data_5YR9 # _entry.id 5YR9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.288 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5YR9 WWPDB D_1300005764 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YR9 _pdbx_database_status.recvd_initial_deposition_date 2017-11-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Negishi, H.' 1 ? 'Abe, S.' 2 ? 'Yamashita, K.' 3 ? 'Hirata, K.' 4 ? 'Niwase, K.' 5 ? 'Boudes, M.' 6 ? 'Coulibaly, F.' 7 ? 'Mori, H.' 8 ? 'Ueno, T.' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem. Commun. (Camb.)' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1364-548X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 54 _citation.language ? _citation.page_first 1988 _citation.page_last 1991 _citation.title 'Supramolecular protein cages constructed from a crystalline protein matrix' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/c7cc08689j _citation.pdbx_database_id_PubMed 29405208 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Negishi, H.' 1 primary 'Abe, S.' 2 primary 'Yamashita, K.' 3 primary 'Hirata, K.' 4 primary 'Niwase, K.' 5 primary 'Boudes, M.' 6 primary 'Coulibaly, F.' 7 primary 'Mori, H.' 8 primary 'Ueno, T.' 9 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5YR9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 103.750 _cell.length_a_esd ? _cell.length_b 103.750 _cell.length_b_esd ? _cell.length_c 103.750 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YR9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Polyhedrin 28320.355 1 ? ? R13A,E73C,Y83C ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 4 ? ? ? ? 3 water nat water 18.015 112 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name C-polyhedrin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MADVAGTSNRDFAGREQRLFNSEQYNYNNSLNGEVSVWVYAYYSDGSVLVINKNSQYKVGISETFKALKEYRCGQHNDSY DECEVNQSIYYPNGGDARKFHSNAKPRAIQIIFSPSVNVRTIKMAKGNAVSVPDEYLQRSHPWEATGIKYRKIKRDGEIV GYSHYFELPHEYNSISLAVSGVHKNPSSYNVGSAHNVMDVFQSCDLALRFCNRYWAELELVNHYISPNAYPYLDINNHSY GVALSNRQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MADVAGTSNRDFAGREQRLFNSEQYNYNNSLNGEVSVWVYAYYSDGSVLVINKNSQYKVGISETFKALKEYRCGQHNDSY DECEVNQSIYYPNGGDARKFHSNAKPRAIQIIFSPSVNVRTIKMAKGNAVSVPDEYLQRSHPWEATGIKYRKIKRDGEIV GYSHYFELPHEYNSISLAVSGVHKNPSSYNVGSAHNVMDVFQSCDLALRFCNRYWAELELVNHYISPNAYPYLDINNHSY GVALSNRQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ASP n 1 4 VAL n 1 5 ALA n 1 6 GLY n 1 7 THR n 1 8 SER n 1 9 ASN n 1 10 ARG n 1 11 ASP n 1 12 PHE n 1 13 ALA n 1 14 GLY n 1 15 ARG n 1 16 GLU n 1 17 GLN n 1 18 ARG n 1 19 LEU n 1 20 PHE n 1 21 ASN n 1 22 SER n 1 23 GLU n 1 24 GLN n 1 25 TYR n 1 26 ASN n 1 27 TYR n 1 28 ASN n 1 29 ASN n 1 30 SER n 1 31 LEU n 1 32 ASN n 1 33 GLY n 1 34 GLU n 1 35 VAL n 1 36 SER n 1 37 VAL n 1 38 TRP n 1 39 VAL n 1 40 TYR n 1 41 ALA n 1 42 TYR n 1 43 TYR n 1 44 SER n 1 45 ASP n 1 46 GLY n 1 47 SER n 1 48 VAL n 1 49 LEU n 1 50 VAL n 1 51 ILE n 1 52 ASN n 1 53 LYS n 1 54 ASN n 1 55 SER n 1 56 GLN n 1 57 TYR n 1 58 LYS n 1 59 VAL n 1 60 GLY n 1 61 ILE n 1 62 SER n 1 63 GLU n 1 64 THR n 1 65 PHE n 1 66 LYS n 1 67 ALA n 1 68 LEU n 1 69 LYS n 1 70 GLU n 1 71 TYR n 1 72 ARG n 1 73 CYS n 1 74 GLY n 1 75 GLN n 1 76 HIS n 1 77 ASN n 1 78 ASP n 1 79 SER n 1 80 TYR n 1 81 ASP n 1 82 GLU n 1 83 CYS n 1 84 GLU n 1 85 VAL n 1 86 ASN n 1 87 GLN n 1 88 SER n 1 89 ILE n 1 90 TYR n 1 91 TYR n 1 92 PRO n 1 93 ASN n 1 94 GLY n 1 95 GLY n 1 96 ASP n 1 97 ALA n 1 98 ARG n 1 99 LYS n 1 100 PHE n 1 101 HIS n 1 102 SER n 1 103 ASN n 1 104 ALA n 1 105 LYS n 1 106 PRO n 1 107 ARG n 1 108 ALA n 1 109 ILE n 1 110 GLN n 1 111 ILE n 1 112 ILE n 1 113 PHE n 1 114 SER n 1 115 PRO n 1 116 SER n 1 117 VAL n 1 118 ASN n 1 119 VAL n 1 120 ARG n 1 121 THR n 1 122 ILE n 1 123 LYS n 1 124 MET n 1 125 ALA n 1 126 LYS n 1 127 GLY n 1 128 ASN n 1 129 ALA n 1 130 VAL n 1 131 SER n 1 132 VAL n 1 133 PRO n 1 134 ASP n 1 135 GLU n 1 136 TYR n 1 137 LEU n 1 138 GLN n 1 139 ARG n 1 140 SER n 1 141 HIS n 1 142 PRO n 1 143 TRP n 1 144 GLU n 1 145 ALA n 1 146 THR n 1 147 GLY n 1 148 ILE n 1 149 LYS n 1 150 TYR n 1 151 ARG n 1 152 LYS n 1 153 ILE n 1 154 LYS n 1 155 ARG n 1 156 ASP n 1 157 GLY n 1 158 GLU n 1 159 ILE n 1 160 VAL n 1 161 GLY n 1 162 TYR n 1 163 SER n 1 164 HIS n 1 165 TYR n 1 166 PHE n 1 167 GLU n 1 168 LEU n 1 169 PRO n 1 170 HIS n 1 171 GLU n 1 172 TYR n 1 173 ASN n 1 174 SER n 1 175 ILE n 1 176 SER n 1 177 LEU n 1 178 ALA n 1 179 VAL n 1 180 SER n 1 181 GLY n 1 182 VAL n 1 183 HIS n 1 184 LYS n 1 185 ASN n 1 186 PRO n 1 187 SER n 1 188 SER n 1 189 TYR n 1 190 ASN n 1 191 VAL n 1 192 GLY n 1 193 SER n 1 194 ALA n 1 195 HIS n 1 196 ASN n 1 197 VAL n 1 198 MET n 1 199 ASP n 1 200 VAL n 1 201 PHE n 1 202 GLN n 1 203 SER n 1 204 CYS n 1 205 ASP n 1 206 LEU n 1 207 ALA n 1 208 LEU n 1 209 ARG n 1 210 PHE n 1 211 CYS n 1 212 ASN n 1 213 ARG n 1 214 TYR n 1 215 TRP n 1 216 ALA n 1 217 GLU n 1 218 LEU n 1 219 GLU n 1 220 LEU n 1 221 VAL n 1 222 ASN n 1 223 HIS n 1 224 TYR n 1 225 ILE n 1 226 SER n 1 227 PRO n 1 228 ASN n 1 229 ALA n 1 230 TYR n 1 231 PRO n 1 232 TYR n 1 233 LEU n 1 234 ASP n 1 235 ILE n 1 236 ASN n 1 237 ASN n 1 238 HIS n 1 239 SER n 1 240 TYR n 1 241 GLY n 1 242 VAL n 1 243 ALA n 1 244 LEU n 1 245 SER n 1 246 ASN n 1 247 ARG n 1 248 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 248 _entity_src_gen.gene_src_common_name BmCPV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bombyx mori cytoplasmic polyhedrosis virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 110829 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYHD_CPVBM _struct_ref.pdbx_db_accession P11041 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MADVAGTSNRDFRGREQRLFNSEQYNYNNSLNGEVSVWVYAYYSDGSVLVINKNSQYKVGISETFKALKEYREGQHNDSY DEYEVNQSIYYPNGGDARKFHSNAKPRAIQIIFSPSVNVRTIKMAKGNAVSVPDEYLQRSHPWEATGIKYRKIKRDGEIV GYSHYFELPHEYNSISLAVSGVHKNPSSYNVGSAHNVMDVFQSCDLALRFCNRYWAELELVNHYISPNAYPYLDINNHSY GVALSNRQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5YR9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 248 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11041 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 248 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 248 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5YR9 ALA A 13 ? UNP P11041 ARG 13 'engineered mutation' 13 1 1 5YR9 CYS A 73 ? UNP P11041 GLU 73 'engineered mutation' 73 2 1 5YR9 CYS A 83 ? UNP P11041 TYR 83 'engineered mutation' 83 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YR9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 25.14 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'IN CELL' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 300 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'In vivo crystallization in the cytoplasm of the cell, temperature 300 K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-10-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL32XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL32XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5YR9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.70 _reflns.d_resolution_low 36.68 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18547 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 27.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.49 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.00 _refine.B_iso_max ? _refine.B_iso_mean 13.272 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.934 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5YR9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.70 _refine.ls_d_res_low 36.68 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18547 _refine.ls_number_reflns_R_free 2025 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.98 _refine.ls_percent_reflns_R_free 9.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.16234 _refine.ls_R_factor_R_free 0.20470 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.15787 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.125 _refine.pdbx_overall_ESU_R_Free 0.120 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.788 _refine.overall_SU_ML 0.086 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1914 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 112 _refine_hist.number_atoms_total 2042 _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 36.68 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.019 0.019 2004 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1820 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.863 1.928 2714 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.058 3.000 4171 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.237 5.000 242 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.616 23.704 108 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.049 15.000 318 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.288 15.000 14 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.126 0.200 275 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 2343 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 523 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.170 1.111 956 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.168 1.110 955 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.865 1.652 1196 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.864 1.652 1197 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.213 1.448 1048 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.211 1.448 1048 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.538 2.049 1517 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.246 10.052 2327 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.198 9.973 2306 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.700 _refine_ls_shell.d_res_low 1.744 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 144 _refine_ls_shell.number_reflns_R_work 1354 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.364 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.340 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5YR9 _struct.title 'Crystal Structure of Cypovirus Polyhedra R13A/E73C/Y83C Mutant' _struct.pdbx_descriptor Polyhedrin _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YR9 _struct_keywords.text 'In vivo protein crystal, polyhedra, viral protein, disulfide bond' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 11 ? SER A 30 ? ASP A 11 SER A 30 1 ? 20 HELX_P HELX_P2 AA2 THR A 64 ? LYS A 69 ? THR A 64 LYS A 69 1 ? 6 HELX_P HELX_P3 AA3 TYR A 80 ? TYR A 91 ? TYR A 80 TYR A 91 1 ? 12 HELX_P HELX_P4 AA4 TYR A 136 ? SER A 140 ? TYR A 136 SER A 140 5 ? 5 HELX_P HELX_P5 AA5 THR A 146 ? TYR A 150 ? THR A 146 TYR A 150 5 ? 5 HELX_P HELX_P6 AA6 ASN A 196 ? ALA A 207 ? ASN A 196 ALA A 207 1 ? 12 HELX_P HELX_P7 AA7 ALA A 216 ? TYR A 224 ? ALA A 216 TYR A 224 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 73 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 83 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id B _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 73 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 83 _struct_conn.ptnr2_symmetry 10_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.020 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 151 ? ARG A 155 ? ARG A 151 ARG A 155 AA1 2 GLU A 158 ? GLU A 167 ? GLU A 158 GLU A 167 AA1 3 ALA A 108 ? PHE A 113 ? ALA A 108 PHE A 113 AA1 4 GLU A 34 ? TYR A 42 ? GLU A 34 TYR A 42 AA1 5 VAL A 48 ? GLN A 56 ? VAL A 48 GLN A 56 AA1 6 LEU A 208 ? TYR A 214 ? LEU A 208 TYR A 214 AA2 1 LYS A 58 ? GLU A 63 ? LYS A 58 GLU A 63 AA2 2 SER A 176 ? HIS A 183 ? SER A 176 HIS A 183 AA2 3 VAL A 117 ? GLY A 127 ? VAL A 117 GLY A 127 AA3 1 TYR A 232 ? LEU A 233 ? TYR A 232 LEU A 233 AA3 2 SER A 239 ? TYR A 240 ? SER A 239 TYR A 240 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 153 ? N ILE A 153 O GLY A 161 ? O GLY A 161 AA1 2 3 O PHE A 166 ? O PHE A 166 N ILE A 109 ? N ILE A 109 AA1 3 4 O GLN A 110 ? O GLN A 110 N TYR A 40 ? N TYR A 40 AA1 4 5 N VAL A 39 ? N VAL A 39 O ILE A 51 ? O ILE A 51 AA1 5 6 N ASN A 52 ? N ASN A 52 O PHE A 210 ? O PHE A 210 AA2 1 2 N GLU A 63 ? N GLU A 63 O LEU A 177 ? O LEU A 177 AA2 2 3 O ALA A 178 ? O ALA A 178 N ALA A 125 ? N ALA A 125 AA3 1 2 N TYR A 232 ? N TYR A 232 O TYR A 240 ? O TYR A 240 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 301 ? 7 'binding site for residue EDO A 301' AC2 Software A EDO 302 ? 5 'binding site for residue EDO A 302' AC3 Software A EDO 303 ? 5 'binding site for residue EDO A 303' AC4 Software A EDO 304 ? 6 'binding site for residue EDO A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASN A 28 ? ASN A 28 . ? 1_555 ? 2 AC1 7 SER A 114 ? SER A 114 . ? 1_555 ? 3 AC1 7 PRO A 115 ? PRO A 115 . ? 1_555 ? 4 AC1 7 GLN A 138 ? GLN A 138 . ? 10_555 ? 5 AC1 7 PRO A 231 ? PRO A 231 . ? 1_555 ? 6 AC1 7 HOH F . ? HOH A 447 . ? 1_555 ? 7 AC1 7 HOH F . ? HOH A 451 . ? 1_555 ? 8 AC2 5 MET A 124 ? MET A 124 . ? 1_555 ? 9 AC2 5 LYS A 149 ? LYS A 149 . ? 1_555 ? 10 AC2 5 HIS A 164 ? HIS A 164 . ? 1_555 ? 11 AC2 5 PHE A 166 ? PHE A 166 . ? 1_555 ? 12 AC2 5 GLN A 248 ? GLN A 248 . ? 23_455 ? 13 AC3 5 GLY A 46 ? GLY A 46 . ? 1_555 ? 14 AC3 5 ALA A 216 ? ALA A 216 . ? 1_555 ? 15 AC3 5 GLU A 217 ? GLU A 217 . ? 1_555 ? 16 AC3 5 HOH F . ? HOH A 401 . ? 1_555 ? 17 AC3 5 HOH F . ? HOH A 479 . ? 1_555 ? 18 AC4 6 LYS A 152 ? LYS A 152 . ? 1_555 ? 19 AC4 6 ILE A 153 ? ILE A 153 . ? 1_555 ? 20 AC4 6 LYS A 154 ? LYS A 154 . ? 1_555 ? 21 AC4 6 LEU A 233 ? LEU A 233 . ? 1_555 ? 22 AC4 6 ASN A 237 ? ASN A 237 . ? 1_555 ? 23 AC4 6 SER A 239 ? SER A 239 . ? 1_555 ? # _atom_sites.entry_id 5YR9 _atom_sites.fract_transf_matrix[1][1] 0.009639 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009639 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009639 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLN 75 75 ? ? ? A . n A 1 76 HIS 76 76 ? ? ? A . n A 1 77 ASN 77 77 ? ? ? A . n A 1 78 ASP 78 78 ? ? ? A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 MET 124 124 124 MET MET A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 TRP 143 143 143 TRP TRP A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 TYR 162 162 162 TYR TYR A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 HIS 170 170 170 HIS HIS A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 HIS 183 183 183 HIS HIS A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 HIS 195 195 195 HIS HIS A . n A 1 196 ASN 196 196 196 ASN ASN A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 MET 198 198 198 MET MET A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 CYS 204 204 204 CYS CYS A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 ARG 209 209 209 ARG ARG A . n A 1 210 PHE 210 210 210 PHE PHE A . n A 1 211 CYS 211 211 211 CYS CYS A . n A 1 212 ASN 212 212 212 ASN ASN A . n A 1 213 ARG 213 213 213 ARG ARG A . n A 1 214 TYR 214 214 214 TYR TYR A . n A 1 215 TRP 215 215 215 TRP TRP A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 ASN 222 222 222 ASN ASN A . n A 1 223 HIS 223 223 223 HIS HIS A . n A 1 224 TYR 224 224 224 TYR TYR A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 ASN 228 228 228 ASN ASN A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 TYR 230 230 230 TYR TYR A . n A 1 231 PRO 231 231 231 PRO PRO A . n A 1 232 TYR 232 232 232 TYR TYR A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 ASN 236 236 236 ASN ASN A . n A 1 237 ASN 237 237 237 ASN ASN A . n A 1 238 HIS 238 238 238 HIS HIS A . n A 1 239 SER 239 239 239 SER SER A . n A 1 240 TYR 240 240 240 TYR TYR A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 VAL 242 242 242 VAL VAL A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 SER 245 245 245 SER SER A . n A 1 246 ASN 246 246 246 ASN ASN A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 GLN 248 248 248 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 301 190 EDO EDO A . C 2 EDO 1 302 193 EDO EDO A . D 2 EDO 1 303 194 EDO EDO A . E 2 EDO 1 304 195 EDO EDO A . F 3 HOH 1 401 107 HOH HOH A . F 3 HOH 2 402 71 HOH HOH A . F 3 HOH 3 403 67 HOH HOH A . F 3 HOH 4 404 66 HOH HOH A . F 3 HOH 5 405 122 HOH HOH A . F 3 HOH 6 406 113 HOH HOH A . F 3 HOH 7 407 35 HOH HOH A . F 3 HOH 8 408 95 HOH HOH A . F 3 HOH 9 409 97 HOH HOH A . F 3 HOH 10 410 130 HOH HOH A . F 3 HOH 11 411 17 HOH HOH A . F 3 HOH 12 412 8 HOH HOH A . F 3 HOH 13 413 64 HOH HOH A . F 3 HOH 14 414 13 HOH HOH A . F 3 HOH 15 415 21 HOH HOH A . F 3 HOH 16 416 62 HOH HOH A . F 3 HOH 17 417 92 HOH HOH A . F 3 HOH 18 418 48 HOH HOH A . F 3 HOH 19 419 9 HOH HOH A . F 3 HOH 20 420 22 HOH HOH A . F 3 HOH 21 421 7 HOH HOH A . F 3 HOH 22 422 53 HOH HOH A . F 3 HOH 23 423 54 HOH HOH A . F 3 HOH 24 424 32 HOH HOH A . F 3 HOH 25 425 30 HOH HOH A . F 3 HOH 26 426 34 HOH HOH A . F 3 HOH 27 427 75 HOH HOH A . F 3 HOH 28 428 69 HOH HOH A . F 3 HOH 29 429 40 HOH HOH A . F 3 HOH 30 430 11 HOH HOH A . F 3 HOH 31 431 31 HOH HOH A . F 3 HOH 32 432 29 HOH HOH A . F 3 HOH 33 433 65 HOH HOH A . F 3 HOH 34 434 61 HOH HOH A . F 3 HOH 35 435 28 HOH HOH A . F 3 HOH 36 436 88 HOH HOH A . F 3 HOH 37 437 25 HOH HOH A . F 3 HOH 38 438 39 HOH HOH A . F 3 HOH 39 439 24 HOH HOH A . F 3 HOH 40 440 10 HOH HOH A . F 3 HOH 41 441 76 HOH HOH A . F 3 HOH 42 442 87 HOH HOH A . F 3 HOH 43 443 5 HOH HOH A . F 3 HOH 44 444 80 HOH HOH A . F 3 HOH 45 445 4 HOH HOH A . F 3 HOH 46 446 2 HOH HOH A . F 3 HOH 47 447 43 HOH HOH A . F 3 HOH 48 448 52 HOH HOH A . F 3 HOH 49 449 93 HOH HOH A . F 3 HOH 50 450 94 HOH HOH A . F 3 HOH 51 451 37 HOH HOH A . F 3 HOH 52 452 51 HOH HOH A . F 3 HOH 53 453 36 HOH HOH A . F 3 HOH 54 454 42 HOH HOH A . F 3 HOH 55 455 81 HOH HOH A . F 3 HOH 56 456 68 HOH HOH A . F 3 HOH 57 457 125 HOH HOH A . F 3 HOH 58 458 79 HOH HOH A . F 3 HOH 59 459 44 HOH HOH A . F 3 HOH 60 460 78 HOH HOH A . F 3 HOH 61 461 136 HOH HOH A . F 3 HOH 62 462 1 HOH HOH A . F 3 HOH 63 463 41 HOH HOH A . F 3 HOH 64 464 70 HOH HOH A . F 3 HOH 65 465 60 HOH HOH A . F 3 HOH 66 466 84 HOH HOH A . F 3 HOH 67 467 56 HOH HOH A . F 3 HOH 68 468 3 HOH HOH A . F 3 HOH 69 469 18 HOH HOH A . F 3 HOH 70 470 6 HOH HOH A . F 3 HOH 71 471 23 HOH HOH A . F 3 HOH 72 472 15 HOH HOH A . F 3 HOH 73 473 27 HOH HOH A . F 3 HOH 74 474 105 HOH HOH A . F 3 HOH 75 475 16 HOH HOH A . F 3 HOH 76 476 58 HOH HOH A . F 3 HOH 77 477 82 HOH HOH A . F 3 HOH 78 478 77 HOH HOH A . F 3 HOH 79 479 26 HOH HOH A . F 3 HOH 80 480 55 HOH HOH A . F 3 HOH 81 481 19 HOH HOH A . F 3 HOH 82 482 127 HOH HOH A . F 3 HOH 83 483 49 HOH HOH A . F 3 HOH 84 484 14 HOH HOH A . F 3 HOH 85 485 101 HOH HOH A . F 3 HOH 86 486 72 HOH HOH A . F 3 HOH 87 487 91 HOH HOH A . F 3 HOH 88 488 33 HOH HOH A . F 3 HOH 89 489 46 HOH HOH A . F 3 HOH 90 490 90 HOH HOH A . F 3 HOH 91 491 20 HOH HOH A . F 3 HOH 92 492 124 HOH HOH A . F 3 HOH 93 493 104 HOH HOH A . F 3 HOH 94 494 57 HOH HOH A . F 3 HOH 95 495 45 HOH HOH A . F 3 HOH 96 496 74 HOH HOH A . F 3 HOH 97 497 50 HOH HOH A . F 3 HOH 98 498 47 HOH HOH A . F 3 HOH 99 499 63 HOH HOH A . F 3 HOH 100 500 89 HOH HOH A . F 3 HOH 101 501 138 HOH HOH A . F 3 HOH 102 502 85 HOH HOH A . F 3 HOH 103 503 103 HOH HOH A . F 3 HOH 104 504 59 HOH HOH A . F 3 HOH 105 505 86 HOH HOH A . F 3 HOH 106 506 115 HOH HOH A . F 3 HOH 107 507 83 HOH HOH A . F 3 HOH 108 508 172 HOH HOH A . F 3 HOH 109 509 96 HOH HOH A . F 3 HOH 110 510 110 HOH HOH A . F 3 HOH 111 511 118 HOH HOH A . F 3 HOH 112 512 102 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 47330 ? 1 MORE -290 ? 1 'SSA (A^2)' 121250 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-21 2 'Structure model' 1 1 2018-03-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 ARG _pdbx_validate_rmsd_bond.auth_seq_id_1 139 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 NE _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 ARG _pdbx_validate_rmsd_bond.auth_seq_id_2 139 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.347 _pdbx_validate_rmsd_bond.bond_target_value 1.460 _pdbx_validate_rmsd_bond.bond_deviation -0.113 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.017 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 96 ? ? CG A ASP 96 ? ? OD1 A ASP 96 ? ? 125.06 118.30 6.76 0.90 N 2 1 CB A ASP 96 ? ? CG A ASP 96 ? ? OD2 A ASP 96 ? ? 111.86 118.30 -6.44 0.90 N 3 1 NE A ARG 139 ? ? CZ A ARG 139 ? ? NH1 A ARG 139 ? ? 126.00 120.30 5.70 0.50 N 4 1 NE A ARG 139 ? ? CZ A ARG 139 ? ? NH2 A ARG 139 ? ? 114.26 120.30 -6.04 0.50 N 5 1 CB A ASP 156 ? ? CG A ASP 156 ? ? OD2 A ASP 156 ? ? 123.82 118.30 5.52 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 57 ? ? 72.59 -49.61 2 1 SER A 131 ? ? 73.16 38.46 3 1 GLU A 135 ? ? 74.51 -57.52 4 1 ASN A 185 ? ? -161.72 86.53 5 1 TYR A 224 ? ? -120.14 -56.44 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A GLN 75 ? A GLN 75 10 1 Y 1 A HIS 76 ? A HIS 76 11 1 Y 1 A ASN 77 ? A ASN 77 12 1 Y 1 A ASP 78 ? A ASP 78 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal JSPS Japan 26620130 1 JSPS Japan 15J11955 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #