data_5ZYS # _entry.id 5ZYS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZYS pdb_00005zys 10.2210/pdb5zys/pdb WWPDB D_1300007881 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-23 2 'Structure model' 2 0 2019-12-11 3 'Structure model' 2 1 2024-03-27 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' author 'Coordinate replacement' 'Sequence discrepancy' ;there is one residue mismatch the nephrin sequence. So we replaced the previous sequence (LPFELPGHLV) with the real sequence (LPFELRGHLV) used in the crystal experiment. ; # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Polymer sequence' 5 2 'Structure model' 'Refinement description' 6 2 'Structure model' 'Structure summary' 7 3 'Structure model' 'Data collection' 8 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' diffrn 3 2 'Structure model' entity 4 2 'Structure model' entity_poly 5 2 'Structure model' entity_poly_seq 6 2 'Structure model' pdbx_nonpoly_scheme 7 2 'Structure model' pdbx_poly_seq_scheme 8 2 'Structure model' pdbx_struct_sheet_hbond 9 2 'Structure model' refine 10 2 'Structure model' refine_hist 11 2 'Structure model' refine_ls_shell 12 2 'Structure model' reflns 13 2 'Structure model' software 14 2 'Structure model' struct_sheet_range 15 3 'Structure model' chem_comp_atom 16 3 'Structure model' chem_comp_bond 17 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn.pdbx_serial_crystal_experiment' 2 2 'Structure model' '_entity.formula_weight' 3 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 4 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 5 2 'Structure model' '_entity_poly_seq.mon_id' 6 2 'Structure model' '_pdbx_nonpoly_scheme.asym_id' 7 2 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num' 8 2 'Structure model' '_pdbx_nonpoly_scheme.ndb_seq_num' 9 2 'Structure model' '_pdbx_nonpoly_scheme.pdb_seq_num' 10 2 'Structure model' '_pdbx_nonpoly_scheme.pdb_strand_id' 11 2 'Structure model' '_pdbx_poly_seq_scheme.auth_mon_id' 12 2 'Structure model' '_pdbx_poly_seq_scheme.mon_id' 13 2 'Structure model' '_pdbx_poly_seq_scheme.pdb_mon_id' 14 2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_comp_id' 15 2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_seq_id' 16 2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_comp_id' 17 2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_seq_id' 18 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_comp_id' 19 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_seq_id' 20 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_comp_id' 21 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id' 22 2 'Structure model' '_refine.ls_number_reflns_R_work' 23 2 'Structure model' '_refine.overall_FOM_work_R_set' 24 2 'Structure model' '_refine.pdbx_R_Free_selection_details' 25 2 'Structure model' '_refine.pdbx_method_to_determine_struct' 26 2 'Structure model' '_refine.pdbx_stereochemistry_target_values' 27 2 'Structure model' '_refine.solvent_model_details' 28 2 'Structure model' '_refine_hist.number_atoms_total' 29 2 'Structure model' '_refine_hist.pdbx_number_atoms_protein' 30 2 'Structure model' '_refine_ls_shell.d_res_high' 31 2 'Structure model' '_refine_ls_shell.d_res_low' 32 2 'Structure model' '_refine_ls_shell.number_reflns_all' 33 2 'Structure model' '_refine_ls_shell.pdbx_total_number_of_bins_used' 34 2 'Structure model' '_reflns.pdbx_number_measured_all' 35 2 'Structure model' '_software.classification' 36 2 'Structure model' '_software.name' 37 2 'Structure model' '_software.version' 38 2 'Structure model' '_struct_sheet_range.end_auth_comp_id' 39 2 'Structure model' '_struct_sheet_range.end_auth_seq_id' 40 2 'Structure model' '_struct_sheet_range.end_label_comp_id' 41 2 'Structure model' '_struct_sheet_range.end_label_seq_id' 42 3 'Structure model' '_database_2.pdbx_DOI' 43 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZYS _pdbx_database_status.recvd_initial_deposition_date 2018-05-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Weng, Z.F.' 1 ? 'Shng, Y.' 2 ? 'Zhu, J.W.' 3 ? 'Zhang, R.G.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Am. Soc. Nephrol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1533-3450 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 2362 _citation.page_last 2371 _citation.title 'Structural Basis of Highly Specific Interaction between Nephrin and MAGI1 in Slit Diaphragm Assembly and Signaling.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1681/ASN.2017121275 _citation.pdbx_database_id_PubMed 30006415 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Weng, Z.' 1 ? primary 'Shang, Y.' 2 ? primary 'Ji, Z.' 3 ? primary 'Ye, F.' 4 ? primary 'Lin, L.' 5 ? primary 'Zhang, R.' 6 ? primary 'Zhu, J.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1' 10576.033 1 ? ? ? ? 2 polymer syn Nephrin 1182.414 1 ? ? ? ? 3 water nat water 18.015 88 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BAI1-associated protein 1,BAP-1,Membrane-associated guanylate kinase inverted 1,MAGI-1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GPGSIPDYQEQDIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQ QAAKQGHVNLTVRRKVV ; ;GPGSIPDYQEQDIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQ QAAKQGHVNLTVRRKVV ; A ? 2 'polypeptide(L)' no no LPFELRGHLV LPFELRGHLV B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 ILE n 1 6 PRO n 1 7 ASP n 1 8 TYR n 1 9 GLN n 1 10 GLU n 1 11 GLN n 1 12 ASP n 1 13 ILE n 1 14 PHE n 1 15 LEU n 1 16 TRP n 1 17 ARG n 1 18 LYS n 1 19 GLU n 1 20 THR n 1 21 GLY n 1 22 PHE n 1 23 GLY n 1 24 PHE n 1 25 ARG n 1 26 ILE n 1 27 LEU n 1 28 GLY n 1 29 GLY n 1 30 ASN n 1 31 GLU n 1 32 PRO n 1 33 GLY n 1 34 GLU n 1 35 PRO n 1 36 ILE n 1 37 TYR n 1 38 ILE n 1 39 GLY n 1 40 HIS n 1 41 ILE n 1 42 VAL n 1 43 PRO n 1 44 LEU n 1 45 GLY n 1 46 ALA n 1 47 ALA n 1 48 ASP n 1 49 THR n 1 50 ASP n 1 51 GLY n 1 52 ARG n 1 53 LEU n 1 54 ARG n 1 55 SER n 1 56 GLY n 1 57 ASP n 1 58 GLU n 1 59 LEU n 1 60 ILE n 1 61 CYS n 1 62 VAL n 1 63 ASP n 1 64 GLY n 1 65 THR n 1 66 PRO n 1 67 VAL n 1 68 ILE n 1 69 GLY n 1 70 LYS n 1 71 SER n 1 72 HIS n 1 73 GLN n 1 74 LEU n 1 75 VAL n 1 76 VAL n 1 77 GLN n 1 78 LEU n 1 79 MET n 1 80 GLN n 1 81 GLN n 1 82 ALA n 1 83 ALA n 1 84 LYS n 1 85 GLN n 1 86 GLY n 1 87 HIS n 1 88 VAL n 1 89 ASN n 1 90 LEU n 1 91 THR n 1 92 VAL n 1 93 ARG n 1 94 ARG n 1 95 LYS n 1 96 VAL n 1 97 VAL n 2 1 LEU n 2 2 PRO n 2 3 PHE n 2 4 GLU n 2 5 LEU n 2 6 ARG n 2 7 GLY n 2 8 HIS n 2 9 LEU n 2 10 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 97 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Magi1, Baiap1, Bap1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 10 _pdbx_entity_src_syn.organism_scientific 'Mus musculus' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 10090 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 822 ? ? ? A . n A 1 2 PRO 2 823 ? ? ? A . n A 1 3 GLY 3 824 ? ? ? A . n A 1 4 SER 4 825 ? ? ? A . n A 1 5 ILE 5 826 ? ? ? A . n A 1 6 PRO 6 827 ? ? ? A . n A 1 7 ASP 7 828 828 ASP ASP A . n A 1 8 TYR 8 829 829 TYR TYR A . n A 1 9 GLN 9 830 830 GLN GLN A . n A 1 10 GLU 10 831 831 GLU GLU A . n A 1 11 GLN 11 832 832 GLN GLN A . n A 1 12 ASP 12 833 833 ASP ASP A . n A 1 13 ILE 13 834 834 ILE ILE A . n A 1 14 PHE 14 835 835 PHE PHE A . n A 1 15 LEU 15 836 836 LEU LEU A . n A 1 16 TRP 16 837 837 TRP TRP A . n A 1 17 ARG 17 838 838 ARG ARG A . n A 1 18 LYS 18 839 839 LYS LYS A . n A 1 19 GLU 19 840 840 GLU GLU A . n A 1 20 THR 20 841 841 THR THR A . n A 1 21 GLY 21 842 842 GLY GLY A . n A 1 22 PHE 22 843 843 PHE PHE A . n A 1 23 GLY 23 844 844 GLY GLY A . n A 1 24 PHE 24 845 845 PHE PHE A . n A 1 25 ARG 25 846 846 ARG ARG A . n A 1 26 ILE 26 847 847 ILE ILE A . n A 1 27 LEU 27 848 848 LEU LEU A . n A 1 28 GLY 28 849 849 GLY GLY A . n A 1 29 GLY 29 850 850 GLY GLY A . n A 1 30 ASN 30 851 851 ASN ASN A . n A 1 31 GLU 31 852 852 GLU GLU A . n A 1 32 PRO 32 853 853 PRO PRO A . n A 1 33 GLY 33 854 854 GLY GLY A . n A 1 34 GLU 34 855 855 GLU GLU A . n A 1 35 PRO 35 856 856 PRO PRO A . n A 1 36 ILE 36 857 857 ILE ILE A . n A 1 37 TYR 37 858 858 TYR TYR A . n A 1 38 ILE 38 859 859 ILE ILE A . n A 1 39 GLY 39 860 860 GLY GLY A . n A 1 40 HIS 40 861 861 HIS HIS A . n A 1 41 ILE 41 862 862 ILE ILE A . n A 1 42 VAL 42 863 863 VAL VAL A . n A 1 43 PRO 43 864 864 PRO PRO A . n A 1 44 LEU 44 865 865 LEU LEU A . n A 1 45 GLY 45 866 866 GLY GLY A . n A 1 46 ALA 46 867 867 ALA ALA A . n A 1 47 ALA 47 868 868 ALA ALA A . n A 1 48 ASP 48 869 869 ASP ASP A . n A 1 49 THR 49 870 870 THR THR A . n A 1 50 ASP 50 871 871 ASP ASP A . n A 1 51 GLY 51 872 872 GLY GLY A . n A 1 52 ARG 52 873 873 ARG ARG A . n A 1 53 LEU 53 874 874 LEU LEU A . n A 1 54 ARG 54 875 875 ARG ARG A . n A 1 55 SER 55 876 876 SER SER A . n A 1 56 GLY 56 877 877 GLY GLY A . n A 1 57 ASP 57 878 878 ASP ASP A . n A 1 58 GLU 58 879 879 GLU GLU A . n A 1 59 LEU 59 880 880 LEU LEU A . n A 1 60 ILE 60 881 881 ILE ILE A . n A 1 61 CYS 61 882 882 CYS CYS A . n A 1 62 VAL 62 883 883 VAL VAL A . n A 1 63 ASP 63 884 884 ASP ASP A . n A 1 64 GLY 64 885 885 GLY GLY A . n A 1 65 THR 65 886 886 THR THR A . n A 1 66 PRO 66 887 887 PRO PRO A . n A 1 67 VAL 67 888 888 VAL VAL A . n A 1 68 ILE 68 889 889 ILE ILE A . n A 1 69 GLY 69 890 890 GLY GLY A . n A 1 70 LYS 70 891 891 LYS LYS A . n A 1 71 SER 71 892 892 SER SER A . n A 1 72 HIS 72 893 893 HIS HIS A . n A 1 73 GLN 73 894 894 GLN GLN A . n A 1 74 LEU 74 895 895 LEU LEU A . n A 1 75 VAL 75 896 896 VAL VAL A . n A 1 76 VAL 76 897 897 VAL VAL A . n A 1 77 GLN 77 898 898 GLN GLN A . n A 1 78 LEU 78 899 899 LEU LEU A . n A 1 79 MET 79 900 900 MET MET A . n A 1 80 GLN 80 901 901 GLN GLN A . n A 1 81 GLN 81 902 902 GLN GLN A . n A 1 82 ALA 82 903 903 ALA ALA A . n A 1 83 ALA 83 904 904 ALA ALA A . n A 1 84 LYS 84 905 905 LYS LYS A . n A 1 85 GLN 85 906 906 GLN GLN A . n A 1 86 GLY 86 907 907 GLY GLY A . n A 1 87 HIS 87 908 908 HIS HIS A . n A 1 88 VAL 88 909 909 VAL VAL A . n A 1 89 ASN 89 910 910 ASN ASN A . n A 1 90 LEU 90 911 911 LEU LEU A . n A 1 91 THR 91 912 912 THR THR A . n A 1 92 VAL 92 913 913 VAL VAL A . n A 1 93 ARG 93 914 914 ARG ARG A . n A 1 94 ARG 94 915 915 ARG ARG A . n A 1 95 LYS 95 916 916 LYS LYS A . n A 1 96 VAL 96 917 917 VAL VAL A . n A 1 97 VAL 97 918 ? ? ? A . n B 2 1 LEU 1 1247 1247 LEU LEU B . n B 2 2 PRO 2 1248 1248 PRO PRO B . n B 2 3 PHE 3 1249 1249 PHE PHE B . n B 2 4 GLU 4 1250 1250 GLU GLU B . n B 2 5 LEU 5 1251 1251 LEU LEU B . n B 2 6 ARG 6 1252 1252 ARG ARG B . n B 2 7 GLY 7 1253 1253 GLY GLY B . n B 2 8 HIS 8 1254 1254 HIS HIS B . n B 2 9 LEU 9 1255 1255 LEU LEU B . n B 2 10 VAL 10 1256 1256 VAL VAL B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 1001 67 HOH HOH A . C 3 HOH 2 1002 27 HOH HOH A . C 3 HOH 3 1003 60 HOH HOH A . C 3 HOH 4 1004 26 HOH HOH A . C 3 HOH 5 1005 44 HOH HOH A . C 3 HOH 6 1006 83 HOH HOH A . C 3 HOH 7 1007 30 HOH HOH A . C 3 HOH 8 1008 17 HOH HOH A . C 3 HOH 9 1009 65 HOH HOH A . C 3 HOH 10 1010 11 HOH HOH A . C 3 HOH 11 1011 2 HOH HOH A . C 3 HOH 12 1012 4 HOH HOH A . C 3 HOH 13 1013 58 HOH HOH A . C 3 HOH 14 1014 63 HOH HOH A . C 3 HOH 15 1015 16 HOH HOH A . C 3 HOH 16 1016 13 HOH HOH A . C 3 HOH 17 1017 9 HOH HOH A . C 3 HOH 18 1018 6 HOH HOH A . C 3 HOH 19 1019 54 HOH HOH A . C 3 HOH 20 1020 8 HOH HOH A . C 3 HOH 21 1021 21 HOH HOH A . C 3 HOH 22 1022 5 HOH HOH A . C 3 HOH 23 1023 25 HOH HOH A . C 3 HOH 24 1024 33 HOH HOH A . C 3 HOH 25 1025 18 HOH HOH A . C 3 HOH 26 1026 1 HOH HOH A . C 3 HOH 27 1027 71 HOH HOH A . C 3 HOH 28 1028 36 HOH HOH A . C 3 HOH 29 1029 37 HOH HOH A . C 3 HOH 30 1030 99 HOH HOH A . C 3 HOH 31 1031 23 HOH HOH A . C 3 HOH 32 1032 14 HOH HOH A . C 3 HOH 33 1033 69 HOH HOH A . C 3 HOH 34 1034 29 HOH HOH A . C 3 HOH 35 1035 34 HOH HOH A . C 3 HOH 36 1036 10 HOH HOH A . C 3 HOH 37 1037 66 HOH HOH A . C 3 HOH 38 1038 43 HOH HOH A . C 3 HOH 39 1039 86 HOH HOH A . C 3 HOH 40 1040 46 HOH HOH A . C 3 HOH 41 1041 22 HOH HOH A . C 3 HOH 42 1042 41 HOH HOH A . C 3 HOH 43 1043 28 HOH HOH A . C 3 HOH 44 1044 7 HOH HOH A . C 3 HOH 45 1045 45 HOH HOH A . C 3 HOH 46 1046 19 HOH HOH A . C 3 HOH 47 1047 31 HOH HOH A . C 3 HOH 48 1048 57 HOH HOH A . C 3 HOH 49 1049 48 HOH HOH A . C 3 HOH 50 1050 62 HOH HOH A . C 3 HOH 51 1051 15 HOH HOH A . C 3 HOH 52 1052 88 HOH HOH A . C 3 HOH 53 1053 39 HOH HOH A . C 3 HOH 54 1054 38 HOH HOH A . C 3 HOH 55 1055 82 HOH HOH A . C 3 HOH 56 1056 40 HOH HOH A . C 3 HOH 57 1057 12 HOH HOH A . C 3 HOH 58 1058 49 HOH HOH A . C 3 HOH 59 1059 50 HOH HOH A . C 3 HOH 60 1060 80 HOH HOH A . C 3 HOH 61 1061 78 HOH HOH A . C 3 HOH 62 1062 52 HOH HOH A . C 3 HOH 63 1063 85 HOH HOH A . C 3 HOH 64 1064 59 HOH HOH A . C 3 HOH 65 1065 76 HOH HOH A . C 3 HOH 66 1066 61 HOH HOH A . C 3 HOH 67 1067 96 HOH HOH A . C 3 HOH 68 1068 106 HOH HOH A . C 3 HOH 69 1069 53 HOH HOH A . C 3 HOH 70 1070 98 HOH HOH A . C 3 HOH 71 1071 77 HOH HOH A . C 3 HOH 72 1072 94 HOH HOH A . C 3 HOH 73 1073 95 HOH HOH A . C 3 HOH 74 1074 79 HOH HOH A . C 3 HOH 75 1075 103 HOH HOH A . C 3 HOH 76 1076 72 HOH HOH A . C 3 HOH 77 1077 42 HOH HOH A . D 3 HOH 1 1301 75 HOH HOH B . D 3 HOH 2 1302 24 HOH HOH B . D 3 HOH 3 1303 3 HOH HOH B . D 3 HOH 4 1304 20 HOH HOH B . D 3 HOH 5 1305 56 HOH HOH B . D 3 HOH 6 1306 32 HOH HOH B . D 3 HOH 7 1307 35 HOH HOH B . D 3 HOH 8 1308 51 HOH HOH B . D 3 HOH 9 1309 84 HOH HOH B . D 3 HOH 10 1310 87 HOH HOH B . D 3 HOH 11 1311 70 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 830 ? CG ? A GLN 9 CG 2 1 Y 1 A GLN 830 ? CD ? A GLN 9 CD 3 1 Y 1 A GLN 830 ? OE1 ? A GLN 9 OE1 4 1 Y 1 A GLN 830 ? NE2 ? A GLN 9 NE2 5 1 Y 1 A LYS 905 ? CG ? A LYS 84 CG 6 1 Y 1 A LYS 905 ? CD ? A LYS 84 CD 7 1 Y 1 A LYS 905 ? CE ? A LYS 84 CE 8 1 Y 1 A LYS 905 ? NZ ? A LYS 84 NZ 9 1 Y 1 A LYS 916 ? CG ? A LYS 95 CG 10 1 Y 1 A LYS 916 ? CD ? A LYS 95 CD 11 1 Y 1 A LYS 916 ? CE ? A LYS 95 CE 12 1 Y 1 A LYS 916 ? NZ ? A LYS 95 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.4_1496 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? d*TREK ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5ZYS _cell.details ? _cell.formula_units_Z ? _cell.length_a 93.731 _cell.length_a_esd ? _cell.length_b 93.731 _cell.length_b_esd ? _cell.length_c 93.731 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZYS _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZYS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.5M sodium chloride , 0.01M magnesium chloride hexahydrate , 0.01Mhexadecyltrimethylammonium bromide ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X 1M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-03-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97853 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NFPSS BEAMLINE BL18U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97853 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U _diffrn_source.pdbx_synchrotron_site NFPSS # _reflns.B_iso_Wilson_estimate 18.680 _reflns.entry_id 5ZYS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.780 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13086 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.900 _reflns.pdbx_Rmerge_I_obs 0.069 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.754 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.079 _reflns.pdbx_Rpim_I_all 0.037 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 51381 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.780 1.810 ? ? ? ? ? ? 683 99.900 ? ? ? ? 0.172 ? ? ? ? ? ? ? ? 3.600 ? 0.567 ? ? 0.202 0.102 ? 1 1 0.952 ? ? 1.810 1.840 ? ? ? ? ? ? 631 99.200 ? ? ? ? 0.167 ? ? ? ? ? ? ? ? 4.000 ? 0.583 ? ? 0.192 0.093 ? 2 1 0.962 ? ? 1.840 1.880 ? ? ? ? ? ? 658 99.100 ? ? ? ? 0.165 ? ? ? ? ? ? ? ? 4.100 ? 0.674 ? ? 0.189 0.091 ? 3 1 0.960 ? ? 1.880 1.920 ? ? ? ? ? ? 648 98.500 ? ? ? ? 0.143 ? ? ? ? ? ? ? ? 4.000 ? 0.722 ? ? 0.164 0.079 ? 4 1 0.975 ? ? 1.920 1.960 ? ? ? ? ? ? 656 98.900 ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 3.900 ? 0.675 ? ? 0.153 0.074 ? 5 1 0.975 ? ? 1.960 2.000 ? ? ? ? ? ? 639 98.900 ? ? ? ? 0.127 ? ? ? ? ? ? ? ? 3.900 ? 0.713 ? ? 0.147 0.072 ? 6 1 0.968 ? ? 2.000 2.050 ? ? ? ? ? ? 670 99.400 ? ? ? ? 0.114 ? ? ? ? ? ? ? ? 3.700 ? 0.739 ? ? 0.132 0.065 ? 7 1 0.975 ? ? 2.050 2.110 ? ? ? ? ? ? 649 99.800 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 3.800 ? 0.772 ? ? 0.117 0.057 ? 8 1 0.987 ? ? 2.110 2.170 ? ? ? ? ? ? 651 99.500 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 4.000 ? 0.789 ? ? 0.115 0.055 ? 9 1 0.981 ? ? 2.170 2.240 ? ? ? ? ? ? 663 99.400 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 4.000 ? 0.744 ? ? 0.106 0.051 ? 10 1 0.982 ? ? 2.240 2.320 ? ? ? ? ? ? 677 99.100 ? ? ? ? 0.089 ? ? ? ? ? ? ? ? 4.000 ? 0.777 ? ? 0.102 0.049 ? 11 1 0.982 ? ? 2.320 2.420 ? ? ? ? ? ? 626 97.400 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 3.900 ? 0.794 ? ? 0.098 0.047 ? 12 1 0.987 ? ? 2.420 2.530 ? ? ? ? ? ? 664 98.500 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 3.700 ? 0.689 ? ? 0.091 0.045 ? 13 1 0.988 ? ? 2.530 2.660 ? ? ? ? ? ? 646 99.500 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 4.000 ? 0.701 ? ? 0.086 0.041 ? 14 1 0.986 ? ? 2.660 2.830 ? ? ? ? ? ? 668 98.700 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 4.000 ? 0.713 ? ? 0.082 0.038 ? 15 1 0.988 ? ? 2.830 3.040 ? ? ? ? ? ? 660 97.900 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 4.000 ? 0.808 ? ? 0.076 0.035 ? 16 1 0.992 ? ? 3.040 3.350 ? ? ? ? ? ? 634 96.100 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 3.800 ? 0.809 ? ? 0.071 0.034 ? 17 1 0.991 ? ? 3.350 3.830 ? ? ? ? ? ? 655 97.200 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 4.100 ? 0.926 ? ? 0.065 0.030 ? 18 1 0.991 ? ? 3.830 4.830 ? ? ? ? ? ? 640 93.700 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 4.000 ? 0.976 ? ? 0.065 0.030 ? 19 1 0.993 ? ? 4.830 50.000 ? ? ? ? ? ? 668 92.800 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 4.000 ? 0.875 ? ? 0.064 0.030 ? 20 1 0.994 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 91.850 _refine.B_iso_mean 22.7400 _refine.B_iso_min 9.860 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ZYS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7800 _refine.ls_d_res_low 46.8650 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13083 _refine.ls_number_reflns_R_free 639 _refine.ls_number_reflns_R_work 12444 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.1200 _refine.ls_percent_reflns_R_free 4.8800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1822 _refine.ls_R_factor_R_free 0.2044 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1812 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.410 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.5300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8774 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.7800 _refine_hist.d_res_low 46.8650 _refine_hist.number_atoms_solvent 88 _refine_hist.number_atoms_total 861 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 100 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 30.97 _refine_hist.pdbx_number_atoms_protein 773 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 784 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.173 ? 1063 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.038 ? 118 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 141 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.579 ? 285 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7800 1.9170 . . 129 2490 99.0000 . . . 0.2229 0.0000 0.1858 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9170 2.1100 . . 113 2500 99.0000 . . . 0.1970 0.0000 0.1726 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1100 2.4153 . . 166 2451 99.0000 . . . 0.2063 0.0000 0.1791 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4153 3.0429 . . 124 2514 99.0000 . . . 0.1956 0.0000 0.1872 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0429 46.8650 . . 107 2489 95.0000 . . . 0.2069 0.0000 0.1803 . . . . . . . . . . . # _struct.entry_id 5ZYS _struct.title 'Structure of Nephrin/MAGI1 complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZYS _struct_keywords.text 'Slit diaphragm, Nephrotic syndrome, MAGI1- Nephrin complex, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MAGI1_MOUSE Q6RHR9 ? 1 ;IPDYQEQDIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQQAAK QGHVNLTVRRKVV ; 826 2 PDB 5ZYS 5ZYS ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5ZYS A 5 ? 97 ? Q6RHR9 826 ? 918 ? 826 918 2 2 5ZYS B 1 ? 10 ? 5ZYS 1247 ? 1256 ? 1247 1256 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ZYS GLY A 1 ? UNP Q6RHR9 ? ? 'expression tag' 822 1 1 5ZYS PRO A 2 ? UNP Q6RHR9 ? ? 'expression tag' 823 2 1 5ZYS GLY A 3 ? UNP Q6RHR9 ? ? 'expression tag' 824 3 1 5ZYS SER A 4 ? UNP Q6RHR9 ? ? 'expression tag' 825 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 990 ? 1 MORE -5 ? 1 'SSA (A^2)' 5710 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 45 ? GLY A 51 ? GLY A 866 GLY A 872 1 ? 7 HELX_P HELX_P2 AA2 SER A 71 ? GLY A 86 ? SER A 892 GLY A 907 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 8 ? TRP A 16 ? TYR A 829 TRP A 837 AA1 2 HIS A 87 ? LYS A 95 ? HIS A 908 LYS A 916 AA1 3 GLU A 58 ? VAL A 62 ? GLU A 879 VAL A 883 AA1 4 THR A 65 ? PRO A 66 ? THR A 886 PRO A 887 AA2 1 ILE A 36 ? ILE A 41 ? ILE A 857 ILE A 862 AA2 2 PHE A 24 ? GLY A 28 ? PHE A 845 GLY A 849 AA2 3 HIS B 8 ? LEU B 9 ? HIS B 1254 LEU B 1255 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 13 ? N ILE A 834 O LEU A 90 ? O LEU A 911 AA1 2 3 O ARG A 93 ? O ARG A 914 N GLU A 58 ? N GLU A 879 AA1 3 4 N VAL A 62 ? N VAL A 883 O THR A 65 ? O THR A 886 AA2 1 2 O GLY A 39 ? O GLY A 860 N ARG A 25 ? N ARG A 846 AA2 2 3 N ILE A 26 ? N ILE A 847 O HIS B 8 ? O HIS B 1254 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 1011 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 822 ? A GLY 1 2 1 Y 1 A PRO 823 ? A PRO 2 3 1 Y 1 A GLY 824 ? A GLY 3 4 1 Y 1 A SER 825 ? A SER 4 5 1 Y 1 A ILE 826 ? A ILE 5 6 1 Y 1 A PRO 827 ? A PRO 6 7 1 Y 1 A VAL 918 ? A VAL 97 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _atom_sites.entry_id 5ZYS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010669 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010669 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010669 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_