data_5YJ8 # _entry.id 5YJ8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5YJ8 pdb_00005yj8 10.2210/pdb5yj8/pdb WWPDB D_1300005387 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YJ8 _pdbx_database_status.recvd_initial_deposition_date 2017-10-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, J.' 1 ? 'Ruan, K.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'FEBS J.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-4658 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 285 _citation.language ? _citation.page_first 2091 _citation.page_last 2103 _citation.title 'Structural plasticity of the TDRD3 Tudor domain probed by a fragment screening hit.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/febs.14469 _citation.pdbx_database_id_PubMed 29645362 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, J.' 1 ? primary 'Zhang, S.' 2 ? primary 'Liu, M.' 3 ? primary 'Liu, Y.' 4 ? primary 'Nshogoza, G.' 5 ? primary 'Gao, J.' 6 ? primary 'Ma, R.' 7 ? primary 'Yang, Y.' 8 ? primary 'Wu, J.' 9 ? primary 'Zhang, J.' 10 ? primary 'Li, F.' 11 ? primary 'Ruan, K.' 12 ? # _cell.length_a 50.974 _cell.length_b 50.974 _cell.length_c 42.087 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 5YJ8 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.entry_id 5YJ8 _symmetry.Int_Tables_number 154 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tudor domain-containing protein 3' 7147.088 1 ? ? 'Tudor domain' ? 2 non-polymer syn '5-(aminomethyl)-1,3-dimethyl-benzimidazol-2-one' 191.230 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 38 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code HHHHHMMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPI _entity_poly.pdbx_seq_one_letter_code_can HHHHHMMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 MET n 1 7 MET n 1 8 TRP n 1 9 LYS n 1 10 PRO n 1 11 GLY n 1 12 ASP n 1 13 GLU n 1 14 CYS n 1 15 PHE n 1 16 ALA n 1 17 LEU n 1 18 TYR n 1 19 TRP n 1 20 GLU n 1 21 ASP n 1 22 ASN n 1 23 LYS n 1 24 PHE n 1 25 TYR n 1 26 ARG n 1 27 ALA n 1 28 GLU n 1 29 VAL n 1 30 GLU n 1 31 ALA n 1 32 LEU n 1 33 HIS n 1 34 SER n 1 35 SER n 1 36 GLY n 1 37 MET n 1 38 THR n 1 39 ALA n 1 40 VAL n 1 41 VAL n 1 42 LYS n 1 43 PHE n 1 44 ILE n 1 45 ASP n 1 46 TYR n 1 47 GLY n 1 48 ASN n 1 49 TYR n 1 50 GLU n 1 51 GLU n 1 52 VAL n 1 53 LEU n 1 54 LEU n 1 55 SER n 1 56 ASN n 1 57 ILE n 1 58 LYS n 1 59 PRO n 1 60 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 60 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TDRD3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-Gold(DE3)pLysS AG' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TDRD3_HUMAN _struct_ref.pdbx_db_accession Q9H7E2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPI _struct_ref.pdbx_align_begin 555 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5YJ8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H7E2 _struct_ref_seq.db_align_beg 555 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 608 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 555 _struct_ref_seq.pdbx_auth_seq_align_end 608 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5YJ8 HIS A 1 ? UNP Q9H7E2 ? ? 'expression tag' 549 1 1 5YJ8 HIS A 2 ? UNP Q9H7E2 ? ? 'expression tag' 550 2 1 5YJ8 HIS A 3 ? UNP Q9H7E2 ? ? 'expression tag' 551 3 1 5YJ8 HIS A 4 ? UNP Q9H7E2 ? ? 'expression tag' 552 4 1 5YJ8 HIS A 5 ? UNP Q9H7E2 ? ? 'expression tag' 553 5 1 5YJ8 MET A 6 ? UNP Q9H7E2 ? ? 'expression tag' 554 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8W9 non-polymer . '5-(aminomethyl)-1,3-dimethyl-benzimidazol-2-one' ? 'C10 H13 N3 O' 191.230 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YJ8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.31 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.5M Ammonium sulfate, 0.1M Sodium acetate trihydrate, pH 4.6' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9774 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9774 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.entry_id 5YJ8 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 40.000 _reflns.d_resolution_high 1.760 _reflns.number_obs 6495 _reflns.number_all ? _reflns.percent_possible_obs 99.400 _reflns.pdbx_Rmerge_I_obs 0.076 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 4.500 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 19.000 _reflns.pdbx_Rrim_I_all 0.078 _reflns.pdbx_Rpim_I_all 0.018 _reflns.pdbx_CC_half ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_number_measured_all 123251 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_chi_squared 1.054 _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.details ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 1.760 1.790 ? ? 295 ? 0.504 ? ? 0.455 15.700 ? ? ? ? ? ? ? ? 96.100 0.520 0.127 0.970 1 2 1.790 1.820 ? ? 323 ? 0.458 ? ? 0.458 18.200 ? ? ? ? ? ? ? ? 99.400 0.471 0.108 0.978 1 3 1.820 1.860 ? ? 314 ? 0.410 ? ? 0.589 19.100 ? ? ? ? ? ? ? ? 98.700 0.421 0.096 0.914 1 4 1.860 1.900 ? ? 320 ? 0.352 ? ? 0.541 19.900 ? ? ? ? ? ? ? ? 100.000 0.361 0.080 0.980 1 5 1.900 1.940 ? ? 320 ? 0.304 ? ? 0.545 19.600 ? ? ? ? ? ? ? ? 98.200 0.312 0.069 0.985 1 6 1.940 1.980 ? ? 307 ? 0.243 ? ? 0.483 19.500 ? ? ? ? ? ? ? ? 100.000 0.249 0.056 0.993 1 7 1.980 2.030 ? ? 324 ? 0.195 ? ? 0.527 18.400 ? ? ? ? ? ? ? ? 99.100 0.200 0.046 0.993 1 8 2.030 2.090 ? ? 320 ? 0.178 ? ? 0.588 18.900 ? ? ? ? ? ? ? ? 100.000 0.183 0.043 0.908 1 9 2.090 2.150 ? ? 318 ? 0.170 ? ? 0.510 20.300 ? ? ? ? ? ? ? ? 99.100 0.174 0.038 0.994 1 10 2.150 2.220 ? ? 334 ? 0.152 ? ? 0.457 20.100 ? ? ? ? ? ? ? ? 99.100 0.156 0.034 0.995 1 11 2.220 2.300 ? ? 309 ? 0.127 ? ? 0.457 19.900 ? ? ? ? ? ? ? ? 100.000 0.130 0.029 0.997 1 12 2.300 2.390 ? ? 328 ? 0.123 ? ? 1.235 18.900 ? ? ? ? ? ? ? ? 99.700 0.127 0.029 0.977 1 13 2.390 2.500 ? ? 321 ? 0.107 ? ? 1.023 18.400 ? ? ? ? ? ? ? ? 99.700 0.111 0.026 0.992 1 14 2.500 2.630 ? ? 331 ? 0.100 ? ? 1.059 19.300 ? ? ? ? ? ? ? ? 99.700 0.103 0.023 0.988 1 15 2.630 2.790 ? ? 325 ? 0.077 ? ? 0.429 19.900 ? ? ? ? ? ? ? ? 100.000 0.079 0.017 0.998 1 16 2.790 3.010 ? ? 332 ? 0.071 ? ? 1.306 19.900 ? ? ? ? ? ? ? ? 99.700 0.073 0.016 0.989 1 17 3.010 3.310 ? ? 326 ? 0.059 ? ? 1.075 18.000 ? ? ? ? ? ? ? ? 100.000 0.061 0.014 0.996 1 18 3.310 3.790 ? ? 335 ? 0.062 ? ? 2.993 19.800 ? ? ? ? ? ? ? ? 100.000 0.064 0.014 0.983 1 19 3.790 4.770 ? ? 339 ? 0.046 ? ? 2.101 18.400 ? ? ? ? ? ? ? ? 100.000 0.047 0.011 0.999 1 20 4.770 40.000 ? ? 374 ? 0.055 ? ? 3.833 17.400 ? ? ? ? ? ? ? ? 100.000 0.057 0.014 0.991 # _refine.entry_id 5YJ8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 1.7620 _refine.ls_d_res_low 30.4620 _refine.pdbx_ls_sigma_F 1.400 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.6000 _refine.ls_number_reflns_obs 6480 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1906 _refine.ls_R_factor_R_work 0.1866 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2263 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 9.8000 _refine.ls_number_reflns_R_free 635 _refine.ls_number_reflns_R_work ? _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 26.5879 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 3PMT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 60.760 _refine.B_iso_min 16.250 _refine.pdbx_overall_phase_error 24.2800 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.7620 _refine_hist.d_res_low 30.4620 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 561 _refine_hist.pdbx_number_residues_total 60 _refine_hist.pdbx_B_iso_mean_ligand 29.50 _refine_hist.pdbx_B_iso_mean_solvent 31.96 _refine_hist.pdbx_number_atoms_protein 504 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # _refine_ls_shell.R_factor_R_free 0.2248 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.1876 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.d_res_high 1.7621 _refine_ls_shell.d_res_low 1.8982 _refine_ls_shell.number_reflns_R_free 132 _refine_ls_shell.number_reflns_R_work 1227 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? # _struct.entry_id 5YJ8 _struct.title 'Identification of a small molecule inhibitor for the Tudor domain of TDRD3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YJ8 _struct_keywords.text 'Transcriptional coactivator, complex, inhibitor, TRANSCRIPTION-INHIBITOR complex' _struct_keywords.pdbx_keywords TRANSCRIPTION/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id HIS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 1 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 5 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id HIS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 549 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 553 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 49 ? LEU A 53 ? TYR A 597 LEU A 601 AA1 2 THR A 38 ? PHE A 43 ? THR A 586 PHE A 591 AA1 3 PHE A 24 ? HIS A 33 ? PHE A 572 HIS A 581 AA1 4 GLU A 13 ? LEU A 17 ? GLU A 561 LEU A 565 AA1 5 ILE A 57 ? PRO A 59 ? ILE A 605 PRO A 607 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 50 ? O GLU A 598 N VAL A 41 ? N VAL A 589 AA1 2 3 O VAL A 40 ? O VAL A 588 N GLU A 30 ? N GLU A 578 AA1 3 4 O ALA A 27 ? O ALA A 575 N CYS A 14 ? N CYS A 562 AA1 4 5 N PHE A 15 ? N PHE A 563 O LYS A 58 ? O LYS A 606 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 8W9 701 ? 6 'binding site for residue 8W9 A 701' AC2 Software A SO4 702 ? 8 'binding site for residue SO4 A 702' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 2 ? HIS A 550 . ? 5_665 ? 2 AC1 6 TYR A 18 ? TYR A 566 . ? 1_555 ? 3 AC1 6 TYR A 25 ? TYR A 573 . ? 1_555 ? 4 AC1 6 PHE A 43 ? PHE A 591 . ? 1_555 ? 5 AC1 6 TYR A 46 ? TYR A 594 . ? 1_555 ? 6 AC1 6 ASN A 48 ? ASN A 596 . ? 1_555 ? 7 AC2 8 HIS A 1 ? HIS A 549 . ? 4_465 ? 8 AC2 8 HIS A 1 ? HIS A 549 . ? 1_555 ? 9 AC2 8 HIS A 2 ? HIS A 550 . ? 4_465 ? 10 AC2 8 HIS A 2 ? HIS A 550 . ? 1_555 ? 11 AC2 8 HIS A 3 ? HIS A 551 . ? 1_555 ? 12 AC2 8 HIS A 3 ? HIS A 551 . ? 4_465 ? 13 AC2 8 HOH D . ? HOH A 819 . ? 5_565 ? 14 AC2 8 HOH D . ? HOH A 819 . ? 2_564 ? # _atom_sites.entry_id 5YJ8 _atom_sites.fract_transf_matrix[1][1] 0.019618 _atom_sites.fract_transf_matrix[1][2] 0.011326 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022653 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023760 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 549 549 HIS HIS A . n A 1 2 HIS 2 550 550 HIS HIS A . n A 1 3 HIS 3 551 551 HIS HIS A . n A 1 4 HIS 4 552 552 HIS HIS A . n A 1 5 HIS 5 553 553 HIS HIS A . n A 1 6 MET 6 554 554 MET MET A . n A 1 7 MET 7 555 555 MET MET A . n A 1 8 TRP 8 556 556 TRP TRP A . n A 1 9 LYS 9 557 557 LYS LYS A . n A 1 10 PRO 10 558 558 PRO PRO A . n A 1 11 GLY 11 559 559 GLY GLY A . n A 1 12 ASP 12 560 560 ASP ASP A . n A 1 13 GLU 13 561 561 GLU GLU A . n A 1 14 CYS 14 562 562 CYS CYS A . n A 1 15 PHE 15 563 563 PHE PHE A . n A 1 16 ALA 16 564 564 ALA ALA A . n A 1 17 LEU 17 565 565 LEU LEU A . n A 1 18 TYR 18 566 566 TYR TYR A . n A 1 19 TRP 19 567 567 TRP TRP A . n A 1 20 GLU 20 568 568 GLU GLU A . n A 1 21 ASP 21 569 569 ASP ASP A . n A 1 22 ASN 22 570 570 ASN ASN A . n A 1 23 LYS 23 571 571 LYS LYS A . n A 1 24 PHE 24 572 572 PHE PHE A . n A 1 25 TYR 25 573 573 TYR TYR A . n A 1 26 ARG 26 574 574 ARG ARG A . n A 1 27 ALA 27 575 575 ALA ALA A . n A 1 28 GLU 28 576 576 GLU GLU A . n A 1 29 VAL 29 577 577 VAL VAL A . n A 1 30 GLU 30 578 578 GLU GLU A . n A 1 31 ALA 31 579 579 ALA ALA A . n A 1 32 LEU 32 580 580 LEU LEU A . n A 1 33 HIS 33 581 581 HIS HIS A . n A 1 34 SER 34 582 582 SER SER A . n A 1 35 SER 35 583 583 SER SER A . n A 1 36 GLY 36 584 584 GLY GLY A . n A 1 37 MET 37 585 585 MET MET A . n A 1 38 THR 38 586 586 THR THR A . n A 1 39 ALA 39 587 587 ALA ALA A . n A 1 40 VAL 40 588 588 VAL VAL A . n A 1 41 VAL 41 589 589 VAL VAL A . n A 1 42 LYS 42 590 590 LYS LYS A . n A 1 43 PHE 43 591 591 PHE PHE A . n A 1 44 ILE 44 592 592 ILE ILE A . n A 1 45 ASP 45 593 593 ASP ASP A . n A 1 46 TYR 46 594 594 TYR TYR A . n A 1 47 GLY 47 595 595 GLY GLY A . n A 1 48 ASN 48 596 596 ASN ASN A . n A 1 49 TYR 49 597 597 TYR TYR A . n A 1 50 GLU 50 598 598 GLU GLU A . n A 1 51 GLU 51 599 599 GLU GLU A . n A 1 52 VAL 52 600 600 VAL VAL A . n A 1 53 LEU 53 601 601 LEU LEU A . n A 1 54 LEU 54 602 602 LEU LEU A . n A 1 55 SER 55 603 603 SER SER A . n A 1 56 ASN 56 604 604 ASN ASN A . n A 1 57 ILE 57 605 605 ILE ILE A . n A 1 58 LYS 58 606 606 LYS LYS A . n A 1 59 PRO 59 607 607 PRO PRO A . n A 1 60 ILE 60 608 608 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 8W9 1 701 1 8W9 DRG A . C 3 SO4 1 702 1 SO4 SO4 A . D 4 HOH 1 801 7 HOH HOH A . D 4 HOH 2 802 15 HOH HOH A . D 4 HOH 3 803 11 HOH HOH A . D 4 HOH 4 804 10 HOH HOH A . D 4 HOH 5 805 5 HOH HOH A . D 4 HOH 6 806 17 HOH HOH A . D 4 HOH 7 807 6 HOH HOH A . D 4 HOH 8 808 34 HOH HOH A . D 4 HOH 9 809 24 HOH HOH A . D 4 HOH 10 810 28 HOH HOH A . D 4 HOH 11 811 8 HOH HOH A . D 4 HOH 12 812 18 HOH HOH A . D 4 HOH 13 813 39 HOH HOH A . D 4 HOH 14 814 3 HOH HOH A . D 4 HOH 15 815 9 HOH HOH A . D 4 HOH 16 816 14 HOH HOH A . D 4 HOH 17 817 16 HOH HOH A . D 4 HOH 18 818 19 HOH HOH A . D 4 HOH 19 819 47 HOH HOH A . D 4 HOH 20 820 38 HOH HOH A . D 4 HOH 21 821 29 HOH HOH A . D 4 HOH 22 822 36 HOH HOH A . D 4 HOH 23 823 2 HOH HOH A . D 4 HOH 24 824 43 HOH HOH A . D 4 HOH 25 825 45 HOH HOH A . D 4 HOH 26 826 21 HOH HOH A . D 4 HOH 27 827 33 HOH HOH A . D 4 HOH 28 828 4 HOH HOH A . D 4 HOH 29 829 32 HOH HOH A . D 4 HOH 30 830 35 HOH HOH A . D 4 HOH 31 831 22 HOH HOH A . D 4 HOH 32 832 46 HOH HOH A . D 4 HOH 33 833 12 HOH HOH A . D 4 HOH 34 834 30 HOH HOH A . D 4 HOH 35 835 37 HOH HOH A . D 4 HOH 36 836 27 HOH HOH A . D 4 HOH 37 837 13 HOH HOH A . D 4 HOH 38 838 42 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 140 ? 1 MORE -10 ? 1 'SSA (A^2)' 4430 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 702 ? C SO4 . 2 1 A HOH 837 ? D HOH . 3 1 A HOH 838 ? D HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-02 2 'Structure model' 1 1 2018-05-16 3 'Structure model' 1 2 2018-06-20 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 4 'Structure model' '_database_2.pdbx_DOI' 13 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -26.2559 25.1995 1.4155 0.2014 0.2465 0.1632 -0.0274 -0.0010 0.0187 3.6418 3.4288 1.8732 -3.5104 0.9593 -1.1963 0.1102 -0.1323 0.0582 -0.1652 0.2561 -0.3552 -0.0123 0.0136 0.1990 'X-RAY DIFFRACTION' 2 ? refined -8.6527 17.5672 2.6664 0.2099 0.2813 0.2138 0.0058 0.0357 0.0067 8.9410 2.1397 3.7759 1.0669 1.6676 -0.0168 -0.2819 0.1589 0.1046 0.4565 0.5681 -0.1753 -0.0498 -0.1553 0.5453 'X-RAY DIFFRACTION' 3 ? refined -16.1714 15.4341 5.5858 0.2059 0.2351 0.1846 -0.0099 -0.0268 -0.0001 7.8424 3.2343 4.8760 -2.0991 -1.5423 0.8960 -0.1201 -0.0966 0.1851 0.3899 0.1092 -0.0399 -0.0466 0.1293 -0.0105 'X-RAY DIFFRACTION' 4 ? refined -15.2368 19.0161 4.9429 0.1805 0.2397 0.3085 0.0100 0.0190 0.0004 3.0611 4.0293 3.1875 -1.1258 2.8781 -0.6218 -0.1899 -0.1224 0.3305 0.2497 0.4687 -0.2124 0.1259 -0.2345 0.2185 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 549 A 560 ;chain 'A' and (resid 549 through 560 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 561 A 570 ;chain 'A' and (resid 561 through 570 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 571 A 595 ;chain 'A' and (resid 571 through 595 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 596 A 608 ;chain 'A' and (resid 596 through 608 ) ; ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10_2155 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 569 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 569 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 OD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 569 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.85 _pdbx_validate_rmsd_angle.angle_target_value 118.30 _pdbx_validate_rmsd_angle.angle_deviation 5.55 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 8W9 C4 C Y N 1 8W9 C5 C Y N 2 8W9 C6 C Y N 3 8W9 C11 C Y N 4 8W9 C8 C Y N 5 8W9 C9 C N N 6 8W9 C10 C N N 7 8W9 C12 C Y N 8 8W9 N2 N N N 9 8W9 N3 N N N 10 8W9 C1 C N N 11 8W9 O7 O N N 12 8W9 C15 C N N 13 8W9 N14 N N N 14 8W9 H1 H N N 15 8W9 H2 H N N 16 8W9 H3 H N N 17 8W9 H4 H N N 18 8W9 H5 H N N 19 8W9 H6 H N N 20 8W9 H7 H N N 21 8W9 H8 H N N 22 8W9 H9 H N N 23 8W9 H10 H N N 24 8W9 H11 H N N 25 8W9 H12 H N N 26 8W9 H13 H N N 27 ALA N N N N 28 ALA CA C N S 29 ALA C C N N 30 ALA O O N N 31 ALA CB C N N 32 ALA OXT O N N 33 ALA H H N N 34 ALA H2 H N N 35 ALA HA H N N 36 ALA HB1 H N N 37 ALA HB2 H N N 38 ALA HB3 H N N 39 ALA HXT H N N 40 ARG N N N N 41 ARG CA C N S 42 ARG C C N N 43 ARG O O N N 44 ARG CB C N N 45 ARG CG C N N 46 ARG CD C N N 47 ARG NE N N N 48 ARG CZ C N N 49 ARG NH1 N N N 50 ARG NH2 N N N 51 ARG OXT O N N 52 ARG H H N N 53 ARG H2 H N N 54 ARG HA H N N 55 ARG HB2 H N N 56 ARG HB3 H N N 57 ARG HG2 H N N 58 ARG HG3 H N N 59 ARG HD2 H N N 60 ARG HD3 H N N 61 ARG HE H N N 62 ARG HH11 H N N 63 ARG HH12 H N N 64 ARG HH21 H N N 65 ARG HH22 H N N 66 ARG HXT H N N 67 ASN N N N N 68 ASN CA C N S 69 ASN C C N N 70 ASN O O N N 71 ASN CB C N N 72 ASN CG C N N 73 ASN OD1 O N N 74 ASN ND2 N N N 75 ASN OXT O N N 76 ASN H H N N 77 ASN H2 H N N 78 ASN HA H N N 79 ASN HB2 H N N 80 ASN HB3 H N N 81 ASN HD21 H N N 82 ASN HD22 H N N 83 ASN HXT H N N 84 ASP N N N N 85 ASP CA C N S 86 ASP C C N N 87 ASP O O N N 88 ASP CB C N N 89 ASP CG C N N 90 ASP OD1 O N N 91 ASP OD2 O N N 92 ASP OXT O N N 93 ASP H H N N 94 ASP H2 H N N 95 ASP HA H N N 96 ASP HB2 H N N 97 ASP HB3 H N N 98 ASP HD2 H N N 99 ASP HXT H N N 100 CYS N N N N 101 CYS CA C N R 102 CYS C C N N 103 CYS O O N N 104 CYS CB C N N 105 CYS SG S N N 106 CYS OXT O N N 107 CYS H H N N 108 CYS H2 H N N 109 CYS HA H N N 110 CYS HB2 H N N 111 CYS HB3 H N N 112 CYS HG H N N 113 CYS HXT H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HIS N N N N 144 HIS CA C N S 145 HIS C C N N 146 HIS O O N N 147 HIS CB C N N 148 HIS CG C Y N 149 HIS ND1 N Y N 150 HIS CD2 C Y N 151 HIS CE1 C Y N 152 HIS NE2 N Y N 153 HIS OXT O N N 154 HIS H H N N 155 HIS H2 H N N 156 HIS HA H N N 157 HIS HB2 H N N 158 HIS HB3 H N N 159 HIS HD1 H N N 160 HIS HD2 H N N 161 HIS HE1 H N N 162 HIS HE2 H N N 163 HIS HXT H N N 164 HOH O O N N 165 HOH H1 H N N 166 HOH H2 H N N 167 ILE N N N N 168 ILE CA C N S 169 ILE C C N N 170 ILE O O N N 171 ILE CB C N S 172 ILE CG1 C N N 173 ILE CG2 C N N 174 ILE CD1 C N N 175 ILE OXT O N N 176 ILE H H N N 177 ILE H2 H N N 178 ILE HA H N N 179 ILE HB H N N 180 ILE HG12 H N N 181 ILE HG13 H N N 182 ILE HG21 H N N 183 ILE HG22 H N N 184 ILE HG23 H N N 185 ILE HD11 H N N 186 ILE HD12 H N N 187 ILE HD13 H N N 188 ILE HXT H N N 189 LEU N N N N 190 LEU CA C N S 191 LEU C C N N 192 LEU O O N N 193 LEU CB C N N 194 LEU CG C N N 195 LEU CD1 C N N 196 LEU CD2 C N N 197 LEU OXT O N N 198 LEU H H N N 199 LEU H2 H N N 200 LEU HA H N N 201 LEU HB2 H N N 202 LEU HB3 H N N 203 LEU HG H N N 204 LEU HD11 H N N 205 LEU HD12 H N N 206 LEU HD13 H N N 207 LEU HD21 H N N 208 LEU HD22 H N N 209 LEU HD23 H N N 210 LEU HXT H N N 211 LYS N N N N 212 LYS CA C N S 213 LYS C C N N 214 LYS O O N N 215 LYS CB C N N 216 LYS CG C N N 217 LYS CD C N N 218 LYS CE C N N 219 LYS NZ N N N 220 LYS OXT O N N 221 LYS H H N N 222 LYS H2 H N N 223 LYS HA H N N 224 LYS HB2 H N N 225 LYS HB3 H N N 226 LYS HG2 H N N 227 LYS HG3 H N N 228 LYS HD2 H N N 229 LYS HD3 H N N 230 LYS HE2 H N N 231 LYS HE3 H N N 232 LYS HZ1 H N N 233 LYS HZ2 H N N 234 LYS HZ3 H N N 235 LYS HXT H N N 236 MET N N N N 237 MET CA C N S 238 MET C C N N 239 MET O O N N 240 MET CB C N N 241 MET CG C N N 242 MET SD S N N 243 MET CE C N N 244 MET OXT O N N 245 MET H H N N 246 MET H2 H N N 247 MET HA H N N 248 MET HB2 H N N 249 MET HB3 H N N 250 MET HG2 H N N 251 MET HG3 H N N 252 MET HE1 H N N 253 MET HE2 H N N 254 MET HE3 H N N 255 MET HXT H N N 256 PHE N N N N 257 PHE CA C N S 258 PHE C C N N 259 PHE O O N N 260 PHE CB C N N 261 PHE CG C Y N 262 PHE CD1 C Y N 263 PHE CD2 C Y N 264 PHE CE1 C Y N 265 PHE CE2 C Y N 266 PHE CZ C Y N 267 PHE OXT O N N 268 PHE H H N N 269 PHE H2 H N N 270 PHE HA H N N 271 PHE HB2 H N N 272 PHE HB3 H N N 273 PHE HD1 H N N 274 PHE HD2 H N N 275 PHE HE1 H N N 276 PHE HE2 H N N 277 PHE HZ H N N 278 PHE HXT H N N 279 PRO N N N N 280 PRO CA C N S 281 PRO C C N N 282 PRO O O N N 283 PRO CB C N N 284 PRO CG C N N 285 PRO CD C N N 286 PRO OXT O N N 287 PRO H H N N 288 PRO HA H N N 289 PRO HB2 H N N 290 PRO HB3 H N N 291 PRO HG2 H N N 292 PRO HG3 H N N 293 PRO HD2 H N N 294 PRO HD3 H N N 295 PRO HXT H N N 296 SER N N N N 297 SER CA C N S 298 SER C C N N 299 SER O O N N 300 SER CB C N N 301 SER OG O N N 302 SER OXT O N N 303 SER H H N N 304 SER H2 H N N 305 SER HA H N N 306 SER HB2 H N N 307 SER HB3 H N N 308 SER HG H N N 309 SER HXT H N N 310 SO4 S S N N 311 SO4 O1 O N N 312 SO4 O2 O N N 313 SO4 O3 O N N 314 SO4 O4 O N N 315 THR N N N N 316 THR CA C N S 317 THR C C N N 318 THR O O N N 319 THR CB C N R 320 THR OG1 O N N 321 THR CG2 C N N 322 THR OXT O N N 323 THR H H N N 324 THR H2 H N N 325 THR HA H N N 326 THR HB H N N 327 THR HG1 H N N 328 THR HG21 H N N 329 THR HG22 H N N 330 THR HG23 H N N 331 THR HXT H N N 332 TRP N N N N 333 TRP CA C N S 334 TRP C C N N 335 TRP O O N N 336 TRP CB C N N 337 TRP CG C Y N 338 TRP CD1 C Y N 339 TRP CD2 C Y N 340 TRP NE1 N Y N 341 TRP CE2 C Y N 342 TRP CE3 C Y N 343 TRP CZ2 C Y N 344 TRP CZ3 C Y N 345 TRP CH2 C Y N 346 TRP OXT O N N 347 TRP H H N N 348 TRP H2 H N N 349 TRP HA H N N 350 TRP HB2 H N N 351 TRP HB3 H N N 352 TRP HD1 H N N 353 TRP HE1 H N N 354 TRP HE3 H N N 355 TRP HZ2 H N N 356 TRP HZ3 H N N 357 TRP HH2 H N N 358 TRP HXT H N N 359 TYR N N N N 360 TYR CA C N S 361 TYR C C N N 362 TYR O O N N 363 TYR CB C N N 364 TYR CG C Y N 365 TYR CD1 C Y N 366 TYR CD2 C Y N 367 TYR CE1 C Y N 368 TYR CE2 C Y N 369 TYR CZ C Y N 370 TYR OH O N N 371 TYR OXT O N N 372 TYR H H N N 373 TYR H2 H N N 374 TYR HA H N N 375 TYR HB2 H N N 376 TYR HB3 H N N 377 TYR HD1 H N N 378 TYR HD2 H N N 379 TYR HE1 H N N 380 TYR HE2 H N N 381 TYR HH H N N 382 TYR HXT H N N 383 VAL N N N N 384 VAL CA C N S 385 VAL C C N N 386 VAL O O N N 387 VAL CB C N N 388 VAL CG1 C N N 389 VAL CG2 C N N 390 VAL OXT O N N 391 VAL H H N N 392 VAL H2 H N N 393 VAL HA H N N 394 VAL HB H N N 395 VAL HG11 H N N 396 VAL HG12 H N N 397 VAL HG13 H N N 398 VAL HG21 H N N 399 VAL HG22 H N N 400 VAL HG23 H N N 401 VAL HXT H N N 402 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 8W9 C12 C6 doub Y N 1 8W9 C12 C11 sing Y N 2 8W9 C6 C5 sing Y N 3 8W9 C15 C11 sing N N 4 8W9 C15 N14 sing N N 5 8W9 C10 N3 sing N N 6 8W9 C11 C8 doub Y N 7 8W9 C5 N3 sing N N 8 8W9 C5 C4 doub Y N 9 8W9 N3 C1 sing N N 10 8W9 C8 C4 sing Y N 11 8W9 C4 N2 sing N N 12 8W9 C1 N2 sing N N 13 8W9 C1 O7 doub N N 14 8W9 N2 C9 sing N N 15 8W9 C6 H1 sing N N 16 8W9 C8 H2 sing N N 17 8W9 C9 H3 sing N N 18 8W9 C9 H4 sing N N 19 8W9 C9 H5 sing N N 20 8W9 C10 H6 sing N N 21 8W9 C10 H7 sing N N 22 8W9 C10 H8 sing N N 23 8W9 C12 H9 sing N N 24 8W9 C15 H10 sing N N 25 8W9 C15 H11 sing N N 26 8W9 N14 H12 sing N N 27 8W9 N14 H13 sing N N 28 ALA N CA sing N N 29 ALA N H sing N N 30 ALA N H2 sing N N 31 ALA CA C sing N N 32 ALA CA CB sing N N 33 ALA CA HA sing N N 34 ALA C O doub N N 35 ALA C OXT sing N N 36 ALA CB HB1 sing N N 37 ALA CB HB2 sing N N 38 ALA CB HB3 sing N N 39 ALA OXT HXT sing N N 40 ARG N CA sing N N 41 ARG N H sing N N 42 ARG N H2 sing N N 43 ARG CA C sing N N 44 ARG CA CB sing N N 45 ARG CA HA sing N N 46 ARG C O doub N N 47 ARG C OXT sing N N 48 ARG CB CG sing N N 49 ARG CB HB2 sing N N 50 ARG CB HB3 sing N N 51 ARG CG CD sing N N 52 ARG CG HG2 sing N N 53 ARG CG HG3 sing N N 54 ARG CD NE sing N N 55 ARG CD HD2 sing N N 56 ARG CD HD3 sing N N 57 ARG NE CZ sing N N 58 ARG NE HE sing N N 59 ARG CZ NH1 sing N N 60 ARG CZ NH2 doub N N 61 ARG NH1 HH11 sing N N 62 ARG NH1 HH12 sing N N 63 ARG NH2 HH21 sing N N 64 ARG NH2 HH22 sing N N 65 ARG OXT HXT sing N N 66 ASN N CA sing N N 67 ASN N H sing N N 68 ASN N H2 sing N N 69 ASN CA C sing N N 70 ASN CA CB sing N N 71 ASN CA HA sing N N 72 ASN C O doub N N 73 ASN C OXT sing N N 74 ASN CB CG sing N N 75 ASN CB HB2 sing N N 76 ASN CB HB3 sing N N 77 ASN CG OD1 doub N N 78 ASN CG ND2 sing N N 79 ASN ND2 HD21 sing N N 80 ASN ND2 HD22 sing N N 81 ASN OXT HXT sing N N 82 ASP N CA sing N N 83 ASP N H sing N N 84 ASP N H2 sing N N 85 ASP CA C sing N N 86 ASP CA CB sing N N 87 ASP CA HA sing N N 88 ASP C O doub N N 89 ASP C OXT sing N N 90 ASP CB CG sing N N 91 ASP CB HB2 sing N N 92 ASP CB HB3 sing N N 93 ASP CG OD1 doub N N 94 ASP CG OD2 sing N N 95 ASP OD2 HD2 sing N N 96 ASP OXT HXT sing N N 97 CYS N CA sing N N 98 CYS N H sing N N 99 CYS N H2 sing N N 100 CYS CA C sing N N 101 CYS CA CB sing N N 102 CYS CA HA sing N N 103 CYS C O doub N N 104 CYS C OXT sing N N 105 CYS CB SG sing N N 106 CYS CB HB2 sing N N 107 CYS CB HB3 sing N N 108 CYS SG HG sing N N 109 CYS OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 SO4 S O1 doub N N 299 SO4 S O2 doub N N 300 SO4 S O3 sing N N 301 SO4 S O4 sing N N 302 THR N CA sing N N 303 THR N H sing N N 304 THR N H2 sing N N 305 THR CA C sing N N 306 THR CA CB sing N N 307 THR CA HA sing N N 308 THR C O doub N N 309 THR C OXT sing N N 310 THR CB OG1 sing N N 311 THR CB CG2 sing N N 312 THR CB HB sing N N 313 THR OG1 HG1 sing N N 314 THR CG2 HG21 sing N N 315 THR CG2 HG22 sing N N 316 THR CG2 HG23 sing N N 317 THR OXT HXT sing N N 318 TRP N CA sing N N 319 TRP N H sing N N 320 TRP N H2 sing N N 321 TRP CA C sing N N 322 TRP CA CB sing N N 323 TRP CA HA sing N N 324 TRP C O doub N N 325 TRP C OXT sing N N 326 TRP CB CG sing N N 327 TRP CB HB2 sing N N 328 TRP CB HB3 sing N N 329 TRP CG CD1 doub Y N 330 TRP CG CD2 sing Y N 331 TRP CD1 NE1 sing Y N 332 TRP CD1 HD1 sing N N 333 TRP CD2 CE2 doub Y N 334 TRP CD2 CE3 sing Y N 335 TRP NE1 CE2 sing Y N 336 TRP NE1 HE1 sing N N 337 TRP CE2 CZ2 sing Y N 338 TRP CE3 CZ3 doub Y N 339 TRP CE3 HE3 sing N N 340 TRP CZ2 CH2 doub Y N 341 TRP CZ2 HZ2 sing N N 342 TRP CZ3 CH2 sing Y N 343 TRP CZ3 HZ3 sing N N 344 TRP CH2 HH2 sing N N 345 TRP OXT HXT sing N N 346 TYR N CA sing N N 347 TYR N H sing N N 348 TYR N H2 sing N N 349 TYR CA C sing N N 350 TYR CA CB sing N N 351 TYR CA HA sing N N 352 TYR C O doub N N 353 TYR C OXT sing N N 354 TYR CB CG sing N N 355 TYR CB HB2 sing N N 356 TYR CB HB3 sing N N 357 TYR CG CD1 doub Y N 358 TYR CG CD2 sing Y N 359 TYR CD1 CE1 sing Y N 360 TYR CD1 HD1 sing N N 361 TYR CD2 CE2 doub Y N 362 TYR CD2 HD2 sing N N 363 TYR CE1 CZ doub Y N 364 TYR CE1 HE1 sing N N 365 TYR CE2 CZ sing Y N 366 TYR CE2 HE2 sing N N 367 TYR CZ OH sing N N 368 TYR OH HH sing N N 369 TYR OXT HXT sing N N 370 VAL N CA sing N N 371 VAL N H sing N N 372 VAL N H2 sing N N 373 VAL CA C sing N N 374 VAL CA CB sing N N 375 VAL CA HA sing N N 376 VAL C O doub N N 377 VAL C OXT sing N N 378 VAL CB CG1 sing N N 379 VAL CB CG2 sing N N 380 VAL CB HB sing N N 381 VAL CG1 HG11 sing N N 382 VAL CG1 HG12 sing N N 383 VAL CG1 HG13 sing N N 384 VAL CG2 HG21 sing N N 385 VAL CG2 HG22 sing N N 386 VAL CG2 HG23 sing N N 387 VAL OXT HXT sing N N 388 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-(aminomethyl)-1,3-dimethyl-benzimidazol-2-one' 8W9 3 'SULFATE ION' SO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3PMT _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #