data_5ZKN # _entry.id 5ZKN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZKN pdb_00005zkn 10.2210/pdb5zkn/pdb WWPDB D_1300007191 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-19 2 'Structure model' 1 1 2024-03-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZKN _pdbx_database_status.recvd_initial_deposition_date 2018-03-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Manjunath, L.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr F Struct Biol Commun' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 74 _citation.language ? _citation.page_first 431 _citation.page_last 440 _citation.title ;Crystal structures and kinetic analyses of N-acetylmannosamine-6-phosphate 2-epimerases from Fusobacterium nucleatum and Vibrio cholerae ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X18008543 _citation.pdbx_database_id_PubMed 29969107 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Manjunath, L.' 1 ? primary 'Guntupalli, S.R.' 2 ? primary 'Currie, M.J.' 3 ? primary 'North, R.A.' 4 0000-0001-5011-1567 primary 'Dobson, R.C.J.' 5 ? primary 'Nayak, V.' 6 ? primary 'Subramanian, R.' 7 0000-0002-6709-190X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative N-acetylmannosamine-6-phosphate 2-epimerase' 26928.389 1 5.1.3.9 ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 3 water nat water 18.015 29 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ManNAc-6-P epimerase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHITSLYKKAGFMNKILESIRGKLIVSCQALEDEPLHSSFIMGRMAYAAYSGGAAGIRANTVEDIKEIKKNVSLP IIGIIKKVYNNSDVYITPTIKEVEDLINEGVQIIAIDATKRERPDRKDLKNFIAEIKEKYPNQLFMADISSVDEALYAEK IGFDIVGTTLVGYTDYTKNYKALEELKKVVKVVKIPVIAEGNIDTPLKAKKALEIGAFAVVVGGAITRPQQITKKFVDEM K ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHITSLYKKAGFMNKILESIRGKLIVSCQALEDEPLHSSFIMGRMAYAAYSGGAAGIRANTVEDIKEIKKNVSLP IIGIIKKVYNNSDVYITPTIKEVEDLINEGVQIIAIDATKRERPDRKDLKNFIAEIKEKYPNQLFMADISSVDEALYAEK IGFDIVGTTLVGYTDYTKNYKALEELKKVVKVVKIPVIAEGNIDTPLKAKKALEIGAFAVVVGGAITRPQQITKKFVDEM K ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 ILE n 1 9 THR n 1 10 SER n 1 11 LEU n 1 12 TYR n 1 13 LYS n 1 14 LYS n 1 15 ALA n 1 16 GLY n 1 17 PHE n 1 18 MET n 1 19 ASN n 1 20 LYS n 1 21 ILE n 1 22 LEU n 1 23 GLU n 1 24 SER n 1 25 ILE n 1 26 ARG n 1 27 GLY n 1 28 LYS n 1 29 LEU n 1 30 ILE n 1 31 VAL n 1 32 SER n 1 33 CYS n 1 34 GLN n 1 35 ALA n 1 36 LEU n 1 37 GLU n 1 38 ASP n 1 39 GLU n 1 40 PRO n 1 41 LEU n 1 42 HIS n 1 43 SER n 1 44 SER n 1 45 PHE n 1 46 ILE n 1 47 MET n 1 48 GLY n 1 49 ARG n 1 50 MET n 1 51 ALA n 1 52 TYR n 1 53 ALA n 1 54 ALA n 1 55 TYR n 1 56 SER n 1 57 GLY n 1 58 GLY n 1 59 ALA n 1 60 ALA n 1 61 GLY n 1 62 ILE n 1 63 ARG n 1 64 ALA n 1 65 ASN n 1 66 THR n 1 67 VAL n 1 68 GLU n 1 69 ASP n 1 70 ILE n 1 71 LYS n 1 72 GLU n 1 73 ILE n 1 74 LYS n 1 75 LYS n 1 76 ASN n 1 77 VAL n 1 78 SER n 1 79 LEU n 1 80 PRO n 1 81 ILE n 1 82 ILE n 1 83 GLY n 1 84 ILE n 1 85 ILE n 1 86 LYS n 1 87 LYS n 1 88 VAL n 1 89 TYR n 1 90 ASN n 1 91 ASN n 1 92 SER n 1 93 ASP n 1 94 VAL n 1 95 TYR n 1 96 ILE n 1 97 THR n 1 98 PRO n 1 99 THR n 1 100 ILE n 1 101 LYS n 1 102 GLU n 1 103 VAL n 1 104 GLU n 1 105 ASP n 1 106 LEU n 1 107 ILE n 1 108 ASN n 1 109 GLU n 1 110 GLY n 1 111 VAL n 1 112 GLN n 1 113 ILE n 1 114 ILE n 1 115 ALA n 1 116 ILE n 1 117 ASP n 1 118 ALA n 1 119 THR n 1 120 LYS n 1 121 ARG n 1 122 GLU n 1 123 ARG n 1 124 PRO n 1 125 ASP n 1 126 ARG n 1 127 LYS n 1 128 ASP n 1 129 LEU n 1 130 LYS n 1 131 ASN n 1 132 PHE n 1 133 ILE n 1 134 ALA n 1 135 GLU n 1 136 ILE n 1 137 LYS n 1 138 GLU n 1 139 LYS n 1 140 TYR n 1 141 PRO n 1 142 ASN n 1 143 GLN n 1 144 LEU n 1 145 PHE n 1 146 MET n 1 147 ALA n 1 148 ASP n 1 149 ILE n 1 150 SER n 1 151 SER n 1 152 VAL n 1 153 ASP n 1 154 GLU n 1 155 ALA n 1 156 LEU n 1 157 TYR n 1 158 ALA n 1 159 GLU n 1 160 LYS n 1 161 ILE n 1 162 GLY n 1 163 PHE n 1 164 ASP n 1 165 ILE n 1 166 VAL n 1 167 GLY n 1 168 THR n 1 169 THR n 1 170 LEU n 1 171 VAL n 1 172 GLY n 1 173 TYR n 1 174 THR n 1 175 ASP n 1 176 TYR n 1 177 THR n 1 178 LYS n 1 179 ASN n 1 180 TYR n 1 181 LYS n 1 182 ALA n 1 183 LEU n 1 184 GLU n 1 185 GLU n 1 186 LEU n 1 187 LYS n 1 188 LYS n 1 189 VAL n 1 190 VAL n 1 191 LYS n 1 192 VAL n 1 193 VAL n 1 194 LYS n 1 195 ILE n 1 196 PRO n 1 197 VAL n 1 198 ILE n 1 199 ALA n 1 200 GLU n 1 201 GLY n 1 202 ASN n 1 203 ILE n 1 204 ASP n 1 205 THR n 1 206 PRO n 1 207 LEU n 1 208 LYS n 1 209 ALA n 1 210 LYS n 1 211 LYS n 1 212 ALA n 1 213 LEU n 1 214 GLU n 1 215 ILE n 1 216 GLY n 1 217 ALA n 1 218 PHE n 1 219 ALA n 1 220 VAL n 1 221 VAL n 1 222 VAL n 1 223 GLY n 1 224 GLY n 1 225 ALA n 1 226 ILE n 1 227 THR n 1 228 ARG n 1 229 PRO n 1 230 GLN n 1 231 GLN n 1 232 ILE n 1 233 THR n 1 234 LYS n 1 235 LYS n 1 236 PHE n 1 237 VAL n 1 238 ASP n 1 239 GLU n 1 240 MET n 1 241 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 241 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nanE, FN1476' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 25586' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Fusobacterium nucleatum subsp. nucleatum ATCC 25586' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 190304 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -16 ? ? ? A . n A 1 2 HIS 2 -15 ? ? ? A . n A 1 3 HIS 3 -14 ? ? ? A . n A 1 4 HIS 4 -13 ? ? ? A . n A 1 5 HIS 5 -12 ? ? ? A . n A 1 6 HIS 6 -11 ? ? ? A . n A 1 7 HIS 7 -10 ? ? ? A . n A 1 8 ILE 8 -9 ? ? ? A . n A 1 9 THR 9 -8 ? ? ? A . n A 1 10 SER 10 -7 ? ? ? A . n A 1 11 LEU 11 -6 ? ? ? A . n A 1 12 TYR 12 -5 ? ? ? A . n A 1 13 LYS 13 -4 ? ? ? A . n A 1 14 LYS 14 -3 ? ? ? A . n A 1 15 ALA 15 -2 ? ? ? A . n A 1 16 GLY 16 -1 ? ? ? A . n A 1 17 PHE 17 0 0 PHE PHE A . n A 1 18 MET 18 1 1 MET MET A . n A 1 19 ASN 19 2 2 ASN ASN A . n A 1 20 LYS 20 3 3 LYS LYS A . n A 1 21 ILE 21 4 4 ILE ILE A . n A 1 22 LEU 22 5 5 LEU LEU A . n A 1 23 GLU 23 6 6 GLU GLU A . n A 1 24 SER 24 7 7 SER SER A . n A 1 25 ILE 25 8 8 ILE ILE A . n A 1 26 ARG 26 9 9 ARG ARG A . n A 1 27 GLY 27 10 10 GLY GLY A . n A 1 28 LYS 28 11 11 LYS LYS A . n A 1 29 LEU 29 12 12 LEU LEU A . n A 1 30 ILE 30 13 13 ILE ILE A . n A 1 31 VAL 31 14 14 VAL VAL A . n A 1 32 SER 32 15 15 SER SER A . n A 1 33 CYS 33 16 16 CYS CYS A . n A 1 34 GLN 34 17 17 GLN GLN A . n A 1 35 ALA 35 18 18 ALA ALA A . n A 1 36 LEU 36 19 19 LEU LEU A . n A 1 37 GLU 37 20 20 GLU GLU A . n A 1 38 ASP 38 21 21 ASP ASP A . n A 1 39 GLU 39 22 22 GLU GLU A . n A 1 40 PRO 40 23 23 PRO PRO A . n A 1 41 LEU 41 24 24 LEU LEU A . n A 1 42 HIS 42 25 25 HIS HIS A . n A 1 43 SER 43 26 26 SER SER A . n A 1 44 SER 44 27 27 SER SER A . n A 1 45 PHE 45 28 28 PHE PHE A . n A 1 46 ILE 46 29 29 ILE ILE A . n A 1 47 MET 47 30 30 MET MET A . n A 1 48 GLY 48 31 31 GLY GLY A . n A 1 49 ARG 49 32 32 ARG ARG A . n A 1 50 MET 50 33 33 MET MET A . n A 1 51 ALA 51 34 34 ALA ALA A . n A 1 52 TYR 52 35 35 TYR TYR A . n A 1 53 ALA 53 36 36 ALA ALA A . n A 1 54 ALA 54 37 37 ALA ALA A . n A 1 55 TYR 55 38 38 TYR TYR A . n A 1 56 SER 56 39 39 SER SER A . n A 1 57 GLY 57 40 40 GLY GLY A . n A 1 58 GLY 58 41 41 GLY GLY A . n A 1 59 ALA 59 42 42 ALA ALA A . n A 1 60 ALA 60 43 43 ALA ALA A . n A 1 61 GLY 61 44 44 GLY GLY A . n A 1 62 ILE 62 45 45 ILE ILE A . n A 1 63 ARG 63 46 46 ARG ARG A . n A 1 64 ALA 64 47 47 ALA ALA A . n A 1 65 ASN 65 48 48 ASN ASN A . n A 1 66 THR 66 49 49 THR THR A . n A 1 67 VAL 67 50 50 VAL VAL A . n A 1 68 GLU 68 51 51 GLU GLU A . n A 1 69 ASP 69 52 52 ASP ASP A . n A 1 70 ILE 70 53 53 ILE ILE A . n A 1 71 LYS 71 54 54 LYS LYS A . n A 1 72 GLU 72 55 55 GLU GLU A . n A 1 73 ILE 73 56 56 ILE ILE A . n A 1 74 LYS 74 57 57 LYS LYS A . n A 1 75 LYS 75 58 58 LYS LYS A . n A 1 76 ASN 76 59 59 ASN ASN A . n A 1 77 VAL 77 60 60 VAL VAL A . n A 1 78 SER 78 61 61 SER SER A . n A 1 79 LEU 79 62 62 LEU LEU A . n A 1 80 PRO 80 63 63 PRO PRO A . n A 1 81 ILE 81 64 64 ILE ILE A . n A 1 82 ILE 82 65 65 ILE ILE A . n A 1 83 GLY 83 66 66 GLY GLY A . n A 1 84 ILE 84 67 67 ILE ILE A . n A 1 85 ILE 85 68 68 ILE ILE A . n A 1 86 LYS 86 69 69 LYS LYS A . n A 1 87 LYS 87 70 70 LYS LYS A . n A 1 88 VAL 88 71 71 VAL VAL A . n A 1 89 TYR 89 72 72 TYR TYR A . n A 1 90 ASN 90 73 73 ASN ASN A . n A 1 91 ASN 91 74 74 ASN ASN A . n A 1 92 SER 92 75 75 SER SER A . n A 1 93 ASP 93 76 76 ASP ASP A . n A 1 94 VAL 94 77 77 VAL VAL A . n A 1 95 TYR 95 78 78 TYR TYR A . n A 1 96 ILE 96 79 79 ILE ILE A . n A 1 97 THR 97 80 80 THR THR A . n A 1 98 PRO 98 81 81 PRO PRO A . n A 1 99 THR 99 82 82 THR THR A . n A 1 100 ILE 100 83 83 ILE ILE A . n A 1 101 LYS 101 84 84 LYS LYS A . n A 1 102 GLU 102 85 85 GLU GLU A . n A 1 103 VAL 103 86 86 VAL VAL A . n A 1 104 GLU 104 87 87 GLU GLU A . n A 1 105 ASP 105 88 88 ASP ASP A . n A 1 106 LEU 106 89 89 LEU LEU A . n A 1 107 ILE 107 90 90 ILE ILE A . n A 1 108 ASN 108 91 91 ASN ASN A . n A 1 109 GLU 109 92 92 GLU GLU A . n A 1 110 GLY 110 93 93 GLY GLY A . n A 1 111 VAL 111 94 94 VAL VAL A . n A 1 112 GLN 112 95 95 GLN GLN A . n A 1 113 ILE 113 96 96 ILE ILE A . n A 1 114 ILE 114 97 97 ILE ILE A . n A 1 115 ALA 115 98 98 ALA ALA A . n A 1 116 ILE 116 99 99 ILE ILE A . n A 1 117 ASP 117 100 100 ASP ASP A . n A 1 118 ALA 118 101 101 ALA ALA A . n A 1 119 THR 119 102 102 THR THR A . n A 1 120 LYS 120 103 103 LYS LYS A . n A 1 121 ARG 121 104 104 ARG ARG A . n A 1 122 GLU 122 105 105 GLU GLU A . n A 1 123 ARG 123 106 106 ARG ARG A . n A 1 124 PRO 124 107 107 PRO PRO A . n A 1 125 ASP 125 108 108 ASP ASP A . n A 1 126 ARG 126 109 109 ARG ARG A . n A 1 127 LYS 127 110 110 LYS LYS A . n A 1 128 ASP 128 111 111 ASP ASP A . n A 1 129 LEU 129 112 112 LEU LEU A . n A 1 130 LYS 130 113 113 LYS LYS A . n A 1 131 ASN 131 114 114 ASN ASN A . n A 1 132 PHE 132 115 115 PHE PHE A . n A 1 133 ILE 133 116 116 ILE ILE A . n A 1 134 ALA 134 117 117 ALA ALA A . n A 1 135 GLU 135 118 118 GLU GLU A . n A 1 136 ILE 136 119 119 ILE ILE A . n A 1 137 LYS 137 120 120 LYS LYS A . n A 1 138 GLU 138 121 121 GLU GLU A . n A 1 139 LYS 139 122 122 LYS LYS A . n A 1 140 TYR 140 123 123 TYR TYR A . n A 1 141 PRO 141 124 124 PRO PRO A . n A 1 142 ASN 142 125 125 ASN ASN A . n A 1 143 GLN 143 126 126 GLN GLN A . n A 1 144 LEU 144 127 127 LEU LEU A . n A 1 145 PHE 145 128 128 PHE PHE A . n A 1 146 MET 146 129 129 MET MET A . n A 1 147 ALA 147 130 130 ALA ALA A . n A 1 148 ASP 148 131 131 ASP ASP A . n A 1 149 ILE 149 132 132 ILE ILE A . n A 1 150 SER 150 133 133 SER SER A . n A 1 151 SER 151 134 134 SER SER A . n A 1 152 VAL 152 135 135 VAL VAL A . n A 1 153 ASP 153 136 136 ASP ASP A . n A 1 154 GLU 154 137 137 GLU GLU A . n A 1 155 ALA 155 138 138 ALA ALA A . n A 1 156 LEU 156 139 139 LEU LEU A . n A 1 157 TYR 157 140 140 TYR TYR A . n A 1 158 ALA 158 141 141 ALA ALA A . n A 1 159 GLU 159 142 142 GLU GLU A . n A 1 160 LYS 160 143 143 LYS LYS A . n A 1 161 ILE 161 144 144 ILE ILE A . n A 1 162 GLY 162 145 145 GLY GLY A . n A 1 163 PHE 163 146 146 PHE PHE A . n A 1 164 ASP 164 147 147 ASP ASP A . n A 1 165 ILE 165 148 148 ILE ILE A . n A 1 166 VAL 166 149 149 VAL VAL A . n A 1 167 GLY 167 150 150 GLY GLY A . n A 1 168 THR 168 151 151 THR THR A . n A 1 169 THR 169 152 152 THR THR A . n A 1 170 LEU 170 153 153 LEU LEU A . n A 1 171 VAL 171 154 154 VAL VAL A . n A 1 172 GLY 172 155 155 GLY GLY A . n A 1 173 TYR 173 156 156 TYR TYR A . n A 1 174 THR 174 157 157 THR THR A . n A 1 175 ASP 175 158 158 ASP ASP A . n A 1 176 TYR 176 159 159 TYR TYR A . n A 1 177 THR 177 160 160 THR THR A . n A 1 178 LYS 178 161 161 LYS LYS A . n A 1 179 ASN 179 162 162 ASN ASN A . n A 1 180 TYR 180 163 163 TYR TYR A . n A 1 181 LYS 181 164 164 LYS LYS A . n A 1 182 ALA 182 165 165 ALA ALA A . n A 1 183 LEU 183 166 166 LEU LEU A . n A 1 184 GLU 184 167 167 GLU GLU A . n A 1 185 GLU 185 168 168 GLU GLU A . n A 1 186 LEU 186 169 169 LEU LEU A . n A 1 187 LYS 187 170 170 LYS LYS A . n A 1 188 LYS 188 171 171 LYS LYS A . n A 1 189 VAL 189 172 172 VAL VAL A . n A 1 190 VAL 190 173 173 VAL VAL A . n A 1 191 LYS 191 174 174 LYS LYS A . n A 1 192 VAL 192 175 175 VAL VAL A . n A 1 193 VAL 193 176 176 VAL VAL A . n A 1 194 LYS 194 177 177 LYS LYS A . n A 1 195 ILE 195 178 178 ILE ILE A . n A 1 196 PRO 196 179 179 PRO PRO A . n A 1 197 VAL 197 180 180 VAL VAL A . n A 1 198 ILE 198 181 181 ILE ILE A . n A 1 199 ALA 199 182 182 ALA ALA A . n A 1 200 GLU 200 183 183 GLU GLU A . n A 1 201 GLY 201 184 184 GLY GLY A . n A 1 202 ASN 202 185 185 ASN ASN A . n A 1 203 ILE 203 186 186 ILE ILE A . n A 1 204 ASP 204 187 187 ASP ASP A . n A 1 205 THR 205 188 188 THR THR A . n A 1 206 PRO 206 189 189 PRO PRO A . n A 1 207 LEU 207 190 190 LEU LEU A . n A 1 208 LYS 208 191 191 LYS LYS A . n A 1 209 ALA 209 192 192 ALA ALA A . n A 1 210 LYS 210 193 193 LYS LYS A . n A 1 211 LYS 211 194 194 LYS LYS A . n A 1 212 ALA 212 195 195 ALA ALA A . n A 1 213 LEU 213 196 196 LEU LEU A . n A 1 214 GLU 214 197 197 GLU GLU A . n A 1 215 ILE 215 198 198 ILE ILE A . n A 1 216 GLY 216 199 199 GLY GLY A . n A 1 217 ALA 217 200 200 ALA ALA A . n A 1 218 PHE 218 201 201 PHE PHE A . n A 1 219 ALA 219 202 202 ALA ALA A . n A 1 220 VAL 220 203 203 VAL VAL A . n A 1 221 VAL 221 204 204 VAL VAL A . n A 1 222 VAL 222 205 205 VAL VAL A . n A 1 223 GLY 223 206 206 GLY GLY A . n A 1 224 GLY 224 207 207 GLY GLY A . n A 1 225 ALA 225 208 208 ALA ALA A . n A 1 226 ILE 226 209 209 ILE ILE A . n A 1 227 THR 227 210 210 THR THR A . n A 1 228 ARG 228 211 211 ARG ARG A . n A 1 229 PRO 229 212 212 PRO PRO A . n A 1 230 GLN 230 213 213 GLN GLN A . n A 1 231 GLN 231 214 214 GLN GLN A . n A 1 232 ILE 232 215 215 ILE ILE A . n A 1 233 THR 233 216 216 THR THR A . n A 1 234 LYS 234 217 217 LYS LYS A . n A 1 235 LYS 235 218 218 LYS LYS A . n A 1 236 PHE 236 219 219 PHE PHE A . n A 1 237 VAL 237 220 220 VAL VAL A . n A 1 238 ASP 238 221 221 ASP ASP A . n A 1 239 GLU 239 222 222 GLU GLU A . n A 1 240 MET 240 223 223 MET MET A . n A 1 241 LYS 241 224 224 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 301 1 CL CL A . C 2 CL 1 302 2 CL CL A . D 3 HOH 1 401 22 HOH HOH A . D 3 HOH 2 402 14 HOH HOH A . D 3 HOH 3 403 15 HOH HOH A . D 3 HOH 4 404 11 HOH HOH A . D 3 HOH 5 405 10 HOH HOH A . D 3 HOH 6 406 19 HOH HOH A . D 3 HOH 7 407 13 HOH HOH A . D 3 HOH 8 408 4 HOH HOH A . D 3 HOH 9 409 16 HOH HOH A . D 3 HOH 10 410 20 HOH HOH A . D 3 HOH 11 411 23 HOH HOH A . D 3 HOH 12 412 9 HOH HOH A . D 3 HOH 13 413 29 HOH HOH A . D 3 HOH 14 414 1 HOH HOH A . D 3 HOH 15 415 5 HOH HOH A . D 3 HOH 16 416 21 HOH HOH A . D 3 HOH 17 417 17 HOH HOH A . D 3 HOH 18 418 7 HOH HOH A . D 3 HOH 19 419 3 HOH HOH A . D 3 HOH 20 420 6 HOH HOH A . D 3 HOH 21 421 8 HOH HOH A . D 3 HOH 22 422 2 HOH HOH A . D 3 HOH 23 423 12 HOH HOH A . D 3 HOH 24 424 18 HOH HOH A . D 3 HOH 25 425 26 HOH HOH A . D 3 HOH 26 426 27 HOH HOH A . D 3 HOH 27 427 24 HOH HOH A . D 3 HOH 28 428 28 HOH HOH A . D 3 HOH 29 429 25 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 109 ? CG ? A ARG 126 CG 2 1 Y 1 A ARG 109 ? CD ? A ARG 126 CD 3 1 Y 1 A ARG 109 ? NE ? A ARG 126 NE 4 1 Y 1 A ARG 109 ? CZ ? A ARG 126 CZ 5 1 Y 1 A ARG 109 ? NH1 ? A ARG 126 NH1 6 1 Y 1 A ARG 109 ? NH2 ? A ARG 126 NH2 7 1 Y 1 A LYS 113 ? CG ? A LYS 130 CG 8 1 Y 1 A LYS 113 ? CD ? A LYS 130 CD 9 1 Y 1 A LYS 113 ? CE ? A LYS 130 CE 10 1 Y 1 A LYS 113 ? NZ ? A LYS 130 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.29 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.length_a 47.515 _cell.length_b 75.347 _cell.length_c 135.882 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 5ZKN _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.entry_id 5ZKN _symmetry.Int_Tables_number 23 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZKN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.42 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG 3350, 0,1M MES pH5.2, 0.4M MgCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-09-29 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9786 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9786 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.entry_id 5ZKN _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 44.850 _reflns.d_resolution_high 2.210 _reflns.number_obs 12687 _reflns.number_all ? _reflns.percent_possible_obs 99.900 _reflns.pdbx_Rmerge_I_obs 0.070 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.500 _reflns.B_iso_Wilson_estimate 49.380 _reflns.pdbx_redundancy 6.400 _reflns.pdbx_Rrim_I_all 0.076 _reflns.pdbx_Rpim_I_all 0.030 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_number_measured_all 80912 _reflns.pdbx_scaling_rejects 10 _reflns.pdbx_chi_squared ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.details ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 2.210 2.270 ? 6997 1086 ? 0.700 ? ? ? 6.400 ? 2.800 ? ? ? ? ? ? 99.000 0.761 0.297 0.783 1 2 9.090 44.850 ? 1075 213 ? 0.044 ? ? ? 5.000 ? 32.400 ? ? ? ? ? ? 98.400 0.048 0.020 0.997 # _refine.entry_id 5ZKN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.2050 _refine.ls_d_res_low 38.8200 _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.7500 _refine.ls_number_reflns_obs 12678 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1856 _refine.ls_R_factor_R_work 0.1830 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2326 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0800 _refine.ls_number_reflns_R_free 644 _refine.ls_number_reflns_R_work 12034 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 66.5271 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.2900 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 153.110 _refine.B_iso_min 32.310 _refine.pdbx_overall_phase_error 27.4200 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.2050 _refine_hist.d_res_low 38.8200 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 29 _refine_hist.number_atoms_total 1776 _refine_hist.pdbx_number_residues_total 225 _refine_hist.pdbx_B_iso_mean_ligand 80.76 _refine_hist.pdbx_B_iso_mean_solvent 54.64 _refine_hist.pdbx_number_atoms_protein 1745 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 1769 0.009 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 2386 0.905 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 283 0.068 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 301 0.006 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 1097 15.557 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id 2.2052 2.3755 5 99.0000 2360 . 0.2684 0.3290 . 119 0.0000 2479 . 'X-RAY DIFFRACTION' 2.3755 2.6145 5 100.0000 2359 . 0.2324 0.2566 . 134 0.0000 2493 . 'X-RAY DIFFRACTION' 2.6145 2.9927 5 100.0000 2392 . 0.2161 0.2970 . 133 0.0000 2525 . 'X-RAY DIFFRACTION' 2.9927 3.7700 5 100.0000 2395 . 0.1907 0.2607 . 134 0.0000 2529 . 'X-RAY DIFFRACTION' 3.7700 38.8258 5 100.0000 2528 . 0.1539 0.1866 . 124 0.0000 2652 . 'X-RAY DIFFRACTION' # _struct.entry_id 5ZKN _struct.title 'Structure of N-acetylmannosamine-6-phosphate 2-epimerase from Fusobacterium nucleatum' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZKN _struct_keywords.text 'Sialic acid catabolic pathway Epimerase, ISOMERASE' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NANE_FUSNN _struct_ref.pdbx_db_accession Q8RDN5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNKILESIRGKLIVSCQALEDEPLHSSFIMGRMAYAAYSGGAAGIRANTVEDIKEIKKNVSLPIIGIIKKVYNNSDVYIT PTIKEVEDLINEGVQIIAIDATKRERPDRKDLKNFIAEIKEKYPNQLFMADISSVDEALYAEKIGFDIVGTTLVGYTDYT KNYKALEELKKVVKVVKIPVIAEGNIDTPLKAKKALEIGAFAVVVGGAITRPQQITKKFVDEMK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ZKN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 18 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 241 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8RDN5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 224 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 224 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ZKN MET A 1 ? UNP Q8RDN5 ? ? 'expression tag' -16 1 1 5ZKN HIS A 2 ? UNP Q8RDN5 ? ? 'expression tag' -15 2 1 5ZKN HIS A 3 ? UNP Q8RDN5 ? ? 'expression tag' -14 3 1 5ZKN HIS A 4 ? UNP Q8RDN5 ? ? 'expression tag' -13 4 1 5ZKN HIS A 5 ? UNP Q8RDN5 ? ? 'expression tag' -12 5 1 5ZKN HIS A 6 ? UNP Q8RDN5 ? ? 'expression tag' -11 6 1 5ZKN HIS A 7 ? UNP Q8RDN5 ? ? 'expression tag' -10 7 1 5ZKN ILE A 8 ? UNP Q8RDN5 ? ? 'expression tag' -9 8 1 5ZKN THR A 9 ? UNP Q8RDN5 ? ? 'expression tag' -8 9 1 5ZKN SER A 10 ? UNP Q8RDN5 ? ? 'expression tag' -7 10 1 5ZKN LEU A 11 ? UNP Q8RDN5 ? ? 'expression tag' -6 11 1 5ZKN TYR A 12 ? UNP Q8RDN5 ? ? 'expression tag' -5 12 1 5ZKN LYS A 13 ? UNP Q8RDN5 ? ? 'expression tag' -4 13 1 5ZKN LYS A 14 ? UNP Q8RDN5 ? ? 'expression tag' -3 14 1 5ZKN ALA A 15 ? UNP Q8RDN5 ? ? 'expression tag' -2 15 1 5ZKN GLY A 16 ? UNP Q8RDN5 ? ? 'expression tag' -1 16 1 5ZKN PHE A 17 ? UNP Q8RDN5 ? ? 'expression tag' 0 17 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3880 ? 1 MORE -75 ? 1 'SSA (A^2)' 19090 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 17 ? SER A 24 ? PHE A 0 SER A 7 1 ? 8 HELX_P HELX_P2 AA2 SER A 43 ? GLY A 58 ? SER A 26 GLY A 41 1 ? 16 HELX_P HELX_P3 AA3 THR A 66 ? VAL A 77 ? THR A 49 VAL A 60 1 ? 12 HELX_P HELX_P4 AA4 THR A 99 ? GLY A 110 ? THR A 82 GLY A 93 1 ? 12 HELX_P HELX_P5 AA5 ASP A 128 ? TYR A 140 ? ASP A 111 TYR A 123 1 ? 13 HELX_P HELX_P6 AA6 SER A 151 ? ILE A 161 ? SER A 134 ILE A 144 1 ? 11 HELX_P HELX_P7 AA7 THR A 174 ? LYS A 178 ? THR A 157 LYS A 161 5 ? 5 HELX_P HELX_P8 AA8 LYS A 181 ? VAL A 193 ? LYS A 164 VAL A 176 1 ? 13 HELX_P HELX_P9 AA9 THR A 205 ? GLY A 216 ? THR A 188 GLY A 199 1 ? 12 HELX_P HELX_P10 AB1 GLY A 223 ? ARG A 228 ? GLY A 206 ARG A 211 1 ? 6 HELX_P HELX_P11 AB2 ARG A 228 ? MET A 240 ? ARG A 211 MET A 223 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 29 ? CYS A 33 ? LEU A 12 CYS A 16 AA1 2 GLY A 61 ? ASN A 65 ? GLY A 44 ASN A 48 AA1 3 ILE A 81 ? ILE A 84 ? ILE A 64 ILE A 67 AA1 4 ILE A 113 ? ASP A 117 ? ILE A 96 ASP A 100 AA1 5 LEU A 144 ? ASP A 148 ? LEU A 127 ASP A 131 AA1 6 ILE A 165 ? GLY A 167 ? ILE A 148 GLY A 150 AA1 7 VAL A 197 ? GLU A 200 ? VAL A 180 GLU A 183 AA1 8 ALA A 219 ? VAL A 222 ? ALA A 202 VAL A 205 AA1 9 LEU A 29 ? CYS A 33 ? LEU A 12 CYS A 16 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N CYS A 33 ? N CYS A 16 O ARG A 63 ? O ARG A 46 AA1 2 3 N ILE A 62 ? N ILE A 45 O ILE A 82 ? O ILE A 65 AA1 3 4 N GLY A 83 ? N GLY A 66 O ILE A 113 ? O ILE A 96 AA1 4 5 N ILE A 114 ? N ILE A 97 O MET A 146 ? O MET A 129 AA1 5 6 N ALA A 147 ? N ALA A 130 O GLY A 167 ? O GLY A 150 AA1 6 7 N VAL A 166 ? N VAL A 149 O ILE A 198 ? O ILE A 181 AA1 7 8 N ALA A 199 ? N ALA A 182 O VAL A 221 ? O VAL A 204 AA1 8 9 O VAL A 220 ? O VAL A 203 N ILE A 30 ? N ILE A 13 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 301 ? 3 'binding site for residue CL A 301' AC2 Software A CL 302 ? 1 'binding site for residue CL A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 GLN A 34 ? GLN A 17 . ? 1_555 ? 2 AC1 3 ARG A 63 ? ARG A 46 . ? 1_555 ? 3 AC1 3 LYS A 86 ? LYS A 69 . ? 1_555 ? 4 AC2 1 TYR A 95 ? TYR A 78 . ? 1_555 ? # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 ASP _pdbx_validate_rmsd_bond.auth_seq_id_1 21 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 N _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 22 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.479 _pdbx_validate_rmsd_bond.bond_target_value 1.336 _pdbx_validate_rmsd_bond.bond_deviation 0.143 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.023 _pdbx_validate_rmsd_bond.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 19 ? ? -68.21 -176.41 2 1 SER A 26 ? ? 171.60 125.87 3 1 THR A 49 ? ? 74.48 153.36 4 1 THR A 80 ? ? 39.27 60.05 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -10.3376 -5.7435 -12.9457 0.3942 0.3836 0.2673 0.0222 0.0742 -0.0310 8.1858 3.9789 4.1593 1.2063 2.0319 0.5359 -0.1202 -0.0727 0.1599 -0.1681 -0.2193 0.2826 0.2140 0.0525 -0.1170 'X-RAY DIFFRACTION' 2 ? refined -12.2208 -21.3491 -15.2061 0.3857 0.4391 0.7283 0.0280 0.0740 -0.0535 4.1770 4.2364 3.5931 0.1329 -0.6278 0.6865 -0.1941 0.0032 0.1712 0.1475 -1.4022 0.4579 0.1837 0.6287 0.0453 'X-RAY DIFFRACTION' 3 ? refined -11.5155 -10.4690 -27.0406 0.3826 0.6461 0.4547 0.0360 0.0182 -0.1429 8.9095 6.3504 6.2030 5.0530 3.2937 2.5360 -0.2417 0.2562 -0.0209 1.0285 -0.7316 0.0121 -0.3681 -0.0528 0.1771 'X-RAY DIFFRACTION' 4 ? refined 9.2682 -2.8216 -23.9580 0.5267 0.5912 0.3573 0.0571 0.0331 -0.1116 4.1740 6.5117 4.6035 3.7097 -4.3867 -3.8073 -0.6477 0.2380 0.3910 1.2856 -0.9948 -0.8194 -0.8269 0.8632 -0.7440 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 40 ;chain 'A' and (resid 1 through 40 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 41 A 173 ;chain 'A' and (resid 41 through 173 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 174 A 211 ;chain 'A' and (resid 174 through 211 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 212 A 224 ;chain 'A' and (resid 212 through 224 ) ; ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -16 ? A MET 1 2 1 Y 1 A HIS -15 ? A HIS 2 3 1 Y 1 A HIS -14 ? A HIS 3 4 1 Y 1 A HIS -13 ? A HIS 4 5 1 Y 1 A HIS -12 ? A HIS 5 6 1 Y 1 A HIS -11 ? A HIS 6 7 1 Y 1 A HIS -10 ? A HIS 7 8 1 Y 1 A ILE -9 ? A ILE 8 9 1 Y 1 A THR -8 ? A THR 9 10 1 Y 1 A SER -7 ? A SER 10 11 1 Y 1 A LEU -6 ? A LEU 11 12 1 Y 1 A TYR -5 ? A TYR 12 13 1 Y 1 A LYS -4 ? A LYS 13 14 1 Y 1 A LYS -3 ? A LYS 14 15 1 Y 1 A ALA -2 ? A ALA 15 16 1 Y 1 A GLY -1 ? A GLY 16 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal ? India DBT/IN/SWEDEN/41/SR/2013 1 ? ? BT/PR5081/INF/156/2012 2 ? ? BT/PR12422/MED/31/287/214 3 # _atom_sites.entry_id 5ZKN _atom_sites.fract_transf_matrix[1][1] 0.021046 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013272 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007359 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL H MG N O S # loop_