFA CD2 HD2 sing N N 296 NFA CE1 CZ doub Y N 297 NFA CE1 HE1 sing N N 298 NFA CE2 CZ sing Y N 299 NFA CE2 HE2 sing N N 300 NFA CZ HZ sing N N 301 NFA NXT HXT1 sing N N 302 NFA NXT HXT2 sing N N 303 PHE N CA sing N N 304 PHE N H sing N N 305 PHE N H2 sing N N 306 PHE CA C sing N N 307 PHE CA CB sing N N 308 PHE CA HA sing N N 309 PHE C O doub N N 310 PHE C OXT sing N N 311 PHE CB CG sing N N 312 PHE CB HB2 sing N N 313 PHE CB HB3 sing N N 314 PHE CG CD1 doub Y N 315 PHE CG CD2 sing Y N 316 PHE CD1 CE1 sing Y N 317 PHE CD1 HD1 sing N N 318 PHE CD2 CE2 doub Y N 319 PHE CD2 HD2 sing N N 320 PHE CE1 CZ doub Y N 321 PHE CE1 HE1 sing N N 322 PHE CE2 CZ sing Y N 323 PHE CE2 HE2 sing N N 324 PHE CZ HZ sing N N 325 PHE OXT HXT sing N N 326 PRO N CA sing N N 327 PRO N CD sing N N 328 PRO N H sing N N 329 PRO CA C sing N N 330 PRO CA CB sing N N 331 PRO CA HA sing N N 332 PRO C O doub N N 333 PRO C OXT sing N N 334 PRO CB CG sing N N 335 PRO CB HB2 sing N N 336 PRO CB HB3 sing N N 337 PRO CG CD sing N N 338 PRO CG HG2 sing N N 339 PRO CG HG3 sing N N 340 PRO CD HD2 sing N N 341 PRO CD HD3 sing N N 342 PRO OXT HXT sing N N 343 SER N CA sing N N 344 SER N H sing N N 345 SER N H2 sing N N 346 SER CA C sing N N 347 SER CA CB sing N N 348 SER CA HA sing N N 349 SER C O doub N N 350 SER C OXT sing N N 351 SER CB OG sing N N 352 SER CB HB2 sing N N 353 SER CB HB3 sing N N 354 SER OG HG sing N N 355 SER OXT HXT sing N N 356 THR N CA sing N N 357 THR N H sing N N 358 THR N H2 sing N N 359 THR CA C sing N N 360 THR CA CB sing N N 361 THR CA HA sing N N 362 THR C O doub N N 363 THR C OXT sing N N 364 THR CB OG1 sing N N 365 THR CB CG2 sing N N 366 THR CB HB sing N N 367 THR OG1 HG1 sing N N 368 THR CG2 HG21 sing N N 369 THR CG2 HG22 sing N N 370 THR CG2 HG23 sing N N 371 THR OXT HXT sing N N 372 TRP N CA sing N N 373 TRP N H sing N N 374 TRP N H2 sing N N 375 TRP CA C sing N N 376 TRP CA CB sing N N 377 TRP CA HA sing N N 378 TRP C O doub N N 379 TRP C OXT sing N N 380 TRP CB CG sing N N 381 TRP CB HB2 sing N N 382 TRP CB HB3 sing N N 383 TRP CG CD1 doub Y N 384 TRP CG CD2 sing Y N 385 TRP CD1 NE1 sing Y N 386 TRP CD1 HD1 sing N N 387 TRP CD2 CE2 doub Y N 388 TRP CD2 CE3 sing Y N 389 TRP NE1 CE2 sing Y N 390 TRP NE1 HE1 sing N N 391 TRP CE2 CZ2 sing Y N 392 TRP CE3 CZ3 doub Y N 393 TRP CE3 HE3 sing N N 394 TRP CZ2 CH2 doub Y N 395 TRP CZ2 HZ2 sing N N 396 TRP CZ3 CH2 sing Y N 397 TRP CZ3 HZ3 sing N N 398 TRP CH2 HH2 sing N N 399 TRP OXT HXT sing N N 400 TYR N CA sing N N 401 TYR N H sing N N 402 TYR N H2 sing N N 403 TYR CA C sing N N 404 TYR CA CB sing N N 405 TYR CA HA sing N N 406 TYR C O doub N N 407 TYR C OXT sing N N 408 TYR CB CG sing N N 409 TYR CB HB2 sing N N 410 TYR CB HB3 sing N N 411 TYR CG CD1 doub Y N 412 TYR CG CD2 sing Y N 413 TYR CD1 CE1 sing Y N 414 TYR CD1 HD1 sing N N 415 TYR CD2 CE2 doub Y N 416 TYR CD2 HD2 sing N N 417 TYR CE1 CZ doub Y N 418 TYR CE1 HE1 sing N N 419 TYR CE2 CZ sing Y N 420 TYR CE2 HE2 sing N N 421 TYR CZ OH sing N N 422 TYR OH HH sing N N 423 TYR OXT HXT sing N N 424 VAL N CA sing N N 425 VAL N H sing N N 426 VAL N H2 sing N N 427 VAL CA C sing N N 428 VAL CA CB sing N N 429 VAL CA HA sing N N 430 VAL C O doub N N 431 VAL C OXT sing N N 432 VAL CB CG1 sing N N 433 VAL CB CG2 sing N N 434 VAL CB HB sing N N 435 VAL CG1 HG11 sing N N 436 VAL CG1 HG12 sing N N 437 VAL CG1 HG13 sing N N 438 VAL CG2 HG21 sing N N 439 VAL CG2 HG22 sing N N 440 VAL CG2 HG23 sing N N 441 VAL OXT HXT sing N N 442 # _pdbx_audit_support.funding_organization 'National Research Foundation of Korea' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number NRF-2017R1D1A1B03033087 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2OGR _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #