data_5AAQ # _entry.id 5AAQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5AAQ pdb_00005aaq 10.2210/pdb5aaq/pdb PDBE EBI-64530 ? ? WWPDB D_1290064530 ? ? BMRB 25734 ? 10.13018/BMR25734 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-13 2 'Structure model' 1 1 2016-08-31 3 'Structure model' 2 0 2019-10-23 4 'Structure model' 2 1 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' atom_site 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_struct_conn_angle 8 4 'Structure model' struct_conn 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_atom_site.Cartn_x' 2 3 'Structure model' '_atom_site.Cartn_y' 3 3 'Structure model' '_atom_site.Cartn_z' 4 3 'Structure model' '_pdbx_database_status.status_code_cs' 5 3 'Structure model' '_pdbx_database_status.status_code_mr' 6 3 'Structure model' '_pdbx_nmr_spectrometer.model' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.value' 20 4 'Structure model' '_struct_conn.pdbx_dist_value' 21 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 33 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 34 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 35 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 5AAQ _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2015-07-28 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 5AAS unspecified 'THE SELECTIVE AUTOPHAGY RECEPTOR TAX1BP1 IS REQUIRED FOR AUTOPHAGY-DEPENDENT CAPTURE OF CYTOSOLIC SALMONELLA TYPHIMURIUM' PDB 5AAY unspecified 'TBK1 RECRUITMENT TO CYTOSOL-INVADING SALMONELLA INDUCES ANTI-BACTERIAL AUTOPHAGY' PDB 5AAZ unspecified 'TBK1 RECRUITMENT TO CYTOSOL-INVADING SALMONELLA INDUCES ANTI-BACTERIAL AUTOPHAGY' BMRB 25734 unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Thurston, T.L.' 1 'Allen, M.D.' 2 'Ravenhill, B.' 3 'Karpiyevitch, M.' 4 'Bloor, S.' 5 'Kaul, A.' 6 'Matthews, S.' 7 'Komander, D.' 8 'Holden, D.' 9 'Bycroft, M.' 10 'Randow, F.' 11 # _citation.id primary _citation.title 'Recruitment of Tbk1 to Cytosol-Invading Salmonella Induces Wipi2-Dependent Antibacterial Autophagy.' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 35 _citation.page_first 1779 _citation.page_last ? _citation.year 2016 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27370208 _citation.pdbx_database_id_DOI 10.15252/EMBJ.201694491 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Thurston, T.L.' 1 ? primary 'Boyle, K.B.' 2 ? primary 'Allen, M.' 3 ? primary 'Ravenhill, B.J.' 4 ? primary 'Karpiyevich, M.' 5 ? primary 'Bloor, S.' 6 ? primary 'Kaul, A.' 7 ? primary 'Noad, J.' 8 ? primary 'Foeglein, A.' 9 ? primary 'Matthews, S.A.' 10 ? primary 'Komander, D.' 11 ? primary 'Bycroft, M.' 12 ? primary 'Randow, F.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CALCIUM-BINDING AND COILED-COIL DOMAIN-CONTAINING PROTEIN 2' 6800.896 1 ? ? 'UNP RESIDUES 388-446' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ANTIGEN NUCLEAR DOT 52 KDA PROTEIN, NUCLEAR DOMAIN 10 PROTEIN NDP52, NUCLEAR DOMAIN 10 PROTEIN 52, NDP52 ZINC FINGER' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL _entity_poly.pdbx_seq_one_letter_code_can GSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 SER n 1 5 PRO n 1 6 LEU n 1 7 SER n 1 8 ILE n 1 9 LYS n 1 10 LYS n 1 11 CYS n 1 12 PRO n 1 13 ILE n 1 14 CYS n 1 15 LYS n 1 16 ALA n 1 17 ASP n 1 18 ASP n 1 19 ILE n 1 20 CYS n 1 21 ASP n 1 22 HIS n 1 23 THR n 1 24 LEU n 1 25 GLU n 1 26 GLN n 1 27 GLN n 1 28 GLN n 1 29 MET n 1 30 GLN n 1 31 PRO n 1 32 LEU n 1 33 CYS n 1 34 PHE n 1 35 ASN n 1 36 CYS n 1 37 PRO n 1 38 ILE n 1 39 CYS n 1 40 ASP n 1 41 LYS n 1 42 ILE n 1 43 PHE n 1 44 PRO n 1 45 ALA n 1 46 THR n 1 47 GLU n 1 48 LYS n 1 49 GLN n 1 50 ILE n 1 51 PHE n 1 52 GLU n 1 53 ASP n 1 54 HIS n 1 55 VAL n 1 56 PHE n 1 57 CYS n 1 58 HIS n 1 59 SER n 1 60 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant C41 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name HLTV _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 387 ? ? ? A . n A 1 2 SER 2 388 ? ? ? A . n A 1 3 PRO 3 389 ? ? ? A . n A 1 4 SER 4 390 390 SER SER A . n A 1 5 PRO 5 391 391 PRO PRO A . n A 1 6 LEU 6 392 392 LEU LEU A . n A 1 7 SER 7 393 393 SER SER A . n A 1 8 ILE 8 394 394 ILE ILE A . n A 1 9 LYS 9 395 395 LYS LYS A . n A 1 10 LYS 10 396 396 LYS LYS A . n A 1 11 CYS 11 397 397 CYS CYS A . n A 1 12 PRO 12 398 398 PRO PRO A . n A 1 13 ILE 13 399 399 ILE ILE A . n A 1 14 CYS 14 400 400 CYS CYS A . n A 1 15 LYS 15 401 401 LYS LYS A . n A 1 16 ALA 16 402 402 ALA ALA A . n A 1 17 ASP 17 403 403 ASP ASP A . n A 1 18 ASP 18 404 404 ASP ASP A . n A 1 19 ILE 19 405 405 ILE ILE A . n A 1 20 CYS 20 406 406 CYS CYS A . n A 1 21 ASP 21 407 407 ASP ASP A . n A 1 22 HIS 22 408 408 HIS HIS A . n A 1 23 THR 23 409 409 THR THR A . n A 1 24 LEU 24 410 410 LEU LEU A . n A 1 25 GLU 25 411 411 GLU GLU A . n A 1 26 GLN 26 412 412 GLN GLN A . n A 1 27 GLN 27 413 413 GLN GLN A . n A 1 28 GLN 28 414 414 GLN GLN A . n A 1 29 MET 29 415 415 MET MET A . n A 1 30 GLN 30 416 416 GLN GLN A . n A 1 31 PRO 31 417 417 PRO PRO A . n A 1 32 LEU 32 418 418 LEU LEU A . n A 1 33 CYS 33 419 419 CYS CYS A . n A 1 34 PHE 34 420 420 PHE PHE A . n A 1 35 ASN 35 421 421 ASN ASN A . n A 1 36 CYS 36 422 422 CYS CYS A . n A 1 37 PRO 37 423 423 PRO PRO A . n A 1 38 ILE 38 424 424 ILE ILE A . n A 1 39 CYS 39 425 425 CYS CYS A . n A 1 40 ASP 40 426 426 ASP ASP A . n A 1 41 LYS 41 427 427 LYS LYS A . n A 1 42 ILE 42 428 428 ILE ILE A . n A 1 43 PHE 43 429 429 PHE PHE A . n A 1 44 PRO 44 430 430 PRO PRO A . n A 1 45 ALA 45 431 431 ALA ALA A . n A 1 46 THR 46 432 432 THR THR A . n A 1 47 GLU 47 433 433 GLU GLU A . n A 1 48 LYS 48 434 434 LYS LYS A . n A 1 49 GLN 49 435 435 GLN GLN A . n A 1 50 ILE 50 436 436 ILE ILE A . n A 1 51 PHE 51 437 437 PHE PHE A . n A 1 52 GLU 52 438 438 GLU GLU A . n A 1 53 ASP 53 439 439 ASP ASP A . n A 1 54 HIS 54 440 440 HIS HIS A . n A 1 55 VAL 55 441 441 VAL VAL A . n A 1 56 PHE 56 442 442 PHE PHE A . n A 1 57 CYS 57 443 443 CYS CYS A . n A 1 58 HIS 58 444 444 HIS HIS A . n A 1 59 SER 59 445 445 SER SER A . n A 1 60 LEU 60 446 446 LEU LEU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 447 _pdbx_nonpoly_scheme.auth_seq_num 447 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 5AAQ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5AAQ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 5AAQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 5AAQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 5AAQ _struct.title 'TBK1 recruitment to cytosol-invading Salmonella induces anti- bacterial autophagy' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5AAQ _struct_keywords.pdbx_keywords 'CALCIUM-BINDING PROTEIN' _struct_keywords.text 'CALCIUM-BINDING PROTEIN, TBK1, NDP52, ZINC-FINGER' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CACO2_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q13137 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5AAQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13137 _struct_ref_seq.db_align_beg 388 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 446 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 388 _struct_ref_seq.pdbx_auth_seq_align_end 446 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5AAQ _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q13137 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 387 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 23 ? GLN A 28 ? THR A 409 GLN A 414 1 ? 6 HELX_P HELX_P2 2 GLU A 47 ? LEU A 60 ? GLU A 433 LEU A 446 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 36 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 422 A ZN 447 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc2 metalc ? ? A CYS 39 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 425 A ZN 447 1_555 ? ? ? ? ? ? ? 2.242 ? ? metalc3 metalc ? ? A HIS 54 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 440 A ZN 447 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc4 metalc ? ? A HIS 58 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 444 A ZN 447 1_555 ? ? ? ? ? ? ? 2.045 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 36 ? A CYS 422 ? 1_555 ZN ? B ZN . ? A ZN 447 ? 1_555 SG ? A CYS 39 ? A CYS 425 ? 1_555 121.9 ? 2 SG ? A CYS 36 ? A CYS 422 ? 1_555 ZN ? B ZN . ? A ZN 447 ? 1_555 NE2 ? A HIS 54 ? A HIS 440 ? 1_555 114.8 ? 3 SG ? A CYS 39 ? A CYS 425 ? 1_555 ZN ? B ZN . ? A ZN 447 ? 1_555 NE2 ? A HIS 54 ? A HIS 440 ? 1_555 118.6 ? 4 SG ? A CYS 36 ? A CYS 422 ? 1_555 ZN ? B ZN . ? A ZN 447 ? 1_555 NE2 ? A HIS 58 ? A HIS 444 ? 1_555 100.4 ? 5 SG ? A CYS 39 ? A CYS 425 ? 1_555 ZN ? B ZN . ? A ZN 447 ? 1_555 NE2 ? A HIS 58 ? A HIS 444 ? 1_555 98.0 ? 6 NE2 ? A HIS 54 ? A HIS 440 ? 1_555 ZN ? B ZN . ? A ZN 447 ? 1_555 NE2 ? A HIS 58 ? A HIS 444 ? 1_555 93.1 ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 CYS A 33 ? CYS A 36 ? CYS A 419 CYS A 422 AA 2 LYS A 41 ? PRO A 44 ? LYS A 427 PRO A 430 # _pdbx_struct_sheet_hbond.sheet_id AA _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 36 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 422 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 41 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 427 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 447 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 447' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 36 ? CYS A 422 . ? 1_555 ? 2 AC1 4 CYS A 39 ? CYS A 425 . ? 1_555 ? 3 AC1 4 HIS A 54 ? HIS A 440 . ? 1_555 ? 4 AC1 4 HIS A 58 ? HIS A 444 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 392 ? ? 61.51 151.75 2 1 SER A 393 ? ? 60.80 160.40 3 1 CYS A 406 ? ? 179.95 -179.63 4 1 THR A 409 ? ? 64.21 114.01 5 1 GLN A 414 ? ? -94.12 46.35 6 2 SER A 393 ? ? 57.93 105.86 7 2 LYS A 395 ? ? -150.95 -78.07 8 2 CYS A 400 ? ? -165.74 -47.42 9 2 ASP A 404 ? ? -78.41 -78.10 10 2 ILE A 405 ? ? -166.88 -43.60 11 2 THR A 409 ? ? 63.01 123.48 12 3 SER A 393 ? ? -153.55 -46.04 13 3 ILE A 399 ? ? 64.48 97.16 14 3 ASP A 404 ? ? 62.40 119.49 15 3 ILE A 405 ? ? -98.31 31.41 16 3 THR A 409 ? ? 61.82 105.52 17 3 MET A 415 ? ? -159.35 -44.94 18 3 GLN A 416 ? ? -170.97 73.82 19 4 LEU A 392 ? ? -155.16 -46.55 20 4 SER A 393 ? ? -178.00 121.77 21 4 ILE A 394 ? ? -90.33 54.47 22 4 ILE A 399 ? ? -175.97 -40.58 23 4 CYS A 400 ? ? -158.06 -45.25 24 4 ASP A 404 ? ? 62.73 -176.61 25 4 THR A 409 ? ? 57.65 170.15 26 4 MET A 415 ? ? -175.41 146.40 27 5 THR A 409 ? ? 61.81 115.06 28 6 ILE A 399 ? ? -115.14 69.80 29 6 ILE A 405 ? ? -140.90 29.90 30 6 THR A 409 ? ? 62.91 140.42 31 6 GLN A 416 ? ? 59.94 88.81 32 7 SER A 393 ? ? -172.73 129.56 33 7 CYS A 400 ? ? -162.98 96.81 34 7 ASP A 404 ? ? 57.53 -179.96 35 7 CYS A 406 ? ? -171.89 -67.90 36 7 THR A 409 ? ? 62.24 142.78 37 7 MET A 415 ? ? -164.22 56.41 38 8 PRO A 391 ? ? -52.77 90.64 39 8 SER A 393 ? ? -60.20 -174.43 40 8 ILE A 394 ? ? -99.23 32.26 41 8 CYS A 406 ? ? -175.53 -40.81 42 8 THR A 409 ? ? 63.07 121.83 43 9 PRO A 391 ? ? -52.91 97.32 44 9 ILE A 399 ? ? -124.13 -52.16 45 9 THR A 409 ? ? 63.65 128.15 46 10 LYS A 395 ? ? -96.06 40.59 47 10 CYS A 400 ? ? -164.55 39.81 48 10 ILE A 405 ? ? -174.52 -40.94 49 10 THR A 409 ? ? 61.28 96.06 50 10 GLN A 414 ? ? -59.83 170.05 51 11 PRO A 391 ? ? -51.64 109.63 52 11 LEU A 392 ? ? -118.53 -72.43 53 11 SER A 393 ? ? 63.60 88.90 54 11 ILE A 394 ? ? -166.06 51.41 55 11 CYS A 400 ? ? 63.02 113.66 56 11 ILE A 405 ? ? -171.69 145.29 57 11 THR A 409 ? ? 63.20 143.69 58 11 GLN A 414 ? ? 63.00 -81.26 59 11 MET A 415 ? ? 178.21 81.16 60 12 CYS A 400 ? ? -164.87 107.13 61 12 ASP A 404 ? ? -71.98 -168.11 62 12 ILE A 405 ? ? 69.40 -67.20 63 12 CYS A 406 ? ? -61.85 -176.38 64 12 THR A 409 ? ? 50.48 96.40 65 13 CYS A 400 ? ? -98.36 -65.48 66 13 ASP A 404 ? ? 56.30 -173.37 67 13 CYS A 406 ? ? -144.67 -70.55 68 13 THR A 409 ? ? 62.66 106.42 69 13 GLN A 416 ? ? -59.20 109.24 70 14 ILE A 399 ? ? -150.29 82.36 71 14 CYS A 400 ? ? -153.99 -62.90 72 14 ASP A 404 ? ? 55.33 -168.31 73 14 ILE A 405 ? ? -61.64 87.33 74 14 THR A 409 ? ? 60.07 93.82 75 15 ILE A 399 ? ? -100.90 -64.39 76 15 CYS A 400 ? ? 70.95 -61.24 77 15 THR A 409 ? ? 61.93 111.96 78 15 GLN A 414 ? ? -84.74 -74.60 79 16 SER A 393 ? ? 60.31 177.95 80 16 ILE A 399 ? ? -87.13 -70.29 81 16 CYS A 406 ? ? -78.82 -73.74 82 16 THR A 409 ? ? 43.32 87.48 83 17 SER A 393 ? ? -148.45 23.19 84 17 ILE A 394 ? ? 53.61 97.95 85 17 LYS A 395 ? ? -172.43 50.50 86 17 ILE A 399 ? ? 62.71 93.77 87 17 THR A 409 ? ? 64.80 140.10 88 18 LEU A 392 ? ? 60.86 155.98 89 18 LYS A 395 ? ? -157.83 -73.96 90 18 ASP A 404 ? ? -174.09 135.88 91 18 CYS A 406 ? ? 56.60 171.60 92 18 THR A 409 ? ? 62.94 146.60 93 18 GLN A 416 ? ? 58.93 93.21 94 19 LEU A 392 ? ? -162.94 -45.12 95 19 SER A 393 ? ? -179.72 -38.70 96 19 LYS A 395 ? ? -169.44 110.89 97 19 CYS A 400 ? ? -161.76 -45.72 98 19 ASP A 404 ? ? 84.88 -21.43 99 19 ILE A 405 ? ? -178.82 109.95 100 19 THR A 409 ? ? 59.91 97.85 101 20 ASP A 404 ? ? 64.75 -171.16 102 20 THR A 409 ? ? 64.18 131.72 # _pdbx_nmr_ensemble.entry_id 5AAQ _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'NO VIOLATIONS' # _pdbx_nmr_representative.entry_id 5AAQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '95% WATER/5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 3 1 DQF-COSY 1 4 1 HSQC 1 5 1 HNCACB 1 6 1 CBCACONH 1 7 1 HNCO 1 8 1 HNCACO 1 9 1 HNHB 1 # _pdbx_nmr_details.entry_id 5AAQ _pdbx_nmr_details.text NONE # _pdbx_nmr_refine.entry_id 5AAQ _pdbx_nmr_refine.method CNS _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' ANSIG ? ? 2 'structure solution' CNS ? ? 3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 387 ? A GLY 1 2 1 Y 1 A SER 388 ? A SER 2 3 1 Y 1 A PRO 389 ? A PRO 3 4 2 Y 1 A GLY 387 ? A GLY 1 5 2 Y 1 A SER 388 ? A SER 2 6 2 Y 1 A PRO 389 ? A PRO 3 7 3 Y 1 A GLY 387 ? A GLY 1 8 3 Y 1 A SER 388 ? A SER 2 9 3 Y 1 A PRO 389 ? A PRO 3 10 4 Y 1 A GLY 387 ? A GLY 1 11 4 Y 1 A SER 388 ? A SER 2 12 4 Y 1 A PRO 389 ? A PRO 3 13 5 Y 1 A GLY 387 ? A GLY 1 14 5 Y 1 A SER 388 ? A SER 2 15 5 Y 1 A PRO 389 ? A PRO 3 16 6 Y 1 A GLY 387 ? A GLY 1 17 6 Y 1 A SER 388 ? A SER 2 18 6 Y 1 A PRO 389 ? A PRO 3 19 7 Y 1 A GLY 387 ? A GLY 1 20 7 Y 1 A SER 388 ? A SER 2 21 7 Y 1 A PRO 389 ? A PRO 3 22 8 Y 1 A GLY 387 ? A GLY 1 23 8 Y 1 A SER 388 ? A SER 2 24 8 Y 1 A PRO 389 ? A PRO 3 25 9 Y 1 A GLY 387 ? A GLY 1 26 9 Y 1 A SER 388 ? A SER 2 27 9 Y 1 A PRO 389 ? A PRO 3 28 10 Y 1 A GLY 387 ? A GLY 1 29 10 Y 1 A SER 388 ? A SER 2 30 10 Y 1 A PRO 389 ? A PRO 3 31 11 Y 1 A GLY 387 ? A GLY 1 32 11 Y 1 A SER 388 ? A SER 2 33 11 Y 1 A PRO 389 ? A PRO 3 34 12 Y 1 A GLY 387 ? A GLY 1 35 12 Y 1 A SER 388 ? A SER 2 36 12 Y 1 A PRO 389 ? A PRO 3 37 13 Y 1 A GLY 387 ? A GLY 1 38 13 Y 1 A SER 388 ? A SER 2 39 13 Y 1 A PRO 389 ? A PRO 3 40 14 Y 1 A GLY 387 ? A GLY 1 41 14 Y 1 A SER 388 ? A SER 2 42 14 Y 1 A PRO 389 ? A PRO 3 43 15 Y 1 A GLY 387 ? A GLY 1 44 15 Y 1 A SER 388 ? A SER 2 45 15 Y 1 A PRO 389 ? A PRO 3 46 16 Y 1 A GLY 387 ? A GLY 1 47 16 Y 1 A SER 388 ? A SER 2 48 16 Y 1 A PRO 389 ? A PRO 3 49 17 Y 1 A GLY 387 ? A GLY 1 50 17 Y 1 A SER 388 ? A SER 2 51 17 Y 1 A PRO 389 ? A PRO 3 52 18 Y 1 A GLY 387 ? A GLY 1 53 18 Y 1 A SER 388 ? A SER 2 54 18 Y 1 A PRO 389 ? A PRO 3 55 19 Y 1 A GLY 387 ? A GLY 1 56 19 Y 1 A SER 388 ? A SER 2 57 19 Y 1 A PRO 389 ? A PRO 3 58 20 Y 1 A GLY 387 ? A GLY 1 59 20 Y 1 A SER 388 ? A SER 2 60 20 Y 1 A PRO 389 ? A PRO 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PHE N N N N 220 PHE CA C N S 221 PHE C C N N 222 PHE O O N N 223 PHE CB C N N 224 PHE CG C Y N 225 PHE CD1 C Y N 226 PHE CD2 C Y N 227 PHE CE1 C Y N 228 PHE CE2 C Y N 229 PHE CZ C Y N 230 PHE OXT O N N 231 PHE H H N N 232 PHE H2 H N N 233 PHE HA H N N 234 PHE HB2 H N N 235 PHE HB3 H N N 236 PHE HD1 H N N 237 PHE HD2 H N N 238 PHE HE1 H N N 239 PHE HE2 H N N 240 PHE HZ H N N 241 PHE HXT H N N 242 PRO N N N N 243 PRO CA C N S 244 PRO C C N N 245 PRO O O N N 246 PRO CB C N N 247 PRO CG C N N 248 PRO CD C N N 249 PRO OXT O N N 250 PRO H H N N 251 PRO HA H N N 252 PRO HB2 H N N 253 PRO HB3 H N N 254 PRO HG2 H N N 255 PRO HG3 H N N 256 PRO HD2 H N N 257 PRO HD3 H N N 258 PRO HXT H N N 259 SER N N N N 260 SER CA C N S 261 SER C C N N 262 SER O O N N 263 SER CB C N N 264 SER OG O N N 265 SER OXT O N N 266 SER H H N N 267 SER H2 H N N 268 SER HA H N N 269 SER HB2 H N N 270 SER HB3 H N N 271 SER HG H N N 272 SER HXT H N N 273 THR N N N N 274 THR CA C N S 275 THR C C N N 276 THR O O N N 277 THR CB C N R 278 THR OG1 O N N 279 THR CG2 C N N 280 THR OXT O N N 281 THR H H N N 282 THR H2 H N N 283 THR HA H N N 284 THR HB H N N 285 THR HG1 H N N 286 THR HG21 H N N 287 THR HG22 H N N 288 THR HG23 H N N 289 THR HXT H N N 290 VAL N N N N 291 VAL CA C N S 292 VAL C C N N 293 VAL O O N N 294 VAL CB C N N 295 VAL CG1 C N N 296 VAL CG2 C N N 297 VAL OXT O N N 298 VAL H H N N 299 VAL H2 H N N 300 VAL HA H N N 301 VAL HB H N N 302 VAL HG11 H N N 303 VAL HG12 H N N 304 VAL HG13 H N N 305 VAL HG21 H N N 306 VAL HG22 H N N 307 VAL HG23 H N N 308 VAL HXT H N N 309 ZN ZN ZN N N 310 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 MET N CA sing N N 190 MET N H sing N N 191 MET N H2 sing N N 192 MET CA C sing N N 193 MET CA CB sing N N 194 MET CA HA sing N N 195 MET C O doub N N 196 MET C OXT sing N N 197 MET CB CG sing N N 198 MET CB HB2 sing N N 199 MET CB HB3 sing N N 200 MET CG SD sing N N 201 MET CG HG2 sing N N 202 MET CG HG3 sing N N 203 MET SD CE sing N N 204 MET CE HE1 sing N N 205 MET CE HE2 sing N N 206 MET CE HE3 sing N N 207 MET OXT HXT sing N N 208 PHE N CA sing N N 209 PHE N H sing N N 210 PHE N H2 sing N N 211 PHE CA C sing N N 212 PHE CA CB sing N N 213 PHE CA HA sing N N 214 PHE C O doub N N 215 PHE C OXT sing N N 216 PHE CB CG sing N N 217 PHE CB HB2 sing N N 218 PHE CB HB3 sing N N 219 PHE CG CD1 doub Y N 220 PHE CG CD2 sing Y N 221 PHE CD1 CE1 sing Y N 222 PHE CD1 HD1 sing N N 223 PHE CD2 CE2 doub Y N 224 PHE CD2 HD2 sing N N 225 PHE CE1 CZ doub Y N 226 PHE CE1 HE1 sing N N 227 PHE CE2 CZ sing Y N 228 PHE CE2 HE2 sing N N 229 PHE CZ HZ sing N N 230 PHE OXT HXT sing N N 231 PRO N CA sing N N 232 PRO N CD sing N N 233 PRO N H sing N N 234 PRO CA C sing N N 235 PRO CA CB sing N N 236 PRO CA HA sing N N 237 PRO C O doub N N 238 PRO C OXT sing N N 239 PRO CB CG sing N N 240 PRO CB HB2 sing N N 241 PRO CB HB3 sing N N 242 PRO CG CD sing N N 243 PRO CG HG2 sing N N 244 PRO CG HG3 sing N N 245 PRO CD HD2 sing N N 246 PRO CD HD3 sing N N 247 PRO OXT HXT sing N N 248 SER N CA sing N N 249 SER N H sing N N 250 SER N H2 sing N N 251 SER CA C sing N N 252 SER CA CB sing N N 253 SER CA HA sing N N 254 SER C O doub N N 255 SER C OXT sing N N 256 SER CB OG sing N N 257 SER CB HB2 sing N N 258 SER CB HB3 sing N N 259 SER OG HG sing N N 260 SER OXT HXT sing N N 261 THR N CA sing N N 262 THR N H sing N N 263 THR N H2 sing N N 264 THR CA C sing N N 265 THR CA CB sing N N 266 THR CA HA sing N N 267 THR C O doub N N 268 THR C OXT sing N N 269 THR CB OG1 sing N N 270 THR CB CG2 sing N N 271 THR CB HB sing N N 272 THR OG1 HG1 sing N N 273 THR CG2 HG21 sing N N 274 THR CG2 HG22 sing N N 275 THR CG2 HG23 sing N N 276 THR OXT HXT sing N N 277 VAL N CA sing N N 278 VAL N H sing N N 279 VAL N H2 sing N N 280 VAL CA C sing N N 281 VAL CA CB sing N N 282 VAL CA HA sing N N 283 VAL C O doub N N 284 VAL C OXT sing N N 285 VAL CB CG1 sing N N 286 VAL CB CG2 sing N N 287 VAL CB HB sing N N 288 VAL CG1 HG11 sing N N 289 VAL CG1 HG12 sing N N 290 VAL CG1 HG13 sing N N 291 VAL CG2 HG21 sing N N 292 VAL CG2 HG22 sing N N 293 VAL CG2 HG23 sing N N 294 VAL OXT HXT sing N N 295 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 5AAQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_