data_5ZBT # _entry.id 5ZBT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.303 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5ZBT WWPDB D_1300006814 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZBT _pdbx_database_status.recvd_initial_deposition_date 2018-02-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Khan, F.' 1 ? 'Suguna, K.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr F Struct Biol Commun' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 75 _citation.language ? _citation.page_first 197 _citation.page_last 204 _citation.title 'Crystal structure of the legume lectin-like domain of an ERGIC-53-like protein from Entamoeba histolytica' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X19000499 _citation.pdbx_database_id_PubMed 30839295 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Khan, F.' 1 ? primary 'Suguna, K.' 2 0000-0003-4717-6567 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5ZBT _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.051 _cell.length_a_esd ? _cell.length_b 57.174 _cell.length_b_esd ? _cell.length_c 72.489 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZBT _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Lectin-like protein' 28356.566 1 ? ? ? ? 2 water nat water 18.015 106 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMASVVDVLSFREPIEPENVVRNYDMKGPIIVFENYVQITPNGIGKSSIMNGKYKVDLPSF ELQLKLNIICKEKCGGGMGVWLTEEKLKEGDLFGAYNIYKGIGIFINFEDVDIPMISVLKNDGVDILKYKPEMYYQCSVA NIQKDKDGAVLRIKYLVNEKKLIIEIMVNHINMDCITIEDIDIPPFYLGISATNGGSGSTSYRVQSLHYYEVGNKERKEV HLNNVVENEQI ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMASVVDVLSFREPIEPENVVRNYDMKGPIIVFENYVQITPNGIGKSSIMNGKYKVDLPSF ELQLKLNIICKEKCGGGMGVWLTEEKLKEGDLFGAYNIYKGIGIFINFEDVDIPMISVLKNDGVDILKYKPEMYYQCSVA NIQKDKDGAVLRIKYLVNEKKLIIEIMVNHINMDCITIEDIDIPPFYLGISATNGGSGSTSYRVQSLHYYEVGNKERKEV HLNNVVENEQI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 SER n 1 24 VAL n 1 25 VAL n 1 26 ASP n 1 27 VAL n 1 28 LEU n 1 29 SER n 1 30 PHE n 1 31 ARG n 1 32 GLU n 1 33 PRO n 1 34 ILE n 1 35 GLU n 1 36 PRO n 1 37 GLU n 1 38 ASN n 1 39 VAL n 1 40 VAL n 1 41 ARG n 1 42 ASN n 1 43 TYR n 1 44 ASP n 1 45 MET n 1 46 LYS n 1 47 GLY n 1 48 PRO n 1 49 ILE n 1 50 ILE n 1 51 VAL n 1 52 PHE n 1 53 GLU n 1 54 ASN n 1 55 TYR n 1 56 VAL n 1 57 GLN n 1 58 ILE n 1 59 THR n 1 60 PRO n 1 61 ASN n 1 62 GLY n 1 63 ILE n 1 64 GLY n 1 65 LYS n 1 66 SER n 1 67 SER n 1 68 ILE n 1 69 MET n 1 70 ASN n 1 71 GLY n 1 72 LYS n 1 73 TYR n 1 74 LYS n 1 75 VAL n 1 76 ASP n 1 77 LEU n 1 78 PRO n 1 79 SER n 1 80 PHE n 1 81 GLU n 1 82 LEU n 1 83 GLN n 1 84 LEU n 1 85 LYS n 1 86 LEU n 1 87 ASN n 1 88 ILE n 1 89 ILE n 1 90 CYS n 1 91 LYS n 1 92 GLU n 1 93 LYS n 1 94 CYS n 1 95 GLY n 1 96 GLY n 1 97 GLY n 1 98 MET n 1 99 GLY n 1 100 VAL n 1 101 TRP n 1 102 LEU n 1 103 THR n 1 104 GLU n 1 105 GLU n 1 106 LYS n 1 107 LEU n 1 108 LYS n 1 109 GLU n 1 110 GLY n 1 111 ASP n 1 112 LEU n 1 113 PHE n 1 114 GLY n 1 115 ALA n 1 116 TYR n 1 117 ASN n 1 118 ILE n 1 119 TYR n 1 120 LYS n 1 121 GLY n 1 122 ILE n 1 123 GLY n 1 124 ILE n 1 125 PHE n 1 126 ILE n 1 127 ASN n 1 128 PHE n 1 129 GLU n 1 130 ASP n 1 131 VAL n 1 132 ASP n 1 133 ILE n 1 134 PRO n 1 135 MET n 1 136 ILE n 1 137 SER n 1 138 VAL n 1 139 LEU n 1 140 LYS n 1 141 ASN n 1 142 ASP n 1 143 GLY n 1 144 VAL n 1 145 ASP n 1 146 ILE n 1 147 LEU n 1 148 LYS n 1 149 TYR n 1 150 LYS n 1 151 PRO n 1 152 GLU n 1 153 MET n 1 154 TYR n 1 155 TYR n 1 156 GLN n 1 157 CYS n 1 158 SER n 1 159 VAL n 1 160 ALA n 1 161 ASN n 1 162 ILE n 1 163 GLN n 1 164 LYS n 1 165 ASP n 1 166 LYS n 1 167 ASP n 1 168 GLY n 1 169 ALA n 1 170 VAL n 1 171 LEU n 1 172 ARG n 1 173 ILE n 1 174 LYS n 1 175 TYR n 1 176 LEU n 1 177 VAL n 1 178 ASN n 1 179 GLU n 1 180 LYS n 1 181 LYS n 1 182 LEU n 1 183 ILE n 1 184 ILE n 1 185 GLU n 1 186 ILE n 1 187 MET n 1 188 VAL n 1 189 ASN n 1 190 HIS n 1 191 ILE n 1 192 ASN n 1 193 MET n 1 194 ASP n 1 195 CYS n 1 196 ILE n 1 197 THR n 1 198 ILE n 1 199 GLU n 1 200 ASP n 1 201 ILE n 1 202 ASP n 1 203 ILE n 1 204 PRO n 1 205 PRO n 1 206 PHE n 1 207 TYR n 1 208 LEU n 1 209 GLY n 1 210 ILE n 1 211 SER n 1 212 ALA n 1 213 THR n 1 214 ASN n 1 215 GLY n 1 216 GLY n 1 217 SER n 1 218 GLY n 1 219 SER n 1 220 THR n 1 221 SER n 1 222 TYR n 1 223 ARG n 1 224 VAL n 1 225 GLN n 1 226 SER n 1 227 LEU n 1 228 HIS n 1 229 TYR n 1 230 TYR n 1 231 GLU n 1 232 VAL n 1 233 GLY n 1 234 ASN n 1 235 LYS n 1 236 GLU n 1 237 ARG n 1 238 LYS n 1 239 GLU n 1 240 VAL n 1 241 HIS n 1 242 LEU n 1 243 ASN n 1 244 ASN n 1 245 VAL n 1 246 VAL n 1 247 GLU n 1 248 ASN n 1 249 GLU n 1 250 GLN n 1 251 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 251 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EHI7A_000050 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Entamoeba histolytica HM-1:IMSS-A' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 885318 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code N9T8S1_ENTHI _struct_ref.pdbx_db_accession N9T8S1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VVDVLSFREPIEPENVVRNYDMKGPIIVFENYVQITPNGIGKSSIMNGKYKVDLPSFELQLKLNIICKEKCGGGMGVWLT EEKLKEGDLFGAYNIYKGIGIFINFEDVDIPMISVLKNDGVDILKYKPEMYYQCSVANIQKDKDGAVLRIKYLVNEKKLI IEIMVNHINMDCITIEDIDIPPFYLGISATNGGSGSTSYRVQSLHYYEVGNKERKEVHLNNVVENEQI ; _struct_ref.pdbx_align_begin 17 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ZBT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 251 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession N9T8S1 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 244 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 24 _struct_ref_seq.pdbx_auth_seq_align_end 251 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ZBT MET A 1 ? UNP N9T8S1 ? ? 'initiating methionine' 1 1 1 5ZBT GLY A 2 ? UNP N9T8S1 ? ? 'expression tag' 2 2 1 5ZBT SER A 3 ? UNP N9T8S1 ? ? 'expression tag' 3 3 1 5ZBT SER A 4 ? UNP N9T8S1 ? ? 'expression tag' 4 4 1 5ZBT HIS A 5 ? UNP N9T8S1 ? ? 'expression tag' 5 5 1 5ZBT HIS A 6 ? UNP N9T8S1 ? ? 'expression tag' 6 6 1 5ZBT HIS A 7 ? UNP N9T8S1 ? ? 'expression tag' 7 7 1 5ZBT HIS A 8 ? UNP N9T8S1 ? ? 'expression tag' 8 8 1 5ZBT HIS A 9 ? UNP N9T8S1 ? ? 'expression tag' 9 9 1 5ZBT HIS A 10 ? UNP N9T8S1 ? ? 'expression tag' 10 10 1 5ZBT SER A 11 ? UNP N9T8S1 ? ? 'expression tag' 11 11 1 5ZBT SER A 12 ? UNP N9T8S1 ? ? 'expression tag' 12 12 1 5ZBT GLY A 13 ? UNP N9T8S1 ? ? 'expression tag' 13 13 1 5ZBT LEU A 14 ? UNP N9T8S1 ? ? 'expression tag' 14 14 1 5ZBT VAL A 15 ? UNP N9T8S1 ? ? 'expression tag' 15 15 1 5ZBT PRO A 16 ? UNP N9T8S1 ? ? 'expression tag' 16 16 1 5ZBT ARG A 17 ? UNP N9T8S1 ? ? 'expression tag' 17 17 1 5ZBT GLY A 18 ? UNP N9T8S1 ? ? 'expression tag' 18 18 1 5ZBT SER A 19 ? UNP N9T8S1 ? ? 'expression tag' 19 19 1 5ZBT HIS A 20 ? UNP N9T8S1 ? ? 'expression tag' 20 20 1 5ZBT MET A 21 ? UNP N9T8S1 ? ? 'expression tag' 21 21 1 5ZBT ALA A 22 ? UNP N9T8S1 ? ? 'expression tag' 22 22 1 5ZBT SER A 23 ? UNP N9T8S1 ? ? 'expression tag' 23 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZBT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.05 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.10 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method MICROBATCH _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Bis-Tris, pH 6.5, 28%(w/v) PEG monomethyl ether 2000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-11-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 2.28977 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E SUPERBRIGHT' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 2.28977 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5ZBT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 44.93 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10084 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 38.47 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ZBT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.400 _refine.ls_d_res_low 26.594 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9374 _refine.ls_number_reflns_R_free 469 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.15 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1769 _refine.ls_R_factor_R_free 0.2126 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1750 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.02 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1658 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 106 _refine_hist.number_atoms_total 1764 _refine_hist.d_res_high 2.400 _refine_hist.d_res_low 26.594 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1692 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.959 ? 2290 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 6.740 ? 1017 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.061 ? 256 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 293 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3997 2.7466 . . 147 2784 94.00 . . . 0.2471 . 0.1826 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7466 3.4592 . . 158 3002 100.00 . . . 0.2398 . 0.1870 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4592 26.5954 . . 164 3119 100.00 . . . 0.1822 . 0.1647 . . . . . . . . . . # _struct.entry_id 5ZBT _struct.title 'Structure of legume lectin-like domain from Entamoeba histolytica' _struct.pdbx_descriptor 'Vesicular mannose-binding lectin, putative' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZBT _struct_keywords.text 'ERGIC-like, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 35 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 42 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 35 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 42 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 90 SG ? ? ? 1_555 A CYS 94 SG ? ? A CYS 90 A CYS 94 1_555 ? ? ? ? ? ? ? 2.021 ? disulf2 disulf ? ? A CYS 157 SG ? ? ? 1_555 A CYS 195 SG ? ? A CYS 157 A CYS 195 1_555 ? ? ? ? ? ? ? 2.072 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 32 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 32 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 33 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 33 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.28 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 4 ? AA3 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 43 ? LYS A 46 ? TYR A 43 LYS A 46 AA1 2 SER A 66 ? GLY A 71 ? SER A 66 GLY A 71 AA1 3 TYR A 207 ? THR A 213 ? TYR A 207 THR A 213 AA1 4 GLY A 97 ? THR A 103 ? GLY A 97 THR A 103 AA1 5 LYS A 120 ? ASN A 127 ? LYS A 120 ASN A 127 AA1 6 MET A 135 ? ASP A 142 ? MET A 135 ASP A 142 AA1 7 MET A 153 ? SER A 158 ? MET A 153 SER A 158 AA2 1 ILE A 50 ? VAL A 51 ? ILE A 50 VAL A 51 AA2 2 VAL A 56 ? THR A 59 ? VAL A 56 THR A 59 AA2 3 THR A 220 ? GLU A 231 ? THR A 220 GLU A 231 AA2 4 ILE A 89 ? CYS A 90 ? ILE A 89 CYS A 90 AA3 1 ILE A 50 ? VAL A 51 ? ILE A 50 VAL A 51 AA3 2 VAL A 56 ? THR A 59 ? VAL A 56 THR A 59 AA3 3 THR A 220 ? GLU A 231 ? THR A 220 GLU A 231 AA3 4 PHE A 80 ? LEU A 86 ? PHE A 80 LEU A 86 AA3 5 VAL A 170 ? LEU A 176 ? VAL A 170 LEU A 176 AA3 6 LYS A 181 ? VAL A 188 ? LYS A 181 VAL A 188 AA3 7 ILE A 191 ? ILE A 198 ? ILE A 191 ILE A 198 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 44 ? N ASP A 44 O ASN A 70 ? O ASN A 70 AA1 2 3 N MET A 69 ? N MET A 69 O ILE A 210 ? O ILE A 210 AA1 3 4 O SER A 211 ? O SER A 211 N GLY A 99 ? N GLY A 99 AA1 4 5 N VAL A 100 ? N VAL A 100 O ILE A 124 ? O ILE A 124 AA1 5 6 N ASN A 127 ? N ASN A 127 O MET A 135 ? O MET A 135 AA1 6 7 N ILE A 136 ? N ILE A 136 O CYS A 157 ? O CYS A 157 AA2 1 2 N ILE A 50 ? N ILE A 50 O GLN A 57 ? O GLN A 57 AA2 2 3 N VAL A 56 ? N VAL A 56 O VAL A 224 ? O VAL A 224 AA2 3 4 O SER A 221 ? O SER A 221 N ILE A 89 ? N ILE A 89 AA3 1 2 N ILE A 50 ? N ILE A 50 O GLN A 57 ? O GLN A 57 AA3 2 3 N VAL A 56 ? N VAL A 56 O VAL A 224 ? O VAL A 224 AA3 3 4 O TYR A 230 ? O TYR A 230 N GLU A 81 ? N GLU A 81 AA3 4 5 N LEU A 82 ? N LEU A 82 O ILE A 173 ? O ILE A 173 AA3 5 6 N ARG A 172 ? N ARG A 172 O GLU A 185 ? O GLU A 185 AA3 6 7 N ILE A 184 ? N ILE A 184 O ILE A 196 ? O ILE A 196 # _atom_sites.entry_id 5ZBT _atom_sites.fract_transf_matrix[1][1] 0.017841 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017490 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013795 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 GLY 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 VAL 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 SER 19 19 ? ? ? A . n A 1 20 HIS 20 20 ? ? ? A . n A 1 21 MET 21 21 ? ? ? A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 TYR 149 149 149 TYR TYR A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 MET 153 153 153 MET MET A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 CYS 157 157 157 CYS CYS A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 TYR 175 175 175 TYR TYR A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 MET 187 187 187 MET MET A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 HIS 190 190 190 HIS HIS A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 MET 193 193 193 MET MET A . n A 1 194 ASP 194 194 194 ASP ASP A . n A 1 195 CYS 195 195 195 CYS CYS A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 ASP 202 202 202 ASP ASP A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 PHE 206 206 206 PHE PHE A . n A 1 207 TYR 207 207 207 TYR TYR A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 ASN 214 214 214 ASN ASN A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 GLY 216 216 216 GLY GLY A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 THR 220 220 220 THR THR A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 TYR 222 222 222 TYR TYR A . n A 1 223 ARG 223 223 223 ARG ARG A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 GLN 225 225 225 GLN GLN A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 HIS 228 228 228 HIS HIS A . n A 1 229 TYR 229 229 229 TYR TYR A . n A 1 230 TYR 230 230 230 TYR TYR A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 ASN 234 234 ? ? ? A . n A 1 235 LYS 235 235 ? ? ? A . n A 1 236 GLU 236 236 ? ? ? A . n A 1 237 ARG 237 237 ? ? ? A . n A 1 238 LYS 238 238 ? ? ? A . n A 1 239 GLU 239 239 ? ? ? A . n A 1 240 VAL 240 240 ? ? ? A . n A 1 241 HIS 241 241 ? ? ? A . n A 1 242 LEU 242 242 ? ? ? A . n A 1 243 ASN 243 243 ? ? ? A . n A 1 244 ASN 244 244 ? ? ? A . n A 1 245 VAL 245 245 ? ? ? A . n A 1 246 VAL 246 246 ? ? ? A . n A 1 247 GLU 247 247 ? ? ? A . n A 1 248 ASN 248 248 ? ? ? A . n A 1 249 GLU 249 249 ? ? ? A . n A 1 250 GLN 250 250 ? ? ? A . n A 1 251 ILE 251 251 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 304 HOH HOH A . B 2 HOH 2 302 303 HOH HOH A . B 2 HOH 3 303 308 HOH HOH A . B 2 HOH 4 304 326 HOH HOH A . B 2 HOH 5 305 311 HOH HOH A . B 2 HOH 6 306 312 HOH HOH A . B 2 HOH 7 307 305 HOH HOH A . B 2 HOH 8 308 309 HOH HOH A . B 2 HOH 9 309 307 HOH HOH A . B 2 HOH 10 310 301 HOH HOH A . B 2 HOH 11 311 306 HOH HOH A . B 2 HOH 12 312 302 HOH HOH A . B 2 HOH 13 313 313 HOH HOH A . B 2 HOH 14 314 318 HOH HOH A . B 2 HOH 15 315 329 HOH HOH A . B 2 HOH 16 316 310 HOH HOH A . B 2 HOH 17 317 330 HOH HOH A . B 2 HOH 18 318 348 HOH HOH A . B 2 HOH 19 319 315 HOH HOH A . B 2 HOH 20 320 343 HOH HOH A . B 2 HOH 21 321 328 HOH HOH A . B 2 HOH 22 322 356 HOH HOH A . B 2 HOH 23 323 334 HOH HOH A . B 2 HOH 24 324 314 HOH HOH A . B 2 HOH 25 325 339 HOH HOH A . B 2 HOH 26 326 324 HOH HOH A . B 2 HOH 27 327 340 HOH HOH A . B 2 HOH 28 328 317 HOH HOH A . B 2 HOH 29 329 325 HOH HOH A . B 2 HOH 30 330 327 HOH HOH A . B 2 HOH 31 331 336 HOH HOH A . B 2 HOH 32 332 347 HOH HOH A . B 2 HOH 33 333 331 HOH HOH A . B 2 HOH 34 334 332 HOH HOH A . B 2 HOH 35 335 321 HOH HOH A . B 2 HOH 36 336 333 HOH HOH A . B 2 HOH 37 337 320 HOH HOH A . B 2 HOH 38 338 322 HOH HOH A . B 2 HOH 39 339 319 HOH HOH A . B 2 HOH 40 340 335 HOH HOH A . B 2 HOH 41 341 364 HOH HOH A . B 2 HOH 42 342 345 HOH HOH A . B 2 HOH 43 343 323 HOH HOH A . B 2 HOH 44 344 354 HOH HOH A . B 2 HOH 45 345 368 HOH HOH A . B 2 HOH 46 346 316 HOH HOH A . B 2 HOH 47 347 355 HOH HOH A . B 2 HOH 48 348 337 HOH HOH A . B 2 HOH 49 349 360 HOH HOH A . B 2 HOH 50 350 363 HOH HOH A . B 2 HOH 51 351 346 HOH HOH A . B 2 HOH 52 352 344 HOH HOH A . B 2 HOH 53 353 373 HOH HOH A . B 2 HOH 54 354 338 HOH HOH A . B 2 HOH 55 355 382 HOH HOH A . B 2 HOH 56 356 341 HOH HOH A . B 2 HOH 57 357 372 HOH HOH A . B 2 HOH 58 358 352 HOH HOH A . B 2 HOH 59 359 375 HOH HOH A . B 2 HOH 60 360 376 HOH HOH A . B 2 HOH 61 361 359 HOH HOH A . B 2 HOH 62 362 342 HOH HOH A . B 2 HOH 63 363 378 HOH HOH A . B 2 HOH 64 364 367 HOH HOH A . B 2 HOH 65 365 349 HOH HOH A . B 2 HOH 66 366 357 HOH HOH A . B 2 HOH 67 367 351 HOH HOH A . B 2 HOH 68 368 358 HOH HOH A . B 2 HOH 69 369 366 HOH HOH A . B 2 HOH 70 370 362 HOH HOH A . B 2 HOH 71 371 377 HOH HOH A . B 2 HOH 72 372 353 HOH HOH A . B 2 HOH 73 373 387 HOH HOH A . B 2 HOH 74 374 361 HOH HOH A . B 2 HOH 75 375 369 HOH HOH A . B 2 HOH 76 376 365 HOH HOH A . B 2 HOH 77 377 350 HOH HOH A . B 2 HOH 78 378 370 HOH HOH A . B 2 HOH 79 379 389 HOH HOH A . B 2 HOH 80 380 371 HOH HOH A . B 2 HOH 81 381 374 HOH HOH A . B 2 HOH 82 382 379 HOH HOH A . B 2 HOH 83 383 383 HOH HOH A . B 2 HOH 84 384 386 HOH HOH A . B 2 HOH 85 385 380 HOH HOH A . B 2 HOH 86 386 388 HOH HOH A . B 2 HOH 87 387 384 HOH HOH A . B 2 HOH 88 388 391 HOH HOH A . B 2 HOH 89 389 394 HOH HOH A . B 2 HOH 90 390 390 HOH HOH A . B 2 HOH 91 391 381 HOH HOH A . B 2 HOH 92 392 385 HOH HOH A . B 2 HOH 93 393 393 HOH HOH A . B 2 HOH 94 394 392 HOH HOH A . B 2 HOH 95 395 395 HOH HOH A . B 2 HOH 96 396 396 HOH HOH A . B 2 HOH 97 397 398 HOH HOH A . B 2 HOH 98 398 401 HOH HOH A . B 2 HOH 99 399 397 HOH HOH A . B 2 HOH 100 400 400 HOH HOH A . B 2 HOH 101 401 399 HOH HOH A . B 2 HOH 102 402 402 HOH HOH A . B 2 HOH 103 403 403 HOH HOH A . B 2 HOH 104 404 404 HOH HOH A . B 2 HOH 105 405 406 HOH HOH A . B 2 HOH 106 406 405 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9960 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-02-20 2 'Structure model' 1 1 2019-03-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? CRANK2 ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 92 ? ? -120.73 -121.48 2 1 CYS A 195 ? ? -146.63 -67.73 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A VAL 24 ? CG1 ? A VAL 24 CG1 2 1 Y 1 A VAL 24 ? CG2 ? A VAL 24 CG2 3 1 Y 1 A LYS 91 ? CG ? A LYS 91 CG 4 1 Y 1 A LYS 91 ? CD ? A LYS 91 CD 5 1 Y 1 A LYS 91 ? CE ? A LYS 91 CE 6 1 Y 1 A LYS 91 ? NZ ? A LYS 91 NZ 7 1 Y 1 A GLU 92 ? CG ? A GLU 92 CG 8 1 Y 1 A GLU 92 ? CD ? A GLU 92 CD 9 1 Y 1 A GLU 92 ? OE1 ? A GLU 92 OE1 10 1 Y 1 A GLU 92 ? OE2 ? A GLU 92 OE2 11 1 Y 1 A LYS 108 ? CD ? A LYS 108 CD 12 1 Y 1 A LYS 108 ? CE ? A LYS 108 CE 13 1 Y 1 A LYS 108 ? NZ ? A LYS 108 NZ 14 1 Y 1 A LYS 150 ? CD ? A LYS 150 CD 15 1 Y 1 A LYS 150 ? CE ? A LYS 150 CE 16 1 Y 1 A LYS 150 ? NZ ? A LYS 150 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A GLY 13 ? A GLY 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A VAL 15 ? A VAL 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A SER 19 ? A SER 19 20 1 Y 1 A HIS 20 ? A HIS 20 21 1 Y 1 A MET 21 ? A MET 21 22 1 Y 1 A ASN 234 ? A ASN 234 23 1 Y 1 A LYS 235 ? A LYS 235 24 1 Y 1 A GLU 236 ? A GLU 236 25 1 Y 1 A ARG 237 ? A ARG 237 26 1 Y 1 A LYS 238 ? A LYS 238 27 1 Y 1 A GLU 239 ? A GLU 239 28 1 Y 1 A VAL 240 ? A VAL 240 29 1 Y 1 A HIS 241 ? A HIS 241 30 1 Y 1 A LEU 242 ? A LEU 242 31 1 Y 1 A ASN 243 ? A ASN 243 32 1 Y 1 A ASN 244 ? A ASN 244 33 1 Y 1 A VAL 245 ? A VAL 245 34 1 Y 1 A VAL 246 ? A VAL 246 35 1 Y 1 A GLU 247 ? A GLU 247 36 1 Y 1 A ASN 248 ? A ASN 248 37 1 Y 1 A GLU 249 ? A GLU 249 38 1 Y 1 A GLN 250 ? A GLN 250 39 1 Y 1 A ILE 251 ? A ILE 251 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? #