data_5ZNG # _entry.id 5ZNG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZNG pdb_00005zng 10.2210/pdb5zng/pdb WWPDB D_1300007392 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZNG _pdbx_database_status.recvd_initial_deposition_date 2018-04-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Guo, L.W.' 1 ? 'Zhang, Y.K.' 2 ? 'Liu, Q.' 3 ? 'Ma, M.Q.' 4 ? 'Liu, J.F.' 5 ? 'Peng, Y.L.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 115 _citation.language ? _citation.page_first 11637 _citation.page_last 11642 _citation.title 'Specific recognition of two MAX effectors by integrated HMA domains in plant immune receptors involves distinct binding surfaces' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1810705115 _citation.pdbx_database_id_PubMed 30355769 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guo, L.' 1 ? primary 'Cesari, S.' 2 ? primary 'de Guillen, K.' 3 ? primary 'Chalvon, V.' 4 ? primary 'Mammri, L.' 5 ? primary 'Ma, M.' 6 ? primary 'Meusnier, I.' 7 ? primary 'Bonnot, F.' 8 ? primary 'Padilla, A.' 9 ? primary 'Peng, Y.L.' 10 ? primary 'Liu, J.' 11 ? primary 'Kroj, T.' 12 0000-0002-3752-1788 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5ZNG _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.721 _cell.length_a_esd ? _cell.length_b 66.721 _cell.length_b_esd ? _cell.length_c 108.328 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZNG _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NBS-LRR type protein' 14895.397 1 ? ? 'S domain' 'SF file contains Friedel pairs.' 2 polymer man AVR1-CO39 9108.982 1 ? ? ? 'SF file contains Friedel pairs.' 3 water nat water 18.015 37 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MDLSNMESVVESALTGQRTKIVVKVHMPCGKSRAKAMALAASVNGVDSVEITGEDKDRLVVVGRGIDPVRLVALLREKCG LAELLMVELVEKEKTQLAGGKKGAYKKHPTYNLSPFDYVEYPPSAPIMQDINPCSTM ; ;MDLSNMESVVESALTGQRTKIVVKVHMPCGKSRAKAMALAASVNGVDSVEITGEDKDRLVVVGRGIDPVRLVALLREKCG LAELLMVELVEKEKTQLAGGKKGAYKKHPTYNLSPFDYVEYPPSAPIMQDINPCSTM ; A ? 2 'polypeptide(L)' no no MAWKDCIIQRYKDGDVNNIYTANRNEEITIEEYKVFVNEACHPYPVILPDRSVLSGDFTSAYADDDESCYRHHHHHH MAWKDCIIQRYKDGDVNNIYTANRNEEITIEEYKVFVNEACHPYPVILPDRSVLSGDFTSAYADDDESCYRHHHHHH C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LEU n 1 4 SER n 1 5 ASN n 1 6 MET n 1 7 GLU n 1 8 SER n 1 9 VAL n 1 10 VAL n 1 11 GLU n 1 12 SER n 1 13 ALA n 1 14 LEU n 1 15 THR n 1 16 GLY n 1 17 GLN n 1 18 ARG n 1 19 THR n 1 20 LYS n 1 21 ILE n 1 22 VAL n 1 23 VAL n 1 24 LYS n 1 25 VAL n 1 26 HIS n 1 27 MET n 1 28 PRO n 1 29 CYS n 1 30 GLY n 1 31 LYS n 1 32 SER n 1 33 ARG n 1 34 ALA n 1 35 LYS n 1 36 ALA n 1 37 MET n 1 38 ALA n 1 39 LEU n 1 40 ALA n 1 41 ALA n 1 42 SER n 1 43 VAL n 1 44 ASN n 1 45 GLY n 1 46 VAL n 1 47 ASP n 1 48 SER n 1 49 VAL n 1 50 GLU n 1 51 ILE n 1 52 THR n 1 53 GLY n 1 54 GLU n 1 55 ASP n 1 56 LYS n 1 57 ASP n 1 58 ARG n 1 59 LEU n 1 60 VAL n 1 61 VAL n 1 62 VAL n 1 63 GLY n 1 64 ARG n 1 65 GLY n 1 66 ILE n 1 67 ASP n 1 68 PRO n 1 69 VAL n 1 70 ARG n 1 71 LEU n 1 72 VAL n 1 73 ALA n 1 74 LEU n 1 75 LEU n 1 76 ARG n 1 77 GLU n 1 78 LYS n 1 79 CYS n 1 80 GLY n 1 81 LEU n 1 82 ALA n 1 83 GLU n 1 84 LEU n 1 85 LEU n 1 86 MET n 1 87 VAL n 1 88 GLU n 1 89 LEU n 1 90 VAL n 1 91 GLU n 1 92 LYS n 1 93 GLU n 1 94 LYS n 1 95 THR n 1 96 GLN n 1 97 LEU n 1 98 ALA n 1 99 GLY n 1 100 GLY n 1 101 LYS n 1 102 LYS n 1 103 GLY n 1 104 ALA n 1 105 TYR n 1 106 LYS n 1 107 LYS n 1 108 HIS n 1 109 PRO n 1 110 THR n 1 111 TYR n 1 112 ASN n 1 113 LEU n 1 114 SER n 1 115 PRO n 1 116 PHE n 1 117 ASP n 1 118 TYR n 1 119 VAL n 1 120 GLU n 1 121 TYR n 1 122 PRO n 1 123 PRO n 1 124 SER n 1 125 ALA n 1 126 PRO n 1 127 ILE n 1 128 MET n 1 129 GLN n 1 130 ASP n 1 131 ILE n 1 132 ASN n 1 133 PRO n 1 134 CYS n 1 135 SER n 1 136 THR n 1 137 MET n 2 1 MET n 2 2 ALA n 2 3 TRP n 2 4 LYS n 2 5 ASP n 2 6 CYS n 2 7 ILE n 2 8 ILE n 2 9 GLN n 2 10 ARG n 2 11 TYR n 2 12 LYS n 2 13 ASP n 2 14 GLY n 2 15 ASP n 2 16 VAL n 2 17 ASN n 2 18 ASN n 2 19 ILE n 2 20 TYR n 2 21 THR n 2 22 ALA n 2 23 ASN n 2 24 ARG n 2 25 ASN n 2 26 GLU n 2 27 GLU n 2 28 ILE n 2 29 THR n 2 30 ILE n 2 31 GLU n 2 32 GLU n 2 33 TYR n 2 34 LYS n 2 35 VAL n 2 36 PHE n 2 37 VAL n 2 38 ASN n 2 39 GLU n 2 40 ALA n 2 41 CYS n 2 42 HIS n 2 43 PRO n 2 44 TYR n 2 45 PRO n 2 46 VAL n 2 47 ILE n 2 48 LEU n 2 49 PRO n 2 50 ASP n 2 51 ARG n 2 52 SER n 2 53 VAL n 2 54 LEU n 2 55 SER n 2 56 GLY n 2 57 ASP n 2 58 PHE n 2 59 THR n 2 60 SER n 2 61 ALA n 2 62 TYR n 2 63 ALA n 2 64 ASP n 2 65 ASP n 2 66 ASP n 2 67 GLU n 2 68 SER n 2 69 CYS n 2 70 TYR n 2 71 ARG n 2 72 HIS n 2 73 HIS n 2 74 HIS n 2 75 HIS n 2 76 HIS n 2 77 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 137 Rice ? Os11gRGA5 ? ? ? ? ? ? 'Oryza sativa subsp. japonica' 39947 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 77 'Crabgrass-specific blast fungus' ? ? ? ? ? ? ? ? 'Magnaporthe grisea' 148305 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP F7J0N2_ORYSJ F7J0N2 ? 1 ;LSNMESVVESALTGQRTKIVVKVHMPCGKSRAKAMALAASVNGVDSVEITGEDKDRLVVVGRGIDPVRLVALLREKCGLA ELLMVELVEKEKTQLAGGKKGAYKKHPTYNLSPFDYVEYPPSAPIMQDINPCSTM ; 982 2 UNP Q8J180_MAGGR Q8J180 ? 2 AWKDCIIQRYKDGDVNNIYTANRNEEITIEEYKVFVNEACHPYPVILPDRSVLSGDFTSAYADDDESC 22 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5ZNG A 3 ? 137 ? F7J0N2 982 ? 1116 ? 982 1116 2 2 5ZNG C 2 ? 69 ? Q8J180 22 ? 89 ? 22 89 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ZNG MET A 1 ? UNP F7J0N2 ? ? 'initiating methionine' 980 1 1 5ZNG ASP A 2 ? UNP F7J0N2 ? ? 'expression tag' 981 2 2 5ZNG MET C 1 ? UNP Q8J180 ? ? 'initiating methionine' 21 3 2 5ZNG TYR C 70 ? UNP Q8J180 ? ? 'expression tag' 90 4 2 5ZNG ARG C 71 ? UNP Q8J180 ? ? 'expression tag' 91 5 2 5ZNG HIS C 72 ? UNP Q8J180 ? ? 'expression tag' 92 6 2 5ZNG HIS C 73 ? UNP Q8J180 ? ? 'expression tag' 93 7 2 5ZNG HIS C 74 ? UNP Q8J180 ? ? 'expression tag' 94 8 2 5ZNG HIS C 75 ? UNP Q8J180 ? ? 'expression tag' 95 9 2 5ZNG HIS C 76 ? UNP Q8J180 ? ? 'expression tag' 96 10 2 5ZNG HIS C 77 ? UNP Q8J180 ? ? 'expression tag' 97 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZNG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.87 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.11 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1.1 M ammonium tartrate dibasic 0.1 M sodium acetate-HCl, pH 4.6 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 R CdTe 300K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5ZNG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.108 _reflns.d_resolution_low 39.47 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 215689 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.11 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.189 _reflns_shell.d_res_low 2.268 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ZNG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.189 _refine.ls_d_res_low 28.405 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 26844 _refine.ls_number_reflns_R_free 1262 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.55 _refine.ls_percent_reflns_R_free 4.70 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1635 _refine.ls_R_factor_R_free 0.1966 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1619 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.57 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2MYV _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.88 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.20 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1086 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 1123 _refine_hist.d_res_high 2.189 _refine_hist.d_res_low 28.405 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1101 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.886 ? 1490 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 10.265 ? 676 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.066 ? 177 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 190 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1895 2.2771 . . 82 2417 81.00 . . . 0.2787 . 0.2661 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2771 2.3807 . . 163 2675 91.00 . . . 0.2632 . 0.2229 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3807 2.5061 . . 158 2847 98.00 . . . 0.2539 . 0.2209 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5061 2.6630 . . 134 2973 100.00 . . . 0.2914 . 0.2160 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6630 2.8685 . . 177 2902 100.00 . . . 0.2536 . 0.2070 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8685 3.1568 . . 136 2951 100.00 . . . 0.2329 . 0.1906 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1568 3.6128 . . 127 2958 100.00 . . . 0.2062 . 0.1688 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6128 4.5488 . . 169 2922 100.00 . . . 0.1754 . 0.1321 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.5488 28.4074 . . 116 2937 99.00 . . . 0.1336 . 0.1307 . . . . . . . . . . # _struct.entry_id 5ZNG _struct.title ;The crystal complex of immune receptor RGA5A_S of Pia from rice (Oryzae sativa) with rice blast (Magnaporthe oryzae) effector protein AVR1-CO39 ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZNG _struct_keywords.text 'RGA5A_S, resistance protein, rice AVR1-CO39, effector protein, Magnaporthe oryzae, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 29 ? SER A 42 ? CYS A 1008 SER A 1021 1 ? 14 HELX_P HELX_P2 AA2 ASP A 67 ? GLY A 80 ? ASP A 1046 GLY A 1059 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 6 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 41 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id C _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 26 _struct_conn.ptnr2_auth_asym_id C _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 61 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.038 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 44 _struct_mon_prot_cis.label_asym_id B _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 64 _struct_mon_prot_cis.auth_asym_id C _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 45 _struct_mon_prot_cis.pdbx_label_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 65 _struct_mon_prot_cis.pdbx_auth_asym_id_2 C _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.80 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 82 ? LEU A 89 ? ALA A 1061 LEU A 1068 AA1 2 ARG A 18 ? VAL A 25 ? ARG A 997 VAL A 1004 AA1 3 ARG A 58 ? ARG A 64 ? ARG A 1037 ARG A 1043 AA1 4 VAL A 46 ? THR A 52 ? VAL A 1025 THR A 1031 AA1 5 ASP B 15 ? ALA B 22 ? ASP C 35 ALA C 42 AA1 6 CYS B 6 ? LYS B 12 ? CYS C 26 LYS C 32 AA1 7 VAL B 53 ? PHE B 58 ? VAL C 73 PHE C 78 AA2 1 GLU B 26 ? ILE B 30 ? GLU C 46 ILE C 50 AA2 2 TYR B 33 ? VAL B 37 ? TYR C 53 VAL C 57 AA2 3 PRO B 43 ? TYR B 44 ? PRO C 63 TYR C 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 88 ? O GLU A 1067 N LYS A 20 ? N LYS A 999 AA1 2 3 N VAL A 23 ? N VAL A 1002 O LEU A 59 ? O LEU A 1038 AA1 3 4 O VAL A 62 ? O VAL A 1041 N ASP A 47 ? N ASP A 1026 AA1 4 5 N VAL A 49 ? N VAL A 1028 O ILE B 19 ? O ILE C 39 AA1 5 6 O TYR B 20 ? O TYR C 40 N ILE B 8 ? N ILE C 28 AA1 6 7 N GLN B 9 ? N GLN C 29 O SER B 55 ? O SER C 75 AA2 1 2 N ILE B 28 ? N ILE C 48 O VAL B 35 ? O VAL C 55 AA2 2 3 N PHE B 36 ? N PHE C 56 O TYR B 44 ? O TYR C 64 # _atom_sites.entry_id 5ZNG _atom_sites.fract_transf_matrix[1][1] 0.014988 _atom_sites.fract_transf_matrix[1][2] 0.008653 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017306 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009231 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 980 ? ? ? A . n A 1 2 ASP 2 981 ? ? ? A . n A 1 3 LEU 3 982 ? ? ? A . n A 1 4 SER 4 983 ? ? ? A . n A 1 5 ASN 5 984 ? ? ? A . n A 1 6 MET 6 985 ? ? ? A . n A 1 7 GLU 7 986 ? ? ? A . n A 1 8 SER 8 987 ? ? ? A . n A 1 9 VAL 9 988 ? ? ? A . n A 1 10 VAL 10 989 ? ? ? A . n A 1 11 GLU 11 990 ? ? ? A . n A 1 12 SER 12 991 991 SER SER A . n A 1 13 ALA 13 992 992 ALA ALA A . n A 1 14 LEU 14 993 993 LEU LEU A . n A 1 15 THR 15 994 994 THR THR A . n A 1 16 GLY 16 995 995 GLY GLY A . n A 1 17 GLN 17 996 996 GLN GLN A . n A 1 18 ARG 18 997 997 ARG ARG A . n A 1 19 THR 19 998 998 THR THR A . n A 1 20 LYS 20 999 999 LYS LYS A . n A 1 21 ILE 21 1000 1000 ILE ILE A . n A 1 22 VAL 22 1001 1001 VAL VAL A . n A 1 23 VAL 23 1002 1002 VAL VAL A . n A 1 24 LYS 24 1003 1003 LYS LYS A . n A 1 25 VAL 25 1004 1004 VAL VAL A . n A 1 26 HIS 26 1005 1005 HIS HIS A . n A 1 27 MET 27 1006 1006 MET MET A . n A 1 28 PRO 28 1007 1007 PRO PRO A . n A 1 29 CYS 29 1008 1008 CYS CYS A . n A 1 30 GLY 30 1009 1009 GLY GLY A . n A 1 31 LYS 31 1010 1010 LYS LYS A . n A 1 32 SER 32 1011 1011 SER SER A . n A 1 33 ARG 33 1012 1012 ARG ARG A . n A 1 34 ALA 34 1013 1013 ALA ALA A . n A 1 35 LYS 35 1014 1014 LYS LYS A . n A 1 36 ALA 36 1015 1015 ALA ALA A . n A 1 37 MET 37 1016 1016 MET MET A . n A 1 38 ALA 38 1017 1017 ALA ALA A . n A 1 39 LEU 39 1018 1018 LEU LEU A . n A 1 40 ALA 40 1019 1019 ALA ALA A . n A 1 41 ALA 41 1020 1020 ALA ALA A . n A 1 42 SER 42 1021 1021 SER SER A . n A 1 43 VAL 43 1022 1022 VAL VAL A . n A 1 44 ASN 44 1023 1023 ASN ASN A . n A 1 45 GLY 45 1024 1024 GLY GLY A . n A 1 46 VAL 46 1025 1025 VAL VAL A . n A 1 47 ASP 47 1026 1026 ASP ASP A . n A 1 48 SER 48 1027 1027 SER SER A . n A 1 49 VAL 49 1028 1028 VAL VAL A . n A 1 50 GLU 50 1029 1029 GLU GLU A . n A 1 51 ILE 51 1030 1030 ILE ILE A . n A 1 52 THR 52 1031 1031 THR THR A . n A 1 53 GLY 53 1032 1032 GLY GLY A . n A 1 54 GLU 54 1033 1033 GLU GLU A . n A 1 55 ASP 55 1034 1034 ASP ASP A . n A 1 56 LYS 56 1035 1035 LYS LYS A . n A 1 57 ASP 57 1036 1036 ASP ASP A . n A 1 58 ARG 58 1037 1037 ARG ARG A . n A 1 59 LEU 59 1038 1038 LEU LEU A . n A 1 60 VAL 60 1039 1039 VAL VAL A . n A 1 61 VAL 61 1040 1040 VAL VAL A . n A 1 62 VAL 62 1041 1041 VAL VAL A . n A 1 63 GLY 63 1042 1042 GLY GLY A . n A 1 64 ARG 64 1043 1043 ARG ARG A . n A 1 65 GLY 65 1044 1044 GLY GLY A . n A 1 66 ILE 66 1045 1045 ILE ILE A . n A 1 67 ASP 67 1046 1046 ASP ASP A . n A 1 68 PRO 68 1047 1047 PRO PRO A . n A 1 69 VAL 69 1048 1048 VAL VAL A . n A 1 70 ARG 70 1049 1049 ARG ARG A . n A 1 71 LEU 71 1050 1050 LEU LEU A . n A 1 72 VAL 72 1051 1051 VAL VAL A . n A 1 73 ALA 73 1052 1052 ALA ALA A . n A 1 74 LEU 74 1053 1053 LEU LEU A . n A 1 75 LEU 75 1054 1054 LEU LEU A . n A 1 76 ARG 76 1055 1055 ARG ARG A . n A 1 77 GLU 77 1056 1056 GLU GLU A . n A 1 78 LYS 78 1057 1057 LYS LYS A . n A 1 79 CYS 79 1058 1058 CYS CYS A . n A 1 80 GLY 80 1059 1059 GLY GLY A . n A 1 81 LEU 81 1060 1060 LEU LEU A . n A 1 82 ALA 82 1061 1061 ALA ALA A . n A 1 83 GLU 83 1062 1062 GLU GLU A . n A 1 84 LEU 84 1063 1063 LEU LEU A . n A 1 85 LEU 85 1064 1064 LEU LEU A . n A 1 86 MET 86 1065 1065 MET MET A . n A 1 87 VAL 87 1066 1066 VAL VAL A . n A 1 88 GLU 88 1067 1067 GLU GLU A . n A 1 89 LEU 89 1068 1068 LEU LEU A . n A 1 90 VAL 90 1069 1069 VAL VAL A . n A 1 91 GLU 91 1070 ? ? ? A . n A 1 92 LYS 92 1071 ? ? ? A . n A 1 93 GLU 93 1072 ? ? ? A . n A 1 94 LYS 94 1073 ? ? ? A . n A 1 95 THR 95 1074 ? ? ? A . n A 1 96 GLN 96 1075 ? ? ? A . n A 1 97 LEU 97 1076 ? ? ? A . n A 1 98 ALA 98 1077 ? ? ? A . n A 1 99 GLY 99 1078 ? ? ? A . n A 1 100 GLY 100 1079 ? ? ? A . n A 1 101 LYS 101 1080 ? ? ? A . n A 1 102 LYS 102 1081 ? ? ? A . n A 1 103 GLY 103 1082 ? ? ? A . n A 1 104 ALA 104 1083 ? ? ? A . n A 1 105 TYR 105 1084 ? ? ? A . n A 1 106 LYS 106 1085 ? ? ? A . n A 1 107 LYS 107 1086 ? ? ? A . n A 1 108 HIS 108 1087 ? ? ? A . n A 1 109 PRO 109 1088 ? ? ? A . n A 1 110 THR 110 1089 ? ? ? A . n A 1 111 TYR 111 1090 ? ? ? A . n A 1 112 ASN 112 1091 ? ? ? A . n A 1 113 LEU 113 1092 ? ? ? A . n A 1 114 SER 114 1093 ? ? ? A . n A 1 115 PRO 115 1094 ? ? ? A . n A 1 116 PHE 116 1095 ? ? ? A . n A 1 117 ASP 117 1096 ? ? ? A . n A 1 118 TYR 118 1097 ? ? ? A . n A 1 119 VAL 119 1098 ? ? ? A . n A 1 120 GLU 120 1099 ? ? ? A . n A 1 121 TYR 121 1100 ? ? ? A . n A 1 122 PRO 122 1101 ? ? ? A . n A 1 123 PRO 123 1102 ? ? ? A . n A 1 124 SER 124 1103 ? ? ? A . n A 1 125 ALA 125 1104 ? ? ? A . n A 1 126 PRO 126 1105 ? ? ? A . n A 1 127 ILE 127 1106 ? ? ? A . n A 1 128 MET 128 1107 ? ? ? A . n A 1 129 GLN 129 1108 ? ? ? A . n A 1 130 ASP 130 1109 ? ? ? A . n A 1 131 ILE 131 1110 ? ? ? A . n A 1 132 ASN 132 1111 ? ? ? A . n A 1 133 PRO 133 1112 ? ? ? A . n A 1 134 CYS 134 1113 ? ? ? A . n A 1 135 SER 135 1114 ? ? ? A . n A 1 136 THR 136 1115 ? ? ? A . n A 1 137 MET 137 1116 ? ? ? A . n B 2 1 MET 1 21 ? ? ? C . n B 2 2 ALA 2 22 22 ALA ALA C . n B 2 3 TRP 3 23 23 TRP TRP C . n B 2 4 LYS 4 24 24 LYS LYS C . n B 2 5 ASP 5 25 25 ASP ASP C . n B 2 6 CYS 6 26 26 CYS CYS C . n B 2 7 ILE 7 27 27 ILE ILE C . n B 2 8 ILE 8 28 28 ILE ILE C . n B 2 9 GLN 9 29 29 GLN GLN C . n B 2 10 ARG 10 30 30 ARG ARG C . n B 2 11 TYR 11 31 31 TYR TYR C . n B 2 12 LYS 12 32 32 LYS LYS C . n B 2 13 ASP 13 33 33 ASP ASP C . n B 2 14 GLY 14 34 34 GLY GLY C . n B 2 15 ASP 15 35 35 ASP ASP C . n B 2 16 VAL 16 36 36 VAL VAL C . n B 2 17 ASN 17 37 37 ASN ASN C . n B 2 18 ASN 18 38 38 ASN ASN C . n B 2 19 ILE 19 39 39 ILE ILE C . n B 2 20 TYR 20 40 40 TYR TYR C . n B 2 21 THR 21 41 41 THR THR C . n B 2 22 ALA 22 42 42 ALA ALA C . n B 2 23 ASN 23 43 43 ASN ASN C . n B 2 24 ARG 24 44 44 ARG ARG C . n B 2 25 ASN 25 45 45 ASN ASN C . n B 2 26 GLU 26 46 46 GLU GLU C . n B 2 27 GLU 27 47 47 GLU GLU C . n B 2 28 ILE 28 48 48 ILE ILE C . n B 2 29 THR 29 49 49 THR THR C . n B 2 30 ILE 30 50 50 ILE ILE C . n B 2 31 GLU 31 51 51 GLU GLU C . n B 2 32 GLU 32 52 52 GLU GLU C . n B 2 33 TYR 33 53 53 TYR TYR C . n B 2 34 LYS 34 54 54 LYS LYS C . n B 2 35 VAL 35 55 55 VAL VAL C . n B 2 36 PHE 36 56 56 PHE PHE C . n B 2 37 VAL 37 57 57 VAL VAL C . n B 2 38 ASN 38 58 58 ASN ASN C . n B 2 39 GLU 39 59 59 GLU GLU C . n B 2 40 ALA 40 60 60 ALA ALA C . n B 2 41 CYS 41 61 61 CYS CYS C . n B 2 42 HIS 42 62 62 HIS HIS C . n B 2 43 PRO 43 63 63 PRO PRO C . n B 2 44 TYR 44 64 64 TYR TYR C . n B 2 45 PRO 45 65 65 PRO PRO C . n B 2 46 VAL 46 66 66 VAL VAL C . n B 2 47 ILE 47 67 67 ILE ILE C . n B 2 48 LEU 48 68 68 LEU LEU C . n B 2 49 PRO 49 69 69 PRO PRO C . n B 2 50 ASP 50 70 70 ASP ASP C . n B 2 51 ARG 51 71 71 ARG ARG C . n B 2 52 SER 52 72 72 SER SER C . n B 2 53 VAL 53 73 73 VAL VAL C . n B 2 54 LEU 54 74 74 LEU LEU C . n B 2 55 SER 55 75 75 SER SER C . n B 2 56 GLY 56 76 76 GLY GLY C . n B 2 57 ASP 57 77 77 ASP ASP C . n B 2 58 PHE 58 78 78 PHE PHE C . n B 2 59 THR 59 79 79 THR THR C . n B 2 60 SER 60 80 80 SER SER C . n B 2 61 ALA 61 81 81 ALA ALA C . n B 2 62 TYR 62 82 82 TYR TYR C . n B 2 63 ALA 63 83 83 ALA ALA C . n B 2 64 ASP 64 84 ? ? ? C . n B 2 65 ASP 65 85 ? ? ? C . n B 2 66 ASP 66 86 ? ? ? C . n B 2 67 GLU 67 87 ? ? ? C . n B 2 68 SER 68 88 ? ? ? C . n B 2 69 CYS 69 89 ? ? ? C . n B 2 70 TYR 70 90 ? ? ? C . n B 2 71 ARG 71 91 ? ? ? C . n B 2 72 HIS 72 92 ? ? ? C . n B 2 73 HIS 73 93 ? ? ? C . n B 2 74 HIS 74 94 ? ? ? C . n B 2 75 HIS 75 95 ? ? ? C . n B 2 76 HIS 76 96 ? ? ? C . n B 2 77 HIS 77 97 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 1201 20 HOH HOH A . C 3 HOH 2 1202 21 HOH HOH A . C 3 HOH 3 1203 3 HOH HOH A . C 3 HOH 4 1204 33 HOH HOH A . C 3 HOH 5 1205 34 HOH HOH A . C 3 HOH 6 1206 5 HOH HOH A . C 3 HOH 7 1207 13 HOH HOH A . C 3 HOH 8 1208 2 HOH HOH A . C 3 HOH 9 1209 25 HOH HOH A . C 3 HOH 10 1210 37 HOH HOH A . C 3 HOH 11 1211 12 HOH HOH A . C 3 HOH 12 1212 29 HOH HOH A . C 3 HOH 13 1213 23 HOH HOH A . C 3 HOH 14 1214 7 HOH HOH A . C 3 HOH 15 1215 30 HOH HOH A . C 3 HOH 16 1216 17 HOH HOH A . C 3 HOH 17 1217 10 HOH HOH A . C 3 HOH 18 1218 22 HOH HOH A . C 3 HOH 19 1219 31 HOH HOH A . C 3 HOH 20 1220 11 HOH HOH A . D 3 HOH 1 101 14 HOH HOH C . D 3 HOH 2 102 19 HOH HOH C . D 3 HOH 3 103 8 HOH HOH C . D 3 HOH 4 104 15 HOH HOH C . D 3 HOH 5 105 36 HOH HOH C . D 3 HOH 6 106 6 HOH HOH C . D 3 HOH 7 107 1 HOH HOH C . D 3 HOH 8 108 26 HOH HOH C . D 3 HOH 9 109 32 HOH HOH C . D 3 HOH 10 110 4 HOH HOH C . D 3 HOH 11 111 27 HOH HOH C . D 3 HOH 12 112 24 HOH HOH C . D 3 HOH 13 113 35 HOH HOH C . D 3 HOH 14 114 9 HOH HOH C . D 3 HOH 15 115 28 HOH HOH C . D 3 HOH 16 116 16 HOH HOH C . D 3 HOH 17 117 18 HOH HOH C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-10-24 2 'Structure model' 1 1 2018-11-28 3 'Structure model' 1 2 2022-07-20 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_assembly_gen 6 3 'Structure model' pdbx_struct_assembly_prop 7 3 'Structure model' pdbx_struct_oper_list 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond 10 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation_author.identifier_ORCID' 7 2 'Structure model' '_citation_author.name' 8 3 'Structure model' '_database_2.pdbx_DOI' 9 3 'Structure model' '_database_2.pdbx_database_accession' 10 3 'Structure model' '_pdbx_struct_assembly.details' 11 3 'Structure model' '_pdbx_struct_assembly.method_details' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -10.9187 20.5728 -14.6554 0.8001 1.3663 1.0526 0.2309 0.0686 0.3507 1.4768 5.0432 2.6436 -1.9491 -1.6191 3.3423 -0.6683 -3.5838 -0.8099 1.0449 1.1526 -1.9523 1.1274 -0.1760 -1.5435 'X-RAY DIFFRACTION' 2 ? refined -22.4773 29.4918 -26.5139 0.2929 0.7634 0.4583 -0.0694 0.0275 -0.0459 4.2429 7.7581 7.6491 -1.4534 4.1956 -1.2658 -0.0298 -1.4658 0.3199 -0.2360 -0.1405 -0.0405 -0.1111 -0.9815 0.1340 'X-RAY DIFFRACTION' 3 ? refined -31.0898 24.8460 -26.9763 0.3223 0.6285 0.5569 -0.0209 -0.0321 0.0265 8.5286 3.8146 2.4834 -4.5885 3.1144 -3.0426 -0.1245 -0.3444 -0.0944 -0.2900 0.3874 0.7001 0.2306 -0.7049 -0.1778 'X-RAY DIFFRACTION' 4 ? refined -24.7717 26.4537 -19.0506 0.2671 0.7640 0.4250 0.0410 0.0444 -0.0646 5.9415 7.7290 8.7148 -0.2918 -0.7252 -3.0143 -0.2781 -0.6714 -0.0485 0.4297 0.1079 0.0509 -0.1772 0.4886 0.3409 'X-RAY DIFFRACTION' 5 ? refined -22.0822 30.3241 -23.4997 0.3670 0.6384 0.4831 0.0205 0.0281 -0.0554 6.5499 3.2726 5.6698 -2.0753 1.7504 -0.5143 -0.1723 -0.8060 0.5750 0.0293 0.0178 -0.0735 -0.3167 0.6194 0.3801 'X-RAY DIFFRACTION' 6 ? refined -21.1884 19.5114 -29.7016 0.5036 0.6043 0.4926 0.0003 0.0550 0.0110 5.1781 6.3651 3.9708 -2.5112 4.5532 -2.3863 0.3102 -0.3337 -0.5962 -0.8702 -0.0072 -0.2540 1.1733 0.1836 -0.0912 'X-RAY DIFFRACTION' 7 ? refined -15.5841 29.4454 -25.4719 0.2489 0.8423 0.5228 -0.0719 0.0198 -0.0690 9.4213 9.6655 3.7526 3.7728 5.7587 2.5959 -0.0061 -1.2636 0.1091 -0.1805 -0.1012 -0.1972 -0.2966 0.4505 -0.0334 'X-RAY DIFFRACTION' 8 ? refined -33.2611 27.4726 -17.0053 0.3324 0.7706 0.4877 0.0031 0.0397 -0.0473 5.8598 2.8684 7.6944 1.0224 -1.0571 -2.0701 -0.1297 0.5053 0.1196 -0.2590 -0.1186 0.2220 0.0111 0.0142 0.1433 'X-RAY DIFFRACTION' 9 ? refined -32.2544 26.6260 -5.9338 0.3014 0.6484 0.5511 0.0385 0.0022 0.0180 5.6154 2.1265 6.8560 -0.7710 1.3801 -1.5577 -0.0082 -0.2112 0.1562 0.6268 -0.4786 -1.1423 -0.2747 0.5737 0.4823 'X-RAY DIFFRACTION' 10 ? refined -39.8894 28.0274 -10.3630 0.2628 0.6768 0.4478 0.0622 0.0122 -0.0657 5.5752 8.6848 4.4434 -0.8923 -1.1634 -0.2035 -0.3326 0.2360 -0.0510 -0.0079 0.1885 0.3077 -0.0169 -0.2411 0.1435 'X-RAY DIFFRACTION' 11 ? refined -35.1711 12.2692 -18.8675 1.1220 1.0454 0.9554 0.0411 0.1568 -0.3747 2.2443 0.4938 0.4838 1.0206 0.6412 0.2002 0.5561 2.1131 -1.1773 -1.0491 1.2274 -1.2609 2.3788 0.2907 -2.1092 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 991 through 996 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 997 through 1008 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1009 through 1021 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1022 through 1031 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1032 through 1046 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1047 through 1058 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1059 through 1069 ) ; 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 22 through 42 ) ; 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 43 through 57 ) ; 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 58 through 78 ) ; 'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 79 through 83 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 C _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 112 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 C _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 115 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.89 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU C 51 ? ? 57.76 -126.24 2 1 TYR C 82 ? ? 79.05 -176.30 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 980 ? A MET 1 2 1 Y 1 A ASP 981 ? A ASP 2 3 1 Y 1 A LEU 982 ? A LEU 3 4 1 Y 1 A SER 983 ? A SER 4 5 1 Y 1 A ASN 984 ? A ASN 5 6 1 Y 1 A MET 985 ? A MET 6 7 1 Y 1 A GLU 986 ? A GLU 7 8 1 Y 1 A SER 987 ? A SER 8 9 1 Y 1 A VAL 988 ? A VAL 9 10 1 Y 1 A VAL 989 ? A VAL 10 11 1 Y 1 A GLU 990 ? A GLU 11 12 1 Y 1 A GLU 1070 ? A GLU 91 13 1 Y 1 A LYS 1071 ? A LYS 92 14 1 Y 1 A GLU 1072 ? A GLU 93 15 1 Y 1 A LYS 1073 ? A LYS 94 16 1 Y 1 A THR 1074 ? A THR 95 17 1 Y 1 A GLN 1075 ? A GLN 96 18 1 Y 1 A LEU 1076 ? A LEU 97 19 1 Y 1 A ALA 1077 ? A ALA 98 20 1 Y 1 A GLY 1078 ? A GLY 99 21 1 Y 1 A GLY 1079 ? A GLY 100 22 1 Y 1 A LYS 1080 ? A LYS 101 23 1 Y 1 A LYS 1081 ? A LYS 102 24 1 Y 1 A GLY 1082 ? A GLY 103 25 1 Y 1 A ALA 1083 ? A ALA 104 26 1 Y 1 A TYR 1084 ? A TYR 105 27 1 Y 1 A LYS 1085 ? A LYS 106 28 1 Y 1 A LYS 1086 ? A LYS 107 29 1 Y 1 A HIS 1087 ? A HIS 108 30 1 Y 1 A PRO 1088 ? A PRO 109 31 1 Y 1 A THR 1089 ? A THR 110 32 1 Y 1 A TYR 1090 ? A TYR 111 33 1 Y 1 A ASN 1091 ? A ASN 112 34 1 Y 1 A LEU 1092 ? A LEU 113 35 1 Y 1 A SER 1093 ? A SER 114 36 1 Y 1 A PRO 1094 ? A PRO 115 37 1 Y 1 A PHE 1095 ? A PHE 116 38 1 Y 1 A ASP 1096 ? A ASP 117 39 1 Y 1 A TYR 1097 ? A TYR 118 40 1 Y 1 A VAL 1098 ? A VAL 119 41 1 Y 1 A GLU 1099 ? A GLU 120 42 1 Y 1 A TYR 1100 ? A TYR 121 43 1 Y 1 A PRO 1101 ? A PRO 122 44 1 Y 1 A PRO 1102 ? A PRO 123 45 1 Y 1 A SER 1103 ? A SER 124 46 1 Y 1 A ALA 1104 ? A ALA 125 47 1 Y 1 A PRO 1105 ? A PRO 126 48 1 Y 1 A ILE 1106 ? A ILE 127 49 1 Y 1 A MET 1107 ? A MET 128 50 1 Y 1 A GLN 1108 ? A GLN 129 51 1 Y 1 A ASP 1109 ? A ASP 130 52 1 Y 1 A ILE 1110 ? A ILE 131 53 1 Y 1 A ASN 1111 ? A ASN 132 54 1 Y 1 A PRO 1112 ? A PRO 133 55 1 Y 1 A CYS 1113 ? A CYS 134 56 1 Y 1 A SER 1114 ? A SER 135 57 1 Y 1 A THR 1115 ? A THR 136 58 1 Y 1 A MET 1116 ? A MET 137 59 1 Y 1 C MET 21 ? B MET 1 60 1 Y 1 C ASP 84 ? B ASP 64 61 1 Y 1 C ASP 85 ? B ASP 65 62 1 Y 1 C ASP 86 ? B ASP 66 63 1 Y 1 C GLU 87 ? B GLU 67 64 1 Y 1 C SER 88 ? B SER 68 65 1 Y 1 C CYS 89 ? B CYS 69 66 1 Y 1 C TYR 90 ? B TYR 70 67 1 Y 1 C ARG 91 ? B ARG 71 68 1 Y 1 C HIS 92 ? B HIS 72 69 1 Y 1 C HIS 93 ? B HIS 73 70 1 Y 1 C HIS 94 ? B HIS 74 71 1 Y 1 C HIS 95 ? B HIS 75 72 1 Y 1 C HIS 96 ? B HIS 76 73 1 Y 1 C HIS 97 ? B HIS 77 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 315711057 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2MYV _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #