data_5ZS6 # _entry.id 5ZS6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZS6 pdb_00005zs6 10.2210/pdb5zs6/pdb WWPDB D_1300007509 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZS6 _pdbx_database_status.recvd_initial_deposition_date 2018-04-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bhandari, S.' 1 ? 'Suguna, K.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 87 _citation.language ? _citation.page_first 365 _citation.page_last 379 _citation.title 'Dodecameric structure of a small heat shock protein from Mycobacterium marinum M.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.25657 _citation.pdbx_database_id_PubMed 30632633 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bhandari, S.' 1 ? primary 'Biswas, S.' 2 ? primary 'Chaudhary, A.' 3 ? primary 'Dutta, S.' 4 ? primary 'Suguna, K.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5ZS6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 91.290 _cell.length_a_esd ? _cell.length_b 91.290 _cell.length_b_esd ? _cell.length_c 91.290 _cell.length_c_esd ? _cell.volume 760793.453 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZS6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall 'I 2 2 3' _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Molecular chaperone (Small heat shock protein)' 16535.803 1 ? ? ? ? 2 polymer man GLY-ARG-LEU-LEU 458.576 1 ? ? ? ? 3 non-polymer man 'DI(HYDROXYETHYL)ETHER' 106.120 3 ? ? ? ? 4 non-polymer syn PROLINE 115.130 1 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 6 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 7 water nat water 18.015 2 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MLMRTDPFRDLDRFAQQVLGTSARPAVMPMDAWREGDKFVVEFDLPGIDADSLDIDIERNVVTVRAERPAVDPNREMLAS ERPRGVFSRQLVLGENLDTARIAASYTEGVLKLQIPVAEKAKPRKISITRGAGDKTISENGAHPEVIEA ; ;MLMRTDPFRDLDRFAQQVLGTSARPAVMPMDAWREGDKFVVEFDLPGIDADSLDIDIERNVVTVRAERPAVDPNREMLAS ERPRGVFSRQLVLGENLDTARIAASYTEGVLKLQIPVAEKAKPRKISITRGAGDKTISENGAHPEVIEA ; A ? 2 'polypeptide(L)' no no GRLL GRLL U ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 MET n 1 4 ARG n 1 5 THR n 1 6 ASP n 1 7 PRO n 1 8 PHE n 1 9 ARG n 1 10 ASP n 1 11 LEU n 1 12 ASP n 1 13 ARG n 1 14 PHE n 1 15 ALA n 1 16 GLN n 1 17 GLN n 1 18 VAL n 1 19 LEU n 1 20 GLY n 1 21 THR n 1 22 SER n 1 23 ALA n 1 24 ARG n 1 25 PRO n 1 26 ALA n 1 27 VAL n 1 28 MET n 1 29 PRO n 1 30 MET n 1 31 ASP n 1 32 ALA n 1 33 TRP n 1 34 ARG n 1 35 GLU n 1 36 GLY n 1 37 ASP n 1 38 LYS n 1 39 PHE n 1 40 VAL n 1 41 VAL n 1 42 GLU n 1 43 PHE n 1 44 ASP n 1 45 LEU n 1 46 PRO n 1 47 GLY n 1 48 ILE n 1 49 ASP n 1 50 ALA n 1 51 ASP n 1 52 SER n 1 53 LEU n 1 54 ASP n 1 55 ILE n 1 56 ASP n 1 57 ILE n 1 58 GLU n 1 59 ARG n 1 60 ASN n 1 61 VAL n 1 62 VAL n 1 63 THR n 1 64 VAL n 1 65 ARG n 1 66 ALA n 1 67 GLU n 1 68 ARG n 1 69 PRO n 1 70 ALA n 1 71 VAL n 1 72 ASP n 1 73 PRO n 1 74 ASN n 1 75 ARG n 1 76 GLU n 1 77 MET n 1 78 LEU n 1 79 ALA n 1 80 SER n 1 81 GLU n 1 82 ARG n 1 83 PRO n 1 84 ARG n 1 85 GLY n 1 86 VAL n 1 87 PHE n 1 88 SER n 1 89 ARG n 1 90 GLN n 1 91 LEU n 1 92 VAL n 1 93 LEU n 1 94 GLY n 1 95 GLU n 1 96 ASN n 1 97 LEU n 1 98 ASP n 1 99 THR n 1 100 ALA n 1 101 ARG n 1 102 ILE n 1 103 ALA n 1 104 ALA n 1 105 SER n 1 106 TYR n 1 107 THR n 1 108 GLU n 1 109 GLY n 1 110 VAL n 1 111 LEU n 1 112 LYS n 1 113 LEU n 1 114 GLN n 1 115 ILE n 1 116 PRO n 1 117 VAL n 1 118 ALA n 1 119 GLU n 1 120 LYS n 1 121 ALA n 1 122 LYS n 1 123 PRO n 1 124 ARG n 1 125 LYS n 1 126 ILE n 1 127 SER n 1 128 ILE n 1 129 THR n 1 130 ARG n 1 131 GLY n 1 132 ALA n 1 133 GLY n 1 134 ASP n 1 135 LYS n 1 136 THR n 1 137 ILE n 1 138 SER n 1 139 GLU n 1 140 ASN n 1 141 GLY n 1 142 ALA n 1 143 HIS n 1 144 PRO n 1 145 GLU n 1 146 VAL n 1 147 ILE n 1 148 GLU n 1 149 ALA n 2 1 GLY n 2 2 ARG n 2 3 LEU n 2 4 LEU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 149 ? ? ? ? M ? ? ? ? 'Mycobacterium marinum M' 216594 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pRSET-A ? ? 2 1 sample 'Biological sequence' 1 4 ? ? ? ? M ? ? ? ? 'Mycobacterium marinum M' 216594 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pRSET-A ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP B2HF11_MYCMM B2HF11 ? 1 ;MLMRTDPFRDLDRFAQQVLGTSARPAVMPMDAWREGDKFVVEFDLPGIDADSLDIDIERNVVTVRAERPAVDPNREMLAS ERPRGVFSRQLVLGENLDTARIAASYTEGVLKLQIPVAEKAKPRKISITRGAGDKTISENGAHPEVIEA ; 1 2 PDB 5ZS6 5ZS6 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5ZS6 A 1 ? 149 ? B2HF11 1 ? 149 ? 1 149 2 2 5ZS6 U 1 ? 4 ? 5ZS6 1 ? 4 ? 1 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZS6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.92 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method MICROBATCH _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M L-Proline, 0.1 M HEPES pH 7.5 and 24 % PEG 1500' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-01-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E+ SUPERBRIGHT' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 38.5 _reflns.entry_id 5ZS6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.81 _reflns.d_resolution_low 64.5516366332 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3204 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.9 _reflns.pdbx_Rmerge_I_obs 0.206 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.045 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.81 _reflns_shell.d_res_low 2.96 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 466 _reflns_shell.percent_possible_all 96.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.627 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 22.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 41.38 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ZS6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.81191345712 _refine.ls_d_res_low 64.55 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3186 _refine.ls_number_reflns_R_free 177 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4692475804 _refine.ls_percent_reflns_R_free 5.55555555556 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.202519140461 _refine.ls_R_factor_R_free 0.250238558138 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.199183007628 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35348710975 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1GME _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 17.2988004223 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.293615717533 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 848 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 2 _refine_hist.number_atoms_total 882 _refine_hist.d_res_high 2.81191345712 _refine_hist.d_res_low 64.55 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0046298894019 ? 908 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.922624459973 ? 1226 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054036055063 ? 146 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00619177403898 ? 158 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.6331990058 ? 566 ? f_dihedral_angle_d ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.8119 _refine_ls_shell.d_res_low 2.9601 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 177 _refine_ls_shell.number_reflns_R_work 3009 _refine_ls_shell.percent_reflns_obs 99.4692475804 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.250238558138 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.199183007628 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5ZS6 _struct.title 'Dodecameric structure of a small Heat Shock Protein from Mycobacterium marinum M: Form-2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZS6 _struct_keywords.text 'sHSP, oligomers, polydispersity, CHAPERONE' _struct_keywords.pdbx_keywords CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? H N N 5 ? I N N 6 ? J N N 7 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 98 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ILE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 102 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 98 _struct_conf.end_auth_comp_id ILE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 102 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id C _struct_conn.ptnr1_label_comp_id PEG _struct_conn.ptnr1_label_seq_id . _struct_conn.ptnr1_label_atom_id O1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id I _struct_conn.ptnr2_label_comp_id NA _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id NA _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id PEG _struct_conn.ptnr1_auth_seq_id 201 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NA _struct_conn.ptnr2_auth_seq_id 207 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.713 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 30 ? GLU A 35 ? MET A 30 GLU A 35 AA1 2 LYS A 38 ? ASP A 44 ? LYS A 38 ASP A 44 AA1 3 VAL A 110 ? PRO A 116 ? VAL A 110 PRO A 116 AA1 4 ALA A 103 ? THR A 107 ? ALA A 103 THR A 107 AA2 1 ASP A 54 ? GLU A 58 ? ASP A 54 GLU A 58 AA2 2 VAL A 61 ? ARG A 68 ? VAL A 61 ARG A 68 AA2 3 GLY A 85 ? LEU A 93 ? GLY A 85 LEU A 93 AA2 4 LEU B 3 ? LEU B 4 ? LEU U 3 LEU U 4 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 35 ? N GLU A 35 O LYS A 38 ? O LYS A 38 AA1 2 3 N VAL A 41 ? N VAL A 41 O LEU A 113 ? O LEU A 113 AA1 3 4 O LYS A 112 ? O LYS A 112 N SER A 105 ? N SER A 105 AA2 1 2 N GLU A 58 ? N GLU A 58 O VAL A 61 ? O VAL A 61 AA2 2 3 N ALA A 66 ? N ALA A 66 O PHE A 87 ? O PHE A 87 AA2 3 4 N VAL A 92 ? N VAL A 92 O LEU B 4 ? O LEU U 4 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A PEG 201 ? 3 'binding site for residue PEG A 201' AC2 Software A PEG 202 ? 5 'binding site for residue PEG A 202' AC3 Software A PEG 203 ? 5 'binding site for residue PEG A 203' AC4 Software A PRO 204 ? 6 'binding site for residue PRO A 204' AC5 Software A CL 205 ? 1 'binding site for residue CL A 205' AC6 Software A CL 206 ? 3 'binding site for residue CL A 206' AC7 Software A NA 207 ? 1 'binding site for residue NA A 207' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 SER A 22 ? SER A 22 . ? 9_555 ? 2 AC1 3 ARG A 75 ? ARG A 75 . ? 1_555 ? 3 AC1 3 NA I . ? NA A 207 . ? 1_555 ? 4 AC2 5 GLY A 47 ? GLY A 47 . ? 1_555 ? 5 AC2 5 ARG A 68 ? ARG A 68 . ? 1_555 ? 6 AC2 5 ARG A 82 ? ARG A 82 . ? 1_555 ? 7 AC2 5 ARG A 84 ? ARG A 84 . ? 1_555 ? 8 AC2 5 LYS A 122 ? LYS A 122 . ? 22_545 ? 9 AC3 5 PRO A 29 ? PRO A 29 . ? 4_566 ? 10 AC3 5 PRO A 29 ? PRO A 29 . ? 1_555 ? 11 AC3 5 ASP A 44 ? ASP A 44 . ? 1_555 ? 12 AC3 5 ASP A 44 ? ASP A 44 . ? 4_566 ? 13 AC3 5 PRO A 83 ? PRO A 83 . ? 1_555 ? 14 AC4 6 ARG A 34 ? ARG A 34 . ? 18_456 ? 15 AC4 6 GLU A 35 ? GLU A 35 . ? 18_456 ? 16 AC4 6 GLY A 36 ? GLY A 36 . ? 18_456 ? 17 AC4 6 ARG A 75 ? ARG A 75 . ? 19_555 ? 18 AC4 6 ARG A 124 ? ARG A 124 . ? 1_555 ? 19 AC4 6 LYS A 125 ? LYS A 125 . ? 1_555 ? 20 AC5 1 LEU A 19 ? LEU A 19 . ? 1_555 ? 21 AC6 3 ARG A 75 ? ARG A 75 . ? 1_555 ? 22 AC6 3 GLU A 76 ? GLU A 76 . ? 1_555 ? 23 AC6 3 ARG A 124 ? ARG A 124 . ? 22_545 ? 24 AC7 1 PEG C . ? PEG A 201 . ? 1_555 ? # _atom_sites.entry_id 5ZS6 _atom_sites.fract_transf_matrix[1][1] 0.010954 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010954 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010954 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 1.04373 23.83732 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 24.73122 6.32584 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? NA ? ? 9.38062 1.54875 3.38349 72.32734 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? 9.05267 ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 MET 3 3 ? ? ? A . n A 1 4 ARG 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 PRO 7 7 ? ? ? A . n A 1 8 PHE 8 8 ? ? ? A . n A 1 9 ARG 9 9 ? ? ? A . n A 1 10 ASP 10 10 ? ? ? A . n A 1 11 LEU 11 11 ? ? ? A . n A 1 12 ASP 12 12 ? ? ? A . n A 1 13 ARG 13 13 ? ? ? A . n A 1 14 PHE 14 14 ? ? ? A . n A 1 15 ALA 15 15 ? ? ? A . n A 1 16 GLN 16 16 ? ? ? A . n A 1 17 GLN 17 17 ? ? ? A . n A 1 18 VAL 18 18 ? ? ? A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 ARG 130 130 130 ARG ALA A . n A 1 131 GLY 131 131 ? ? ? A . n A 1 132 ALA 132 132 ? ? ? A . n A 1 133 GLY 133 133 ? ? ? A . n A 1 134 ASP 134 134 ? ? ? A . n A 1 135 LYS 135 135 ? ? ? A . n A 1 136 THR 136 136 ? ? ? A . n A 1 137 ILE 137 137 ? ? ? A . n A 1 138 SER 138 138 ? ? ? A . n A 1 139 GLU 139 139 ? ? ? A . n A 1 140 ASN 140 140 ? ? ? A . n A 1 141 GLY 141 141 ? ? ? A . n A 1 142 ALA 142 142 ? ? ? A . n A 1 143 HIS 143 143 ? ? ? A . n A 1 144 PRO 144 144 ? ? ? A . n A 1 145 GLU 145 145 ? ? ? A . n A 1 146 VAL 146 146 ? ? ? A . n A 1 147 ILE 147 147 ? ? ? A . n A 1 148 GLU 148 148 ? ? ? A . n A 1 149 ALA 149 149 ? ? ? A . n B 2 1 GLY 1 1 1 GLY GLY U . n B 2 2 ARG 2 2 2 ARG ARG U . n B 2 3 LEU 3 3 3 LEU LEU U . n B 2 4 LEU 4 4 4 LEU LEU U . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 PEG 1 201 1 PEG PEG A . D 3 PEG 1 202 2 PEG PEG A . E 3 PEG 1 203 3 PEG PEG A . F 4 PRO 1 204 1 PRO PRO A . G 5 CL 1 205 1 CL CL A . H 5 CL 1 206 2 CL CL A . I 6 NA 1 207 1 NA NA A . J 7 HOH 1 301 1 HOH HOH A . J 7 HOH 2 302 2 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details DODECAMERIC _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F,G,H,I,J 1 2 A,B,C,D,E,F,G,H,I,J 1 3 A,B,C,D,E,F,G,H,I,J 1 4 A,B,C,D,E,F,G,H,I,J 1 5 A,B,C,D,E,F,G,H,I,J 1 6 A,B,C,D,E,F,G,H,I,J 1 7 A,B,C,D,E,F,G,H,I,J 1 8 A,B,C,D,E,F,G,H,I,J 1 9 A,B,C,D,E,F,G,H,I,J 1 10 A,B,C,D,E,F,G,H,I,J 1 11 A,B,C,D,E,F,G,H,I,J 1 12 A,B,C,D,E,F,G,H,I,J # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 91.2900000000 0.0000000000 -1.0000000000 0.0000000000 91.2900000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 91.2900000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 91.2900000000 4 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 91.2900000000 0.0000000000 0.0000000000 -1.0000000000 91.2900000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_566 z,-x+1,-y+1 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 91.2900000000 0.0000000000 -1.0000000000 0.0000000000 91.2900000000 7 'crystal symmetry operation' 7_665 -z+1,-x+1,y 0.0000000000 0.0000000000 -1.0000000000 91.2900000000 -1.0000000000 0.0000000000 0.0000000000 91.2900000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_656 -z+1,x,-y+1 0.0000000000 0.0000000000 -1.0000000000 91.2900000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 91.2900000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_656 -y+1,z,-x+1 0.0000000000 -1.0000000000 0.0000000000 91.2900000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 91.2900000000 11 'crystal symmetry operation' 11_566 y,-z+1,-x+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 91.2900000000 -1.0000000000 0.0000000000 0.0000000000 91.2900000000 12 'crystal symmetry operation' 12_665 -y+1,-z+1,x 0.0000000000 -1.0000000000 0.0000000000 91.2900000000 0.0000000000 0.0000000000 -1.0000000000 91.2900000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-30 2 'Structure model' 1 1 2019-04-17 3 'Structure model' 1 2 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' refine_hist # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' 8 3 'Structure model' '_refine_hist.d_res_low' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 z,x,y 3 y,z,x 4 -y,-z,x 5 z,-x,-y 6 -y,z,-x 7 -z,-x,y 8 -z,x,-y 9 y,-z,-x 10 x,-y,-z 11 -x,y,-z 12 -x,-y,z 13 x+1/2,y+1/2,z+1/2 14 z+1/2,x+1/2,y+1/2 15 y+1/2,z+1/2,x+1/2 16 -y+1/2,-z+1/2,x+1/2 17 z+1/2,-x+1/2,-y+1/2 18 -y+1/2,z+1/2,-x+1/2 19 -z+1/2,-x+1/2,y+1/2 20 -z+1/2,x+1/2,-y+1/2 21 y+1/2,-z+1/2,-x+1/2 22 x+1/2,-y+1/2,-z+1/2 23 -x+1/2,y+1/2,-z+1/2 24 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3]_esd _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3]_esd 1 ? refined 22.9561967475 35.81675478 66.8799934734 0.566349404511 0.75568814147 0.704783258103 0.286961837306 0.0670534854386 -0.22877482665 8.13830711969 2.96618885681 4.45307648066 4.33268141887 -5.98226663888 -3.37134795125 -0.325254511501 1.29309221748 -0.560712737456 0.308508078124 -0.403732491672 0.236332474679 0.398937154373 0.160999427758 0.578215502082 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 ? refined 16.9759343976 35.3447825949 53.0068036393 0.312854504879 0.321786776391 0.327911611788 -0.0684646953315 0.0462631452561 0.0139279820417 4.56230699408 3.33094574648 3.98350246849 0.444545214472 -3.17060411651 2.15636598845 -0.303281270318 0.224618760959 -0.47568433032 0.198640586705 -0.116363946664 0.0113772986683 0.695631208799 -0.340573295366 0.378865137653 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 ? refined 16.9416205861 36.9794394425 46.5662841051 0.207788738707 0.223775853732 0.261533394737 0.0178092881026 -0.0766697422022 0.00478461298411 2.04235766663 1.5430345136 7.89138838561 0.530759425932 -2.85898146991 -0.446924079198 0.114132692881 -0.144538493782 -0.307857095441 0.017651062671 -0.131298412867 0.0667850185362 0.121128006572 0.231954840476 0.0339268548359 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4 ? refined 18.4345393097 36.1481928134 74.7717459895 0.404632725531 0.338554996145 0.233703497922 -0.119585163992 -0.0328352842416 0.00162653622316 0.956281109585 0.693899566477 0.909654521727 0.168347692435 -0.765115834664 -0.262046123758 0.0753227920113 -0.736537201559 -0.208550004102 0.372433550789 0.110360973675 -0.0970802782931 -0.140199194165 -0.282090668766 -0.19962096801 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id 1 1 ? ;chain 'U' and (resid 1 through 4 ) ; 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? 2 2 ? ;chain 'A' and (resid 19 through 68 ) ; 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? 3 3 ? ;chain 'A' and (resid 69 through 109 ) ; 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? 4 4 ? ;chain 'A' and (resid 110 through 130 ) ; 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 59 ? ? -26.01 -54.92 2 1 ASN A 60 ? ? -140.74 22.84 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 24 ? CG ? A ARG 24 CG 2 1 Y 1 A ARG 24 ? CD ? A ARG 24 CD 3 1 Y 1 A ARG 24 ? NE ? A ARG 24 NE 4 1 Y 1 A ARG 24 ? CZ ? A ARG 24 CZ 5 1 Y 1 A ARG 24 ? NH1 ? A ARG 24 NH1 6 1 Y 1 A ARG 24 ? NH2 ? A ARG 24 NH2 7 1 Y 1 A ARG 34 ? CG ? A ARG 34 CG 8 1 Y 1 A ARG 34 ? CD ? A ARG 34 CD 9 1 Y 1 A ARG 34 ? NE ? A ARG 34 NE 10 1 Y 1 A ARG 34 ? CZ ? A ARG 34 CZ 11 1 Y 1 A ARG 34 ? NH1 ? A ARG 34 NH1 12 1 Y 1 A ARG 34 ? NH2 ? A ARG 34 NH2 13 1 Y 1 A ASP 37 ? CG ? A ASP 37 CG 14 1 Y 1 A ASP 37 ? OD1 ? A ASP 37 OD1 15 1 Y 1 A ASP 37 ? OD2 ? A ASP 37 OD2 16 1 Y 1 A LYS 38 ? CD ? A LYS 38 CD 17 1 Y 1 A LYS 38 ? CE ? A LYS 38 CE 18 1 Y 1 A LYS 38 ? NZ ? A LYS 38 NZ 19 1 Y 1 A ASP 51 ? CG ? A ASP 51 CG 20 1 Y 1 A ASP 51 ? OD1 ? A ASP 51 OD1 21 1 Y 1 A ASP 51 ? OD2 ? A ASP 51 OD2 22 1 Y 1 A ASP 54 ? CG ? A ASP 54 CG 23 1 Y 1 A ASP 54 ? OD1 ? A ASP 54 OD1 24 1 Y 1 A ASP 54 ? OD2 ? A ASP 54 OD2 25 1 Y 1 A ASP 56 ? OD1 ? A ASP 56 OD1 26 1 Y 1 A ASP 56 ? OD2 ? A ASP 56 OD2 27 1 Y 1 A GLU 76 ? CG ? A GLU 76 CG 28 1 Y 1 A GLU 76 ? CD ? A GLU 76 CD 29 1 Y 1 A GLU 76 ? OE1 ? A GLU 76 OE1 30 1 Y 1 A GLU 76 ? OE2 ? A GLU 76 OE2 31 1 Y 1 A GLU 95 ? CG ? A GLU 95 CG 32 1 Y 1 A GLU 95 ? CD ? A GLU 95 CD 33 1 Y 1 A GLU 95 ? OE1 ? A GLU 95 OE1 34 1 Y 1 A GLU 95 ? OE2 ? A GLU 95 OE2 35 1 Y 1 A ARG 101 ? NE ? A ARG 101 NE 36 1 Y 1 A ARG 101 ? CZ ? A ARG 101 CZ 37 1 Y 1 A ARG 101 ? NH1 ? A ARG 101 NH1 38 1 Y 1 A ARG 101 ? NH2 ? A ARG 101 NH2 39 1 Y 1 A GLU 108 ? OE1 ? A GLU 108 OE1 40 1 Y 1 A GLU 108 ? OE2 ? A GLU 108 OE2 41 1 Y 1 A GLU 119 ? CG ? A GLU 119 CG 42 1 Y 1 A GLU 119 ? CD ? A GLU 119 CD 43 1 Y 1 A GLU 119 ? OE1 ? A GLU 119 OE1 44 1 Y 1 A GLU 119 ? OE2 ? A GLU 119 OE2 45 1 Y 1 A LYS 125 ? CG ? A LYS 125 CG 46 1 Y 1 A LYS 125 ? CD ? A LYS 125 CD 47 1 Y 1 A LYS 125 ? CE ? A LYS 125 CE 48 1 Y 1 A LYS 125 ? NZ ? A LYS 125 NZ 49 1 Y 1 A ARG 130 ? CG ? A ARG 130 CG 50 1 Y 1 A ARG 130 ? CD ? A ARG 130 CD 51 1 Y 1 A ARG 130 ? NE ? A ARG 130 NE 52 1 Y 1 A ARG 130 ? CZ ? A ARG 130 CZ 53 1 Y 1 A ARG 130 ? NH1 ? A ARG 130 NH1 54 1 Y 1 A ARG 130 ? NH2 ? A ARG 130 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A MET 3 ? A MET 3 4 1 Y 1 A ARG 4 ? A ARG 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A PRO 7 ? A PRO 7 8 1 Y 1 A PHE 8 ? A PHE 8 9 1 Y 1 A ARG 9 ? A ARG 9 10 1 Y 1 A ASP 10 ? A ASP 10 11 1 Y 1 A LEU 11 ? A LEU 11 12 1 Y 1 A ASP 12 ? A ASP 12 13 1 Y 1 A ARG 13 ? A ARG 13 14 1 Y 1 A PHE 14 ? A PHE 14 15 1 Y 1 A ALA 15 ? A ALA 15 16 1 Y 1 A GLN 16 ? A GLN 16 17 1 Y 1 A GLN 17 ? A GLN 17 18 1 Y 1 A VAL 18 ? A VAL 18 19 1 Y 1 A GLY 131 ? A GLY 131 20 1 Y 1 A ALA 132 ? A ALA 132 21 1 Y 1 A GLY 133 ? A GLY 133 22 1 Y 1 A ASP 134 ? A ASP 134 23 1 Y 1 A LYS 135 ? A LYS 135 24 1 Y 1 A THR 136 ? A THR 136 25 1 Y 1 A ILE 137 ? A ILE 137 26 1 Y 1 A SER 138 ? A SER 138 27 1 Y 1 A GLU 139 ? A GLU 139 28 1 Y 1 A ASN 140 ? A ASN 140 29 1 Y 1 A GLY 141 ? A GLY 141 30 1 Y 1 A ALA 142 ? A ALA 142 31 1 Y 1 A HIS 143 ? A HIS 143 32 1 Y 1 A PRO 144 ? A PRO 144 33 1 Y 1 A GLU 145 ? A GLU 145 34 1 Y 1 A VAL 146 ? A VAL 146 35 1 Y 1 A ILE 147 ? A ILE 147 36 1 Y 1 A GLU 148 ? A GLU 148 37 1 Y 1 A ALA 149 ? A ALA 149 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 NA NA NA N N 237 PEG C1 C N N 238 PEG O1 O N N 239 PEG C2 C N N 240 PEG O2 O N N 241 PEG C3 C N N 242 PEG C4 C N N 243 PEG O4 O N N 244 PEG H11 H N N 245 PEG H12 H N N 246 PEG HO1 H N N 247 PEG H21 H N N 248 PEG H22 H N N 249 PEG H31 H N N 250 PEG H32 H N N 251 PEG H41 H N N 252 PEG H42 H N N 253 PEG HO4 H N N 254 PHE N N N N 255 PHE CA C N S 256 PHE C C N N 257 PHE O O N N 258 PHE CB C N N 259 PHE CG C Y N 260 PHE CD1 C Y N 261 PHE CD2 C Y N 262 PHE CE1 C Y N 263 PHE CE2 C Y N 264 PHE CZ C Y N 265 PHE OXT O N N 266 PHE H H N N 267 PHE H2 H N N 268 PHE HA H N N 269 PHE HB2 H N N 270 PHE HB3 H N N 271 PHE HD1 H N N 272 PHE HD2 H N N 273 PHE HE1 H N N 274 PHE HE2 H N N 275 PHE HZ H N N 276 PHE HXT H N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PEG C1 O1 sing N N 224 PEG C1 C2 sing N N 225 PEG C1 H11 sing N N 226 PEG C1 H12 sing N N 227 PEG O1 HO1 sing N N 228 PEG C2 O2 sing N N 229 PEG C2 H21 sing N N 230 PEG C2 H22 sing N N 231 PEG O2 C3 sing N N 232 PEG C3 C4 sing N N 233 PEG C3 H31 sing N N 234 PEG C3 H32 sing N N 235 PEG C4 O4 sing N N 236 PEG C4 H41 sing N N 237 PEG C4 H42 sing N N 238 PEG O4 HO4 sing N N 239 PHE N CA sing N N 240 PHE N H sing N N 241 PHE N H2 sing N N 242 PHE CA C sing N N 243 PHE CA CB sing N N 244 PHE CA HA sing N N 245 PHE C O doub N N 246 PHE C OXT sing N N 247 PHE CB CG sing N N 248 PHE CB HB2 sing N N 249 PHE CB HB3 sing N N 250 PHE CG CD1 doub Y N 251 PHE CG CD2 sing Y N 252 PHE CD1 CE1 sing Y N 253 PHE CD1 HD1 sing N N 254 PHE CD2 CE2 doub Y N 255 PHE CD2 HD2 sing N N 256 PHE CE1 CZ doub Y N 257 PHE CE1 HE1 sing N N 258 PHE CE2 CZ sing Y N 259 PHE CE2 HE2 sing N N 260 PHE CZ HZ sing N N 261 PHE OXT HXT sing N N 262 PRO N CA sing N N 263 PRO N CD sing N N 264 PRO N H sing N N 265 PRO CA C sing N N 266 PRO CA CB sing N N 267 PRO CA HA sing N N 268 PRO C O doub N N 269 PRO C OXT sing N N 270 PRO CB CG sing N N 271 PRO CB HB2 sing N N 272 PRO CB HB3 sing N N 273 PRO CG CD sing N N 274 PRO CG HG2 sing N N 275 PRO CG HG3 sing N N 276 PRO CD HD2 sing N N 277 PRO CD HD3 sing N N 278 PRO OXT HXT sing N N 279 SER N CA sing N N 280 SER N H sing N N 281 SER N H2 sing N N 282 SER CA C sing N N 283 SER CA CB sing N N 284 SER CA HA sing N N 285 SER C O doub N N 286 SER C OXT sing N N 287 SER CB OG sing N N 288 SER CB HB2 sing N N 289 SER CB HB3 sing N N 290 SER OG HG sing N N 291 SER OXT HXT sing N N 292 THR N CA sing N N 293 THR N H sing N N 294 THR N H2 sing N N 295 THR CA C sing N N 296 THR CA CB sing N N 297 THR CA HA sing N N 298 THR C O doub N N 299 THR C OXT sing N N 300 THR CB OG1 sing N N 301 THR CB CG2 sing N N 302 THR CB HB sing N N 303 THR OG1 HG1 sing N N 304 THR CG2 HG21 sing N N 305 THR CG2 HG22 sing N N 306 THR CG2 HG23 sing N N 307 THR OXT HXT sing N N 308 TRP N CA sing N N 309 TRP N H sing N N 310 TRP N H2 sing N N 311 TRP CA C sing N N 312 TRP CA CB sing N N 313 TRP CA HA sing N N 314 TRP C O doub N N 315 TRP C OXT sing N N 316 TRP CB CG sing N N 317 TRP CB HB2 sing N N 318 TRP CB HB3 sing N N 319 TRP CG CD1 doub Y N 320 TRP CG CD2 sing Y N 321 TRP CD1 NE1 sing Y N 322 TRP CD1 HD1 sing N N 323 TRP CD2 CE2 doub Y N 324 TRP CD2 CE3 sing Y N 325 TRP NE1 CE2 sing Y N 326 TRP NE1 HE1 sing N N 327 TRP CE2 CZ2 sing Y N 328 TRP CE3 CZ3 doub Y N 329 TRP CE3 HE3 sing N N 330 TRP CZ2 CH2 doub Y N 331 TRP CZ2 HZ2 sing N N 332 TRP CZ3 CH2 sing Y N 333 TRP CZ3 HZ3 sing N N 334 TRP CH2 HH2 sing N N 335 TRP OXT HXT sing N N 336 TYR N CA sing N N 337 TYR N H sing N N 338 TYR N H2 sing N N 339 TYR CA C sing N N 340 TYR CA CB sing N N 341 TYR CA HA sing N N 342 TYR C O doub N N 343 TYR C OXT sing N N 344 TYR CB CG sing N N 345 TYR CB HB2 sing N N 346 TYR CB HB3 sing N N 347 TYR CG CD1 doub Y N 348 TYR CG CD2 sing Y N 349 TYR CD1 CE1 sing Y N 350 TYR CD1 HD1 sing N N 351 TYR CD2 CE2 doub Y N 352 TYR CD2 HD2 sing N N 353 TYR CE1 CZ doub Y N 354 TYR CE1 HE1 sing N N 355 TYR CE2 CZ sing Y N 356 TYR CE2 HE2 sing N N 357 TYR CZ OH sing N N 358 TYR OH HH sing N N 359 TYR OXT HXT sing N N 360 VAL N CA sing N N 361 VAL N H sing N N 362 VAL N H2 sing N N 363 VAL CA C sing N N 364 VAL CA CB sing N N 365 VAL CA HA sing N N 366 VAL C O doub N N 367 VAL C OXT sing N N 368 VAL CB CG1 sing N N 369 VAL CB CG2 sing N N 370 VAL CB HB sing N N 371 VAL CG1 HG11 sing N N 372 VAL CG1 HG12 sing N N 373 VAL CG1 HG13 sing N N 374 VAL CG2 HG21 sing N N 375 VAL CG2 HG22 sing N N 376 VAL CG2 HG23 sing N N 377 VAL OXT HXT sing N N 378 # _pdbx_audit_support.funding_organization ? _pdbx_audit_support.country India _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'DI(HYDROXYETHYL)ETHER' PEG 4 PROLINE PRO 5 'CHLORIDE ION' CL 6 'SODIUM ION' NA 7 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1GME _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ;SEC-MALS Dynamic Light Scattering Native-PAGE gels ; # _space_group.name_H-M_alt 'I 2 3' _space_group.name_Hall 'I 2 2 3' _space_group.IT_number 197 _space_group.crystal_system cubic _space_group.id 1 #