data_5YIP # _entry.id 5YIP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5YIP pdb_00005yip 10.2210/pdb5yip/pdb WWPDB D_1300005040 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YIP _pdbx_database_status.recvd_initial_deposition_date 2017-10-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Li, J.' 1 0000-0002-8921-1626 'Zhu, R.' 2 ? 'Chen, K.' 3 0000-0003-0321-0604 'Zheng, H.' 4 ? 'Yuan, C.' 5 ? 'Zhang, H.' 6 ? 'Wang, C.' 7 ? 'Zhang, M.' 8 0000-0001-9404-0190 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat. Chem. Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 778 _citation.page_last 787 _citation.title 'Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41589-018-0082-8 _citation.pdbx_database_id_PubMed 29867141 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, J.' 1 0000-0002-8921-1626 primary 'Zhu, R.' 2 0000-0002-5991-1365 primary 'Chen, K.' 3 ? primary 'Zheng, H.' 4 ? primary 'Zhao, H.' 5 ? primary 'Yuan, C.' 6 ? primary 'Zhang, H.' 7 ? primary 'Wang, C.' 8 ? primary 'Zhang, M.' 9 0000-0001-9404-0190 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5YIP _cell.details ? _cell.formula_units_Z ? _cell.length_a 104.172 _cell.length_a_esd ? _cell.length_b 104.172 _cell.length_b_esd ? _cell.length_c 63.901 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YIP _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Gamma-aminobutyric acid receptor-associated protein-like 1' 14642.653 1 ? ? ? ? 2 polymer man Ankyrin-3 2919.998 1 ? ? 'UNP RESIDUES 1985-2010' ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 63 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'GABA(A) receptor-associated protein-like 1,Glandular epithelial cell protein 1,GEC-1' 2 ANK-3,Ankyrin-G # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GPGSEFMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPED ALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK ; ;GPGSEFMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPED ALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK ; A ? 2 'polypeptide(L)' no no PEDDWTEFSSEEIREARQAAASHAPS PEDDWTEFSSEEIREARQAAASHAPS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 GLU n 1 6 PHE n 1 7 MET n 1 8 LYS n 1 9 PHE n 1 10 GLN n 1 11 TYR n 1 12 LYS n 1 13 GLU n 1 14 ASP n 1 15 HIS n 1 16 PRO n 1 17 PHE n 1 18 GLU n 1 19 TYR n 1 20 ARG n 1 21 LYS n 1 22 LYS n 1 23 GLU n 1 24 GLY n 1 25 GLU n 1 26 LYS n 1 27 ILE n 1 28 ARG n 1 29 LYS n 1 30 LYS n 1 31 TYR n 1 32 PRO n 1 33 ASP n 1 34 ARG n 1 35 VAL n 1 36 PRO n 1 37 VAL n 1 38 ILE n 1 39 VAL n 1 40 GLU n 1 41 LYS n 1 42 ALA n 1 43 PRO n 1 44 LYS n 1 45 ALA n 1 46 ARG n 1 47 VAL n 1 48 PRO n 1 49 ASP n 1 50 LEU n 1 51 ASP n 1 52 LYS n 1 53 ARG n 1 54 LYS n 1 55 TYR n 1 56 LEU n 1 57 VAL n 1 58 PRO n 1 59 SER n 1 60 ASP n 1 61 LEU n 1 62 THR n 1 63 VAL n 1 64 GLY n 1 65 GLN n 1 66 PHE n 1 67 TYR n 1 68 PHE n 1 69 LEU n 1 70 ILE n 1 71 ARG n 1 72 LYS n 1 73 ARG n 1 74 ILE n 1 75 HIS n 1 76 LEU n 1 77 ARG n 1 78 PRO n 1 79 GLU n 1 80 ASP n 1 81 ALA n 1 82 LEU n 1 83 PHE n 1 84 PHE n 1 85 PHE n 1 86 VAL n 1 87 ASN n 1 88 ASN n 1 89 THR n 1 90 ILE n 1 91 PRO n 1 92 PRO n 1 93 THR n 1 94 SER n 1 95 ALA n 1 96 THR n 1 97 MET n 1 98 GLY n 1 99 GLN n 1 100 LEU n 1 101 TYR n 1 102 GLU n 1 103 ASP n 1 104 ASN n 1 105 HIS n 1 106 GLU n 1 107 GLU n 1 108 ASP n 1 109 TYR n 1 110 PHE n 1 111 LEU n 1 112 TYR n 1 113 VAL n 1 114 ALA n 1 115 TYR n 1 116 SER n 1 117 ASP n 1 118 GLU n 1 119 SER n 1 120 VAL n 1 121 TYR n 1 122 GLY n 1 123 LYS n 2 1 PRO n 2 2 GLU n 2 3 ASP n 2 4 ASP n 2 5 TRP n 2 6 THR n 2 7 GLU n 2 8 PHE n 2 9 SER n 2 10 SER n 2 11 GLU n 2 12 GLU n 2 13 ILE n 2 14 ARG n 2 15 GLU n 2 16 ALA n 2 17 ARG n 2 18 GLN n 2 19 ALA n 2 20 ALA n 2 21 ALA n 2 22 SER n 2 23 HIS n 2 24 ALA n 2 25 PRO n 2 26 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 123 Mouse ? 'Gabarapl1, Apg8l, Atg8l, Gec1, MNCb-0091' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 26 Rat ? Ank3 ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GBRL1_MOUSE Q8R3R8 ? 1 ;MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFV NNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK ; 1 2 UNP ANK3_RAT O70511 ? 2 PEDDWTEFSSEEIREARQAAASHAPS 1985 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5YIP A 7 ? 123 ? Q8R3R8 1 ? 117 ? 1 117 2 2 5YIP B 1 ? 26 ? O70511 1985 ? 2010 ? 1985 2010 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5YIP GLY A 1 ? UNP Q8R3R8 ? ? 'expression tag' -5 1 1 5YIP PRO A 2 ? UNP Q8R3R8 ? ? 'expression tag' -4 2 1 5YIP GLY A 3 ? UNP Q8R3R8 ? ? 'expression tag' -3 3 1 5YIP SER A 4 ? UNP Q8R3R8 ? ? 'expression tag' -2 4 1 5YIP GLU A 5 ? UNP Q8R3R8 ? ? 'expression tag' -1 5 1 5YIP PHE A 6 ? UNP Q8R3R8 ? ? 'expression tag' 0 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YIP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.83 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '35% w/v Pentaerythritol ethoxylate 797 (15/4 EO/OH), 0.2 M ammonium sulfate, 0.1 M sodium acetate (pH 4.6)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-10-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97774 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97774 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 27.510 _reflns.entry_id 5YIP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.850 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18077 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.900 _reflns.pdbx_Rmerge_I_obs 0.084 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.529 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.087 _reflns.pdbx_Rpim_I_all 0.022 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.850 1.880 ? ? ? ? ? ? 898 100.000 ? ? ? ? ? ? ? ? ? ? ? ? ? 14.100 ? 0.452 ? ? ? 0.280 ? 1 1 0.887 ? 1.880 1.920 ? ? ? ? ? ? 866 100.000 ? ? ? ? 0.886 ? ? ? ? ? ? ? ? 15.600 ? 0.463 ? ? 0.916 0.229 ? 2 1 0.897 ? 1.920 1.950 ? ? ? ? ? ? 881 100.000 ? ? ? ? 0.743 ? ? ? ? ? ? ? ? 16.800 ? 0.456 ? ? 0.766 0.185 ? 3 1 0.989 ? 1.950 1.990 ? ? ? ? ? ? 881 100.000 ? ? ? ? 0.620 ? ? ? ? ? ? ? ? 16.800 ? 0.447 ? ? 0.639 0.154 ? 4 1 0.948 ? 1.990 2.040 ? ? ? ? ? ? 886 100.000 ? ? ? ? 0.542 ? ? ? ? ? ? ? ? 16.600 ? 0.459 ? ? 0.559 0.135 ? 5 1 0.954 ? 2.040 2.080 ? ? ? ? ? ? 885 100.000 ? ? ? ? 0.449 ? ? ? ? ? ? ? ? 16.500 ? 0.458 ? ? 0.464 0.113 ? 6 1 0.977 ? 2.080 2.140 ? ? ? ? ? ? 884 100.000 ? ? ? ? 0.353 ? ? ? ? ? ? ? ? 16.500 ? 0.459 ? ? 0.365 0.089 ? 7 1 0.978 ? 2.140 2.190 ? ? ? ? ? ? 888 100.000 ? ? ? ? 0.314 ? ? ? ? ? ? ? ? 16.400 ? 0.458 ? ? 0.324 0.079 ? 8 1 0.984 ? 2.190 2.260 ? ? ? ? ? ? 901 100.000 ? ? ? ? 0.229 ? ? ? ? ? ? ? ? 16.300 ? 0.466 ? ? 0.236 0.058 ? 9 1 0.991 ? 2.260 2.330 ? ? ? ? ? ? 878 100.000 ? ? ? ? 0.193 ? ? ? ? ? ? ? ? 15.700 ? 0.487 ? ? 0.199 0.050 ? 10 1 0.992 ? 2.330 2.410 ? ? ? ? ? ? 890 100.000 ? ? ? ? 0.170 ? ? ? ? ? ? ? ? 13.900 ? 0.504 ? ? 0.176 0.047 ? 11 1 0.993 ? 2.410 2.510 ? ? ? ? ? ? 915 99.900 ? ? ? ? 0.148 ? ? ? ? ? ? ? ? 16.600 ? 0.500 ? ? 0.153 0.037 ? 12 1 0.996 ? 2.510 2.630 ? ? ? ? ? ? 887 99.900 ? ? ? ? 0.116 ? ? ? ? ? ? ? ? 17.100 ? 0.498 ? ? 0.119 0.029 ? 13 1 0.998 ? 2.630 2.760 ? ? ? ? ? ? 904 100.000 ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 16.700 ? 0.523 ? ? 0.106 0.026 ? 14 1 0.998 ? 2.760 2.940 ? ? ? ? ? ? 899 100.000 ? ? ? ? 0.089 ? ? ? ? ? ? ? ? 16.400 ? 0.536 ? ? 0.092 0.023 ? 15 1 0.998 ? 2.940 3.160 ? ? ? ? ? ? 917 100.000 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 16.100 ? 0.592 ? ? 0.075 0.019 ? 16 1 0.999 ? 3.160 3.480 ? ? ? ? ? ? 918 100.000 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 14.100 ? 0.643 ? ? 0.059 0.016 ? 17 1 0.999 ? 3.480 3.990 ? ? ? ? ? ? 926 100.000 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 16.200 ? 0.698 ? ? 0.053 0.013 ? 18 1 0.999 ? 3.990 5.020 ? ? ? ? ? ? 943 100.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 15.900 ? 0.734 ? ? 0.047 0.012 ? 19 1 0.999 ? 5.020 50.000 ? ? ? ? ? ? 1030 99.600 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 14.000 ? 0.740 ? ? 0.048 0.012 ? 20 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 110.070 _refine.B_iso_mean 37.7709 _refine.B_iso_min 17.030 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5YIP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.85 _refine.ls_d_res_low 30.1180 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18042 _refine.ls_number_reflns_R_free 910 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8600 _refine.ls_percent_reflns_R_free 5.0400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1832 _refine.ls_R_factor_R_free 0.2222 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1813 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2R2Q _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.6000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.85 _refine_hist.d_res_low 30.1180 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 63 _refine_hist.number_atoms_total 1238 _refine_hist.pdbx_number_residues_total 146 _refine_hist.pdbx_B_iso_mean_ligand 65.50 _refine_hist.pdbx_B_iso_mean_solvent 38.18 _refine_hist.pdbx_number_atoms_protein 1169 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 1212 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.113 ? 1644 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.073 ? 169 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 217 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.000 ? 966 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8465 1.9622 2936 . 155 2781 100.0000 . . . 0.2682 0.0000 0.2355 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 1.9622 2.1137 2936 . 165 2771 100.0000 . . . 0.2454 0.0000 0.2126 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.1137 2.3263 2960 . 158 2802 100.0000 . . . 0.2328 0.0000 0.2014 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.3263 2.6628 3005 . 145 2860 100.0000 . . . 0.2728 0.0000 0.1935 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.6628 3.3541 3014 . 134 2880 100.0000 . . . 0.2083 0.0000 0.1894 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.3541 30.1215 3191 . 153 3038 100.0000 . . . 0.1983 0.0000 0.1567 . . . . . . 6 . . . # _struct.entry_id 5YIP _struct.title 'Crystal Structure of AnkG LIR/GABARAPL1 complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YIP _struct_keywords.text 'Autophagy, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 9 ? HIS A 15 ? PHE A 3 HIS A 9 1 ? 7 HELX_P HELX_P2 AA2 PRO A 16 ? TYR A 31 ? PRO A 10 TYR A 25 1 ? 16 HELX_P HELX_P3 AA3 THR A 62 ? HIS A 75 ? THR A 56 HIS A 69 1 ? 14 HELX_P HELX_P4 AA4 THR A 96 ? HIS A 105 ? THR A 90 HIS A 99 1 ? 10 HELX_P HELX_P5 AA5 SER B 9 ? ALA B 20 ? SER B 1993 ALA B 2004 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 54 ? PRO A 58 ? LYS A 48 PRO A 52 AA1 2 ARG A 34 ? LYS A 41 ? ARG A 28 LYS A 35 AA1 3 LEU A 111 ? SER A 116 ? LEU A 105 SER A 110 AA1 4 PHE A 83 ? PHE A 85 ? PHE A 77 PHE A 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 55 ? O TYR A 49 N VAL A 37 ? N VAL A 31 AA1 2 3 N ILE A 38 ? N ILE A 32 O VAL A 113 ? O VAL A 107 AA1 3 4 O SER A 116 ? O SER A 110 N PHE A 83 ? N PHE A 77 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id GOL _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue GOL A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 LYS A 12 ? LYS A 6 . ? 1_555 ? 2 AC1 3 PHE A 17 ? PHE A 11 . ? 1_555 ? 3 AC1 3 ARG A 20 ? ARG A 14 . ? 1_555 ? # _atom_sites.entry_id 5YIP _atom_sites.fract_transf_matrix[1][1] 0.009600 _atom_sites.fract_transf_matrix[1][2] 0.005542 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011085 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015649 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -5 -5 GLY GLY A . n A 1 2 PRO 2 -4 -4 PRO PRO A . n A 1 3 GLY 3 -3 -3 GLY GLY A . n A 1 4 SER 4 -2 -2 SER SER A . n A 1 5 GLU 5 -1 -1 GLU GLU A . n A 1 6 PHE 6 0 0 PHE PHE A . n A 1 7 MET 7 1 1 MET MET A . n A 1 8 LYS 8 2 2 LYS LYS A . n A 1 9 PHE 9 3 3 PHE PHE A . n A 1 10 GLN 10 4 4 GLN GLN A . n A 1 11 TYR 11 5 5 TYR TYR A . n A 1 12 LYS 12 6 6 LYS LYS A . n A 1 13 GLU 13 7 7 GLU GLU A . n A 1 14 ASP 14 8 8 ASP ASP A . n A 1 15 HIS 15 9 9 HIS HIS A . n A 1 16 PRO 16 10 10 PRO PRO A . n A 1 17 PHE 17 11 11 PHE PHE A . n A 1 18 GLU 18 12 12 GLU GLU A . n A 1 19 TYR 19 13 13 TYR TYR A . n A 1 20 ARG 20 14 14 ARG ARG A . n A 1 21 LYS 21 15 15 LYS LYS A . n A 1 22 LYS 22 16 16 LYS LYS A . n A 1 23 GLU 23 17 17 GLU GLU A . n A 1 24 GLY 24 18 18 GLY GLY A . n A 1 25 GLU 25 19 19 GLU GLU A . n A 1 26 LYS 26 20 20 LYS LYS A . n A 1 27 ILE 27 21 21 ILE ILE A . n A 1 28 ARG 28 22 22 ARG ARG A . n A 1 29 LYS 29 23 23 LYS LYS A . n A 1 30 LYS 30 24 24 LYS LYS A . n A 1 31 TYR 31 25 25 TYR TYR A . n A 1 32 PRO 32 26 26 PRO PRO A . n A 1 33 ASP 33 27 27 ASP ASP A . n A 1 34 ARG 34 28 28 ARG ARG A . n A 1 35 VAL 35 29 29 VAL VAL A . n A 1 36 PRO 36 30 30 PRO PRO A . n A 1 37 VAL 37 31 31 VAL VAL A . n A 1 38 ILE 38 32 32 ILE ILE A . n A 1 39 VAL 39 33 33 VAL VAL A . n A 1 40 GLU 40 34 34 GLU GLU A . n A 1 41 LYS 41 35 35 LYS LYS A . n A 1 42 ALA 42 36 36 ALA ALA A . n A 1 43 PRO 43 37 37 PRO PRO A . n A 1 44 LYS 44 38 38 LYS LYS A . n A 1 45 ALA 45 39 39 ALA ALA A . n A 1 46 ARG 46 40 40 ARG ARG A . n A 1 47 VAL 47 41 41 VAL VAL A . n A 1 48 PRO 48 42 42 PRO PRO A . n A 1 49 ASP 49 43 43 ASP ASP A . n A 1 50 LEU 50 44 44 LEU LEU A . n A 1 51 ASP 51 45 45 ASP ASP A . n A 1 52 LYS 52 46 46 LYS LYS A . n A 1 53 ARG 53 47 47 ARG ARG A . n A 1 54 LYS 54 48 48 LYS LYS A . n A 1 55 TYR 55 49 49 TYR TYR A . n A 1 56 LEU 56 50 50 LEU LEU A . n A 1 57 VAL 57 51 51 VAL VAL A . n A 1 58 PRO 58 52 52 PRO PRO A . n A 1 59 SER 59 53 53 SER SER A . n A 1 60 ASP 60 54 54 ASP ASP A . n A 1 61 LEU 61 55 55 LEU LEU A . n A 1 62 THR 62 56 56 THR THR A . n A 1 63 VAL 63 57 57 VAL VAL A . n A 1 64 GLY 64 58 58 GLY GLY A . n A 1 65 GLN 65 59 59 GLN GLN A . n A 1 66 PHE 66 60 60 PHE PHE A . n A 1 67 TYR 67 61 61 TYR TYR A . n A 1 68 PHE 68 62 62 PHE PHE A . n A 1 69 LEU 69 63 63 LEU LEU A . n A 1 70 ILE 70 64 64 ILE ILE A . n A 1 71 ARG 71 65 65 ARG ARG A . n A 1 72 LYS 72 66 66 LYS LYS A . n A 1 73 ARG 73 67 67 ARG ARG A . n A 1 74 ILE 74 68 68 ILE ILE A . n A 1 75 HIS 75 69 69 HIS HIS A . n A 1 76 LEU 76 70 70 LEU LEU A . n A 1 77 ARG 77 71 71 ARG ARG A . n A 1 78 PRO 78 72 72 PRO PRO A . n A 1 79 GLU 79 73 73 GLU GLU A . n A 1 80 ASP 80 74 74 ASP ASP A . n A 1 81 ALA 81 75 75 ALA ALA A . n A 1 82 LEU 82 76 76 LEU LEU A . n A 1 83 PHE 83 77 77 PHE PHE A . n A 1 84 PHE 84 78 78 PHE PHE A . n A 1 85 PHE 85 79 79 PHE PHE A . n A 1 86 VAL 86 80 80 VAL VAL A . n A 1 87 ASN 87 81 81 ASN ASN A . n A 1 88 ASN 88 82 82 ASN ASN A . n A 1 89 THR 89 83 83 THR THR A . n A 1 90 ILE 90 84 84 ILE ILE A . n A 1 91 PRO 91 85 85 PRO PRO A . n A 1 92 PRO 92 86 86 PRO PRO A . n A 1 93 THR 93 87 87 THR THR A . n A 1 94 SER 94 88 88 SER SER A . n A 1 95 ALA 95 89 89 ALA ALA A . n A 1 96 THR 96 90 90 THR THR A . n A 1 97 MET 97 91 91 MET MET A . n A 1 98 GLY 98 92 92 GLY GLY A . n A 1 99 GLN 99 93 93 GLN GLN A . n A 1 100 LEU 100 94 94 LEU LEU A . n A 1 101 TYR 101 95 95 TYR TYR A . n A 1 102 GLU 102 96 96 GLU GLU A . n A 1 103 ASP 103 97 97 ASP ASP A . n A 1 104 ASN 104 98 98 ASN ASN A . n A 1 105 HIS 105 99 99 HIS HIS A . n A 1 106 GLU 106 100 100 GLU GLU A . n A 1 107 GLU 107 101 101 GLU GLU A . n A 1 108 ASP 108 102 102 ASP ASP A . n A 1 109 TYR 109 103 103 TYR TYR A . n A 1 110 PHE 110 104 104 PHE PHE A . n A 1 111 LEU 111 105 105 LEU LEU A . n A 1 112 TYR 112 106 106 TYR TYR A . n A 1 113 VAL 113 107 107 VAL VAL A . n A 1 114 ALA 114 108 108 ALA ALA A . n A 1 115 TYR 115 109 109 TYR TYR A . n A 1 116 SER 116 110 110 SER SER A . n A 1 117 ASP 117 111 111 ASP ASP A . n A 1 118 GLU 118 112 112 GLU GLU A . n A 1 119 SER 119 113 113 SER SER A . n A 1 120 VAL 120 114 114 VAL VAL A . n A 1 121 TYR 121 115 115 TYR TYR A . n A 1 122 GLY 122 116 116 GLY GLY A . n A 1 123 LYS 123 117 117 LYS LYS A . n B 2 1 PRO 1 1985 1985 PRO PRO B . n B 2 2 GLU 2 1986 1986 GLU GLU B . n B 2 3 ASP 3 1987 1987 ASP ASP B . n B 2 4 ASP 4 1988 1988 ASP ASP B . n B 2 5 TRP 5 1989 1989 TRP TRP B . n B 2 6 THR 6 1990 1990 THR THR B . n B 2 7 GLU 7 1991 1991 GLU GLU B . n B 2 8 PHE 8 1992 1992 PHE PHE B . n B 2 9 SER 9 1993 1993 SER SER B . n B 2 10 SER 10 1994 1994 SER SER B . n B 2 11 GLU 11 1995 1995 GLU GLU B . n B 2 12 GLU 12 1996 1996 GLU GLU B . n B 2 13 ILE 13 1997 1997 ILE ILE B . n B 2 14 ARG 14 1998 1998 ARG ARG B . n B 2 15 GLU 15 1999 1999 GLU GLU B . n B 2 16 ALA 16 2000 2000 ALA ALA B . n B 2 17 ARG 17 2001 2001 ARG ARG B . n B 2 18 GLN 18 2002 2002 GLN GLN B . n B 2 19 ALA 19 2003 2003 ALA ALA B . n B 2 20 ALA 20 2004 2004 ALA ALA B . n B 2 21 ALA 21 2005 2005 ALA ALA B . n B 2 22 SER 22 2006 2006 SER SER B . n B 2 23 HIS 23 2007 2007 HIS HIS B . n B 2 24 ALA 24 2008 ? ? ? B . n B 2 25 PRO 25 2009 ? ? ? B . n B 2 26 SER 26 2010 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 201 1 GOL GOL A . D 4 HOH 1 301 110 HOH HOH A . D 4 HOH 2 302 7 HOH HOH A . D 4 HOH 3 303 11 HOH HOH A . D 4 HOH 4 304 16 HOH HOH A . D 4 HOH 5 305 45 HOH HOH A . D 4 HOH 6 306 9 HOH HOH A . D 4 HOH 7 307 51 HOH HOH A . D 4 HOH 8 308 43 HOH HOH A . D 4 HOH 9 309 12 HOH HOH A . D 4 HOH 10 310 50 HOH HOH A . D 4 HOH 11 311 35 HOH HOH A . D 4 HOH 12 312 2 HOH HOH A . D 4 HOH 13 313 14 HOH HOH A . D 4 HOH 14 314 22 HOH HOH A . D 4 HOH 15 315 36 HOH HOH A . D 4 HOH 16 316 29 HOH HOH A . D 4 HOH 17 317 15 HOH HOH A . D 4 HOH 18 318 20 HOH HOH A . D 4 HOH 19 319 3 HOH HOH A . D 4 HOH 20 320 34 HOH HOH A . D 4 HOH 21 321 13 HOH HOH A . D 4 HOH 22 322 21 HOH HOH A . D 4 HOH 23 323 37 HOH HOH A . D 4 HOH 24 324 109 HOH HOH A . D 4 HOH 25 325 5 HOH HOH A . D 4 HOH 26 326 28 HOH HOH A . D 4 HOH 27 327 18 HOH HOH A . D 4 HOH 28 328 31 HOH HOH A . D 4 HOH 29 329 27 HOH HOH A . D 4 HOH 30 330 53 HOH HOH A . D 4 HOH 31 331 17 HOH HOH A . D 4 HOH 32 332 1 HOH HOH A . D 4 HOH 33 333 8 HOH HOH A . D 4 HOH 34 334 86 HOH HOH A . D 4 HOH 35 335 6 HOH HOH A . D 4 HOH 36 336 107 HOH HOH A . D 4 HOH 37 337 68 HOH HOH A . D 4 HOH 38 338 106 HOH HOH A . D 4 HOH 39 339 26 HOH HOH A . D 4 HOH 40 340 92 HOH HOH A . D 4 HOH 41 341 52 HOH HOH A . D 4 HOH 42 342 56 HOH HOH A . D 4 HOH 43 343 60 HOH HOH A . D 4 HOH 44 344 48 HOH HOH A . D 4 HOH 45 345 71 HOH HOH A . D 4 HOH 46 346 54 HOH HOH A . D 4 HOH 47 347 4 HOH HOH A . D 4 HOH 48 348 23 HOH HOH A . D 4 HOH 49 349 10 HOH HOH A . D 4 HOH 50 350 39 HOH HOH A . D 4 HOH 51 351 105 HOH HOH A . D 4 HOH 52 352 19 HOH HOH A . D 4 HOH 53 353 25 HOH HOH A . D 4 HOH 54 354 58 HOH HOH A . D 4 HOH 55 355 59 HOH HOH A . D 4 HOH 56 356 49 HOH HOH A . D 4 HOH 57 357 44 HOH HOH A . E 4 HOH 1 2101 30 HOH HOH B . E 4 HOH 2 2102 24 HOH HOH B . E 4 HOH 3 2103 108 HOH HOH B . E 4 HOH 4 2104 33 HOH HOH B . E 4 HOH 5 2105 83 HOH HOH B . E 4 HOH 6 2106 65 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1790 ? 1 MORE -6 ? 1 'SSA (A^2)' 8080 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 319 ? D HOH . 2 1 A HOH 357 ? D HOH . 3 1 B HOH 2102 ? E HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-23 2 'Structure model' 1 1 2018-07-04 3 'Structure model' 1 2 2018-08-01 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_DOI' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation_author.identifier_ORCID' 9 4 'Structure model' '_database_2.pdbx_DOI' 10 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -18.9103 41.6953 69.4564 0.4599 0.2721 0.2991 -0.0816 0.0349 0.0554 7.9242 5.1158 9.1013 -0.0213 -0.4989 6.8128 -0.2418 0.1642 0.0464 -0.1709 -0.5209 0.2552 0.6913 0.4105 0.0880 'X-RAY DIFFRACTION' 2 ? refined -23.3676 56.7090 79.8035 0.5864 0.4032 0.2008 -0.1788 0.0217 -0.0686 6.3176 7.8108 5.0210 -3.4493 0.3439 -2.7325 -0.0206 -0.0041 0.0226 -0.9283 0.3043 -0.1265 1.0117 -0.2682 -0.0172 'X-RAY DIFFRACTION' 3 ? refined -14.8020 56.9502 69.1786 0.3693 0.1809 0.2638 -0.1440 -0.0191 0.0088 4.5488 5.9667 4.4285 -1.6612 -1.2832 3.5112 0.0554 0.0485 -0.1103 -0.5322 0.5079 -0.6014 0.5866 -0.1232 0.2592 'X-RAY DIFFRACTION' 4 ? refined -18.0931 56.3108 62.6985 0.2633 0.1271 0.1995 -0.1038 -0.0240 0.0147 2.7139 2.0709 2.8414 -1.0116 -0.9058 0.7440 0.0967 -0.1808 0.0727 -0.0426 0.1643 -0.0689 0.1946 -0.0478 0.0559 'X-RAY DIFFRACTION' 5 ? refined -14.3579 65.4623 74.2208 0.5828 0.2805 0.3446 -0.2362 -0.0377 -0.0606 4.8036 8.1881 5.4653 4.4617 -0.0347 1.0385 0.3379 -0.2371 -0.0315 -0.2716 -0.0911 -0.0801 0.6916 0.1141 0.1066 'X-RAY DIFFRACTION' 6 ? refined -14.9360 70.3778 56.1170 0.5969 0.2570 0.4195 -0.1915 0.0510 0.0681 6.3997 8.6721 6.0925 2.3160 0.3919 2.8291 -0.2295 -0.0002 0.2663 0.4452 0.3379 -0.1555 0.0659 -0.1759 -0.0337 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A -5 A 3 ;chain 'A' and (resid -5 through 3 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 4 A 24 ;chain 'A' and (resid 4 through 24 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 25 A 47 ;chain 'A' and (resid 25 through 47 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 48 A 117 ;chain 'A' and (resid 48 through 117 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 B 1986 B 1993 ;chain 'B' and (resid 1986 through 1993 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 B 1994 B 2007 ;chain 'B' and (resid 1994 through 2007 ) ; ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id B _pdbx_validate_torsion.auth_seq_id 1987 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -150.52 _pdbx_validate_torsion.psi 68.27 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 7 ? CG ? A GLU 13 CG 2 1 Y 1 A GLU 7 ? CD ? A GLU 13 CD 3 1 Y 1 A GLU 7 ? OE1 ? A GLU 13 OE1 4 1 Y 1 A GLU 7 ? OE2 ? A GLU 13 OE2 5 1 Y 1 A TYR 13 ? CG ? A TYR 19 CG 6 1 Y 1 A TYR 13 ? CD1 ? A TYR 19 CD1 7 1 Y 1 A TYR 13 ? CD2 ? A TYR 19 CD2 8 1 Y 1 A TYR 13 ? CE1 ? A TYR 19 CE1 9 1 Y 1 A TYR 13 ? CE2 ? A TYR 19 CE2 10 1 Y 1 A TYR 13 ? CZ ? A TYR 19 CZ 11 1 Y 1 A TYR 13 ? OH ? A TYR 19 OH 12 1 Y 1 A LYS 16 ? CG ? A LYS 22 CG 13 1 Y 1 A LYS 16 ? CD ? A LYS 22 CD 14 1 Y 1 A LYS 16 ? CE ? A LYS 22 CE 15 1 Y 1 A LYS 16 ? NZ ? A LYS 22 NZ 16 1 Y 1 A LYS 20 ? CG ? A LYS 26 CG 17 1 Y 1 A LYS 20 ? CD ? A LYS 26 CD 18 1 Y 1 A LYS 20 ? CE ? A LYS 26 CE 19 1 Y 1 A LYS 20 ? NZ ? A LYS 26 NZ 20 1 Y 1 A LYS 23 ? CG ? A LYS 29 CG 21 1 Y 1 A LYS 23 ? CD ? A LYS 29 CD 22 1 Y 1 A LYS 23 ? CE ? A LYS 29 CE 23 1 Y 1 A LYS 23 ? NZ ? A LYS 29 NZ 24 1 Y 1 A ARG 40 ? CG ? A ARG 46 CG 25 1 Y 1 A ARG 40 ? CD ? A ARG 46 CD 26 1 Y 1 A ARG 40 ? NE ? A ARG 46 NE 27 1 Y 1 A ARG 40 ? CZ ? A ARG 46 CZ 28 1 Y 1 A ARG 40 ? NH1 ? A ARG 46 NH1 29 1 Y 1 A ARG 40 ? NH2 ? A ARG 46 NH2 30 1 Y 1 A ARG 47 ? CG ? A ARG 53 CG 31 1 Y 1 A ARG 47 ? CD ? A ARG 53 CD 32 1 Y 1 A ARG 47 ? NE ? A ARG 53 NE 33 1 Y 1 A ARG 47 ? CZ ? A ARG 53 CZ 34 1 Y 1 A ARG 47 ? NH1 ? A ARG 53 NH1 35 1 Y 1 A ARG 47 ? NH2 ? A ARG 53 NH2 36 1 Y 1 A ARG 71 ? CG ? A ARG 77 CG 37 1 Y 1 A ARG 71 ? CD ? A ARG 77 CD 38 1 Y 1 A ARG 71 ? NE ? A ARG 77 NE 39 1 Y 1 A ARG 71 ? CZ ? A ARG 77 CZ 40 1 Y 1 A ARG 71 ? NH1 ? A ARG 77 NH1 41 1 Y 1 A ARG 71 ? NH2 ? A ARG 77 NH2 42 1 Y 1 A GLU 96 ? CG ? A GLU 102 CG 43 1 Y 1 A GLU 96 ? CD ? A GLU 102 CD 44 1 Y 1 A GLU 96 ? OE1 ? A GLU 102 OE1 45 1 Y 1 A GLU 96 ? OE2 ? A GLU 102 OE2 46 1 Y 1 A LYS 117 ? CE ? A LYS 123 CE 47 1 Y 1 A LYS 117 ? NZ ? A LYS 123 NZ 48 1 Y 1 B GLU 1986 ? CG ? B GLU 2 CG 49 1 Y 1 B GLU 1986 ? CD ? B GLU 2 CD 50 1 Y 1 B GLU 1986 ? OE1 ? B GLU 2 OE1 51 1 Y 1 B GLU 1986 ? OE2 ? B GLU 2 OE2 52 1 Y 1 B GLU 1995 ? CG ? B GLU 11 CG 53 1 Y 1 B GLU 1995 ? CD ? B GLU 11 CD 54 1 Y 1 B GLU 1995 ? OE1 ? B GLU 11 OE1 55 1 Y 1 B GLU 1995 ? OE2 ? B GLU 11 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B ALA 2008 ? B ALA 24 2 1 Y 1 B PRO 2009 ? B PRO 25 3 1 Y 1 B SER 2010 ? B SER 26 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 GOL C1 C N N 123 GOL O1 O N N 124 GOL C2 C N N 125 GOL O2 O N N 126 GOL C3 C N N 127 GOL O3 O N N 128 GOL H11 H N N 129 GOL H12 H N N 130 GOL HO1 H N N 131 GOL H2 H N N 132 GOL HO2 H N N 133 GOL H31 H N N 134 GOL H32 H N N 135 GOL HO3 H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Research Grants Council (RGC)' _pdbx_audit_support.country 'Hong Kong' _pdbx_audit_support.grant_number AoE-M09-12 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2R2Q _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? #