data_5DD4 # _entry.id 5DD4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5DD4 WWPDB D_1000213042 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5DDG PDB . unspecified MCSG-APC111381 TargetTrack . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DD4 _pdbx_database_status.recvd_initial_deposition_date 2015-08-24 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chang, C.' 1 'Tesar, C.' 2 'Rodionov, D.' 3 'Joachimiak, A.' 4 'Midwest Center for Structural Genomics (MCSG)' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 43 _citation.language ? _citation.page_first 10546 _citation.page_last 10559 _citation.title 'A novel transcriptional regulator of L-arabinose utilization in human gut bacteria.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkv1005 _citation.pdbx_database_id_PubMed 26438537 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chang, C.' 1 primary 'Tesar, C.' 2 primary 'Li, X.' 3 primary 'Kim, Y.' 4 primary 'Rodionov, D.A.' 5 primary 'Joachimiak, A.' 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5DD4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 123.735 _cell.length_a_esd ? _cell.length_b 123.735 _cell.length_b_esd ? _cell.length_c 123.735 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DD4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TRANSCRIPTIONAL REGULATOR AraR' 26622.131 1 ? ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 3 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 4 water nat water 18.015 27 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NUDIX family hydrolase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNA(MSE)KNYYSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPA(MSE)GEWSL(MSE)GGFVQKDESVDDAAKRVLA ELTGLENVY(MSE)EQVGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPE(MSE)VDK ARE(MSE)(MSE)KQKASVEPIGFNLLPKLFTLSQLQSLYEAIYGEP(MSE)DKRNFRKRVAE(MSE)DFIEKTDKIDKL GSKRGAALYKFNGKAYRKDPKFKL ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMKNYYSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQ VGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLP KLFTLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKLGSKRGAALYKFNGKAYRKDPKFKL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MCSG-APC111381 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MSE n 1 5 LYS n 1 6 ASN n 1 7 TYR n 1 8 TYR n 1 9 SER n 1 10 SER n 1 11 ASN n 1 12 PRO n 1 13 THR n 1 14 PHE n 1 15 TYR n 1 16 LEU n 1 17 GLY n 1 18 ILE n 1 19 ASP n 1 20 CYS n 1 21 ILE n 1 22 ILE n 1 23 PHE n 1 24 GLY n 1 25 PHE n 1 26 ASN n 1 27 GLU n 1 28 GLY n 1 29 GLU n 1 30 ILE n 1 31 SER n 1 32 LEU n 1 33 LEU n 1 34 LEU n 1 35 LEU n 1 36 LYS n 1 37 ARG n 1 38 ASN n 1 39 PHE n 1 40 GLU n 1 41 PRO n 1 42 ALA n 1 43 MSE n 1 44 GLY n 1 45 GLU n 1 46 TRP n 1 47 SER n 1 48 LEU n 1 49 MSE n 1 50 GLY n 1 51 GLY n 1 52 PHE n 1 53 VAL n 1 54 GLN n 1 55 LYS n 1 56 ASP n 1 57 GLU n 1 58 SER n 1 59 VAL n 1 60 ASP n 1 61 ASP n 1 62 ALA n 1 63 ALA n 1 64 LYS n 1 65 ARG n 1 66 VAL n 1 67 LEU n 1 68 ALA n 1 69 GLU n 1 70 LEU n 1 71 THR n 1 72 GLY n 1 73 LEU n 1 74 GLU n 1 75 ASN n 1 76 VAL n 1 77 TYR n 1 78 MSE n 1 79 GLU n 1 80 GLN n 1 81 VAL n 1 82 GLY n 1 83 ALA n 1 84 PHE n 1 85 GLY n 1 86 ALA n 1 87 ILE n 1 88 ASP n 1 89 ARG n 1 90 ASP n 1 91 PRO n 1 92 GLY n 1 93 GLU n 1 94 ARG n 1 95 VAL n 1 96 VAL n 1 97 SER n 1 98 ILE n 1 99 ALA n 1 100 TYR n 1 101 TYR n 1 102 ALA n 1 103 LEU n 1 104 ILE n 1 105 ASN n 1 106 ILE n 1 107 ASN n 1 108 GLU n 1 109 TYR n 1 110 ASP n 1 111 ARG n 1 112 GLU n 1 113 LEU n 1 114 VAL n 1 115 GLN n 1 116 LYS n 1 117 HIS n 1 118 ASN n 1 119 ALA n 1 120 TYR n 1 121 TRP n 1 122 VAL n 1 123 ASN n 1 124 ILE n 1 125 ASN n 1 126 GLU n 1 127 LEU n 1 128 PRO n 1 129 ALA n 1 130 LEU n 1 131 ILE n 1 132 PHE n 1 133 ASP n 1 134 HIS n 1 135 PRO n 1 136 GLU n 1 137 MSE n 1 138 VAL n 1 139 ASP n 1 140 LYS n 1 141 ALA n 1 142 ARG n 1 143 GLU n 1 144 MSE n 1 145 MSE n 1 146 LYS n 1 147 GLN n 1 148 LYS n 1 149 ALA n 1 150 SER n 1 151 VAL n 1 152 GLU n 1 153 PRO n 1 154 ILE n 1 155 GLY n 1 156 PHE n 1 157 ASN n 1 158 LEU n 1 159 LEU n 1 160 PRO n 1 161 LYS n 1 162 LEU n 1 163 PHE n 1 164 THR n 1 165 LEU n 1 166 SER n 1 167 GLN n 1 168 LEU n 1 169 GLN n 1 170 SER n 1 171 LEU n 1 172 TYR n 1 173 GLU n 1 174 ALA n 1 175 ILE n 1 176 TYR n 1 177 GLY n 1 178 GLU n 1 179 PRO n 1 180 MSE n 1 181 ASP n 1 182 LYS n 1 183 ARG n 1 184 ASN n 1 185 PHE n 1 186 ARG n 1 187 LYS n 1 188 ARG n 1 189 VAL n 1 190 ALA n 1 191 GLU n 1 192 MSE n 1 193 ASP n 1 194 PHE n 1 195 ILE n 1 196 GLU n 1 197 LYS n 1 198 THR n 1 199 ASP n 1 200 LYS n 1 201 ILE n 1 202 ASP n 1 203 LYS n 1 204 LEU n 1 205 GLY n 1 206 SER n 1 207 LYS n 1 208 ARG n 1 209 GLY n 1 210 ALA n 1 211 ALA n 1 212 LEU n 1 213 TYR n 1 214 LYS n 1 215 PHE n 1 216 ASN n 1 217 GLY n 1 218 LYS n 1 219 ALA n 1 220 TYR n 1 221 ARG n 1 222 LYS n 1 223 ASP n 1 224 PRO n 1 225 LYS n 1 226 PHE n 1 227 LYS n 1 228 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 228 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BT_0354 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 226186 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PMCSG68 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8AAV8_BACTN _struct_ref.pdbx_db_accession Q8AAV8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKNYYSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGA FGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLPKLF TLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKLGSKRGAALYKFNGKAYRKDPKFKL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5DD4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 228 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8AAV8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 225 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 225 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5DD4 SER A 1 ? UNP Q8AAV8 ? ? 'expression tag' -2 1 1 5DD4 ASN A 2 ? UNP Q8AAV8 ? ? 'expression tag' -1 2 1 5DD4 ALA A 3 ? UNP Q8AAV8 ? ? 'expression tag' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DD4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 297 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.1M Malic Acid' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-11-16 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)double crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97934 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5DD4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.560 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10292 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.800 _reflns.pdbx_Rmerge_I_obs 0.114 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 21.025 _reflns.pdbx_netI_over_sigmaI 10.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.104 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 111364 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.560 2.580 ? ? ? ? ? 273 ? 100.000 ? ? ? ? 0.992 ? ? ? ? ? ? ? ? 11.000 ? 0.803 ? ? ? ? 0 1 1 ? ? 2.580 2.600 ? ? ? ? ? 232 ? 100.000 ? ? ? ? 0.914 ? ? ? ? ? ? ? ? 11.000 ? 0.846 ? ? ? ? 0 2 1 ? ? 2.600 2.630 ? ? ? ? ? 270 ? 100.000 ? ? ? ? 0.960 ? ? ? ? ? ? ? ? 11.100 ? 0.860 ? ? ? ? 0 3 1 ? ? 2.630 2.650 ? ? ? ? ? 259 ? 100.000 ? ? ? ? 0.782 ? ? ? ? ? ? ? ? 10.900 ? 0.918 ? ? ? ? 0 4 1 ? ? 2.650 2.680 ? ? ? ? ? 242 ? 100.000 ? ? ? ? 0.646 ? ? ? ? ? ? ? ? 11.100 ? 0.906 ? ? ? ? 0 5 1 ? ? 2.680 2.700 ? ? ? ? ? 246 ? 100.000 ? ? ? ? 0.687 ? ? ? ? ? ? ? ? 11.000 ? 0.887 ? ? ? ? 0 6 1 ? ? 2.700 2.730 ? ? ? ? ? 267 ? 100.000 ? ? ? ? 0.566 ? ? ? ? ? ? ? ? 11.000 ? 0.889 ? ? ? ? 0 7 1 ? ? 2.730 2.760 ? ? ? ? ? 244 ? 100.000 ? ? ? ? 0.570 ? ? ? ? ? ? ? ? 11.000 ? 0.941 ? ? ? ? 0 8 1 ? ? 2.760 2.790 ? ? ? ? ? 248 ? 100.000 ? ? ? ? 0.476 ? ? ? ? ? ? ? ? 11.100 ? 0.972 ? ? ? ? 0 9 1 ? ? 2.790 2.820 ? ? ? ? ? 270 ? 100.000 ? ? ? ? 0.393 ? ? ? ? ? ? ? ? 11.000 ? 0.904 ? ? ? ? 0 10 1 ? ? 2.820 2.850 ? ? ? ? ? 245 ? 100.000 ? ? ? ? 0.377 ? ? ? ? ? ? ? ? 11.100 ? 0.957 ? ? ? ? 0 11 1 ? ? 2.850 2.880 ? ? ? ? ? 261 ? 100.000 ? ? ? ? 0.355 ? ? ? ? ? ? ? ? 11.000 ? 0.964 ? ? ? ? 0 12 1 ? ? 2.880 2.920 ? ? ? ? ? 259 ? 100.000 ? ? ? ? 0.337 ? ? ? ? ? ? ? ? 10.900 ? 0.980 ? ? ? ? 0 13 1 ? ? 2.920 2.960 ? ? ? ? ? 238 ? 100.000 ? ? ? ? 0.318 ? ? ? ? ? ? ? ? 11.200 ? 0.998 ? ? ? ? 0 14 1 ? ? 2.960 2.990 ? ? ? ? ? 256 ? 100.000 ? ? ? ? 0.271 ? ? ? ? ? ? ? ? 11.100 ? 0.981 ? ? ? ? 0 15 1 ? ? 2.990 3.040 ? ? ? ? ? 243 ? 100.000 ? ? ? ? 0.263 ? ? ? ? ? ? ? ? 10.900 ? 1.102 ? ? ? ? 0 16 1 ? ? 3.040 3.080 ? ? ? ? ? 268 ? 100.000 ? ? ? ? 0.213 ? ? ? ? ? ? ? ? 11.100 ? 1.070 ? ? ? ? 0 17 1 ? ? 3.080 3.120 ? ? ? ? ? 268 ? 100.000 ? ? ? ? 0.224 ? ? ? ? ? ? ? ? 10.900 ? 1.164 ? ? ? ? 0 18 1 ? ? 3.120 3.170 ? ? ? ? ? 246 ? 100.000 ? ? ? ? 0.202 ? ? ? ? ? ? ? ? 11.100 ? 1.127 ? ? ? ? 0 19 1 ? ? 3.170 3.230 ? ? ? ? ? 250 ? 100.000 ? ? ? ? 0.168 ? ? ? ? ? ? ? ? 11.000 ? 1.129 ? ? ? ? 0 20 1 ? ? 3.230 3.280 ? ? ? ? ? 253 ? 100.000 ? ? ? ? 0.171 ? ? ? ? ? ? ? ? 10.900 ? 1.228 ? ? ? ? 0 21 1 ? ? 3.280 3.340 ? ? ? ? ? 269 ? 100.000 ? ? ? ? 0.151 ? ? ? ? ? ? ? ? 10.900 ? 1.148 ? ? ? ? 0 22 1 ? ? 3.340 3.400 ? ? ? ? ? 246 ? 100.000 ? ? ? ? 0.142 ? ? ? ? ? ? ? ? 11.000 ? 1.262 ? ? ? ? 0 23 1 ? ? 3.400 3.470 ? ? ? ? ? 266 ? 100.000 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? 10.900 ? 1.280 ? ? ? ? 0 24 1 ? ? 3.470 3.550 ? ? ? ? ? 255 ? 100.000 ? ? ? ? 0.124 ? ? ? ? ? ? ? ? 10.900 ? 1.312 ? ? ? ? 0 25 1 ? ? 3.550 3.630 ? ? ? ? ? 255 ? 100.000 ? ? ? ? 0.125 ? ? ? ? ? ? ? ? 10.800 ? 1.456 ? ? ? ? 0 26 1 ? ? 3.630 3.720 ? ? ? ? ? 251 ? 100.000 ? ? ? ? 0.115 ? ? ? ? ? ? ? ? 10.900 ? 1.387 ? ? ? ? 0 27 1 ? ? 3.720 3.820 ? ? ? ? ? 264 ? 100.000 ? ? ? ? 0.116 ? ? ? ? ? ? ? ? 10.900 ? 1.463 ? ? ? ? 0 28 1 ? ? 3.820 3.940 ? ? ? ? ? 264 ? 100.000 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 10.800 ? 1.428 ? ? ? ? 0 29 1 ? ? 3.940 4.060 ? ? ? ? ? 253 ? 100.000 ? ? ? ? 0.110 ? ? ? ? ? ? ? ? 10.700 ? 1.465 ? ? ? ? 0 30 1 ? ? 4.060 4.210 ? ? ? ? ? 254 ? 100.000 ? ? ? ? 0.105 ? ? ? ? ? ? ? ? 10.600 ? 1.454 ? ? ? ? 0 31 1 ? ? 4.210 4.380 ? ? ? ? ? 257 ? 100.000 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 10.600 ? 1.336 ? ? ? ? 0 32 1 ? ? 4.380 4.580 ? ? ? ? ? 262 ? 100.000 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 10.600 ? 1.339 ? ? ? ? 0 33 1 ? ? 4.580 4.820 ? ? ? ? ? 254 ? 100.000 ? ? ? ? 0.089 ? ? ? ? ? ? ? ? 10.600 ? 1.188 ? ? ? ? 0 34 1 ? ? 4.820 5.120 ? ? ? ? ? 268 ? 100.000 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 10.400 ? 1.158 ? ? ? ? 0 35 1 ? ? 5.120 5.510 ? ? ? ? ? 256 ? 100.000 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 10.200 ? 1.174 ? ? ? ? 0 36 1 ? ? 5.510 6.070 ? ? ? ? ? 261 ? 100.000 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 10.500 ? 1.019 ? ? ? ? 0 37 1 ? ? 6.070 6.940 ? ? ? ? ? 268 ? 100.000 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 10.400 ? 0.948 ? ? ? ? 0 38 1 ? ? 6.940 8.740 ? ? ? ? ? 273 ? 100.000 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 10.500 ? 0.962 ? ? ? ? 0 39 1 ? ? 8.740 50.000 ? ? ? ? ? 278 ? 97.500 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 9.500 ? 0.785 ? ? ? ? 0 40 1 ? ? # _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.0000 _refine.B_iso_max 107.010 _refine.B_iso_mean 35.6170 _refine.B_iso_min 11.480 _refine.correlation_coeff_Fo_to_Fc 0.9370 _refine.correlation_coeff_Fo_to_Fc_free 0.9130 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DD4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5600 _refine.ls_d_res_low 39.1600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9559 _refine.ls_number_reflns_R_free 479 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.4400 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1847 _refine.ls_R_factor_R_free 0.2219 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1828 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.4380 _refine.pdbx_overall_ESU_R_Free 0.2560 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 16.8460 _refine.overall_SU_ML 0.1790 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.5600 _refine_hist.d_res_low 39.1600 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 1811 _refine_hist.pdbx_number_residues_total 221 _refine_hist.pdbx_B_iso_mean_ligand 37.23 _refine_hist.pdbx_B_iso_mean_solvent 24.71 _refine_hist.pdbx_number_atoms_protein 1776 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.019 1849 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1764 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.311 1.989 2492 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.709 3.000 4069 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.409 5.000 226 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.294 24.783 92 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.678 15.000 310 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.129 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.071 0.200 261 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.021 2108 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 422 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.5630 _refine_ls_shell.d_res_low 2.6300 _refine_ls_shell.number_reflns_all 573 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 32 _refine_ls_shell.number_reflns_R_work 541 _refine_ls_shell.percent_reflns_obs 73.9400 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2750 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2430 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5DD4 _struct.title 'Apo structure of transcriptional factor AraR from Bacteroides thetaiotaomicron VPI' _struct.pdbx_descriptor 'TRANSCRIPTIONAL REGULATOR AraR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DD4 _struct_keywords.text ;Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, AraR, DNA binding, TRANSCRIPTIONAL REGULATOR, BACTEROIDES THETAIOTAOMICRON, HELIX-TURN-HELIX MOTIF, NUDIX FOLD, TRANSCRIPTION REGULATOR ; _struct_keywords.pdbx_keywords 'TRANSCRIPTION REGULATOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 58 ? GLY A 72 ? SER A 55 GLY A 69 1 ? 15 HELX_P HELX_P2 AA2 ASP A 110 ? ASN A 118 ? ASP A 107 ASN A 115 1 ? 9 HELX_P HELX_P3 AA3 ASP A 133 ? SER A 150 ? ASP A 130 SER A 147 1 ? 18 HELX_P HELX_P4 AA4 VAL A 151 ? LEU A 159 ? VAL A 148 LEU A 156 5 ? 9 HELX_P HELX_P5 AA5 THR A 164 ? GLY A 177 ? THR A 161 GLY A 174 1 ? 14 HELX_P HELX_P6 AA6 ASP A 181 ? GLU A 191 ? ASP A 178 GLU A 188 1 ? 11 HELX_P HELX_P7 AA7 ASN A 216 ? ASP A 223 ? ASN A 213 ASP A 220 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A ALA 42 C ? ? ? 1_555 A MSE 43 N ? ? A ALA 39 A MSE 40 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale both ? A MSE 43 C ? ? ? 1_555 A GLY 44 N ? ? A MSE 40 A GLY 41 1_555 ? ? ? ? ? ? ? 1.327 ? covale3 covale both ? A LEU 48 C ? ? ? 1_555 A MSE 49 N ? ? A LEU 45 A MSE 46 1_555 ? ? ? ? ? ? ? 1.326 ? covale4 covale both ? A MSE 49 C ? ? ? 1_555 A GLY 50 N ? ? A MSE 46 A GLY 47 1_555 ? ? ? ? ? ? ? 1.324 ? covale5 covale both ? A TYR 77 C ? ? ? 1_555 A MSE 78 N ? ? A TYR 74 A MSE 75 1_555 ? ? ? ? ? ? ? 1.332 ? covale6 covale both ? A MSE 78 C ? ? ? 1_555 A GLU 79 N ? ? A MSE 75 A GLU 76 1_555 ? ? ? ? ? ? ? 1.314 ? covale7 covale both ? A GLU 136 C A ? ? 1_555 A MSE 137 N ? ? A GLU 133 A MSE 134 1_555 ? ? ? ? ? ? ? 1.330 ? covale8 covale both ? A GLU 136 C B ? ? 1_555 A MSE 137 N ? ? A GLU 133 A MSE 134 1_555 ? ? ? ? ? ? ? 1.327 ? covale9 covale both ? A MSE 137 C ? ? ? 1_555 A VAL 138 N ? ? A MSE 134 A VAL 135 1_555 ? ? ? ? ? ? ? 1.329 ? covale10 covale both ? A GLU 143 C ? ? ? 1_555 A MSE 144 N ? ? A GLU 140 A MSE 141 1_555 ? ? ? ? ? ? ? 1.329 ? covale11 covale both ? A MSE 144 C ? ? ? 1_555 A MSE 145 N ? ? A MSE 141 A MSE 142 1_555 ? ? ? ? ? ? ? 1.322 ? covale12 covale both ? A MSE 145 C ? ? ? 1_555 A LYS 146 N ? ? A MSE 142 A LYS 143 1_555 ? ? ? ? ? ? ? 1.332 ? covale13 covale both ? A PRO 179 C ? ? ? 1_555 A MSE 180 N ? ? A PRO 176 A MSE 177 1_555 ? ? ? ? ? ? ? 1.330 ? covale14 covale both ? A MSE 180 C ? ? ? 1_555 A ASP 181 N ? ? A MSE 177 A ASP 178 1_555 ? ? ? ? ? ? ? 1.326 ? covale15 covale both ? A GLU 191 C ? ? ? 1_555 A MSE 192 N ? ? A GLU 188 A MSE 189 1_555 ? ? ? ? ? ? ? 1.329 ? covale16 covale both ? A MSE 192 C ? ? ? 1_555 A ASP 193 N ? ? A MSE 189 A ASP 190 1_555 ? ? ? ? ? ? ? 1.329 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 40 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 37 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 41 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 38 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.42 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 4 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 46 ? SER A 47 ? TRP A 43 SER A 44 AA1 2 GLU A 29 ? LYS A 36 ? GLU A 26 LYS A 33 AA1 3 TYR A 15 ? ASN A 26 ? TYR A 12 ASN A 23 AA1 4 VAL A 95 ? LEU A 103 ? VAL A 92 LEU A 100 AA1 5 TYR A 77 ? PHE A 84 ? TYR A 74 PHE A 81 AA2 1 MSE A 49 ? PHE A 52 ? MSE A 46 PHE A 49 AA2 2 TYR A 15 ? ASN A 26 ? TYR A 12 ASN A 23 AA2 3 GLU A 29 ? LYS A 36 ? GLU A 26 LYS A 33 AA2 4 ALA A 119 ? ASN A 123 ? ALA A 116 ASN A 120 AA3 1 ILE A 195 ? LYS A 203 ? ILE A 192 LYS A 200 AA3 2 GLY A 209 ? PHE A 215 ? GLY A 206 PHE A 212 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O SER A 47 ? O SER A 44 N LEU A 35 ? N LEU A 32 AA1 2 3 O SER A 31 ? O SER A 28 N GLY A 24 ? N GLY A 21 AA1 3 4 N ILE A 21 ? N ILE A 18 O TYR A 100 ? O TYR A 97 AA1 4 5 O SER A 97 ? O SER A 94 N PHE A 84 ? N PHE A 81 AA2 1 2 O MSE A 49 ? O MSE A 46 N CYS A 20 ? N CYS A 17 AA2 2 3 N GLY A 24 ? N GLY A 21 O SER A 31 ? O SER A 28 AA2 3 4 N LEU A 32 ? N LEU A 29 O VAL A 122 ? O VAL A 119 AA3 1 2 N THR A 198 ? N THR A 195 O LEU A 212 ? O LEU A 209 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 301 ? 5 'binding site for residue EDO A 301' AC2 Software A ACT 302 ? 2 'binding site for residue ACT A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 19 ? ASP A 16 . ? 1_555 ? 2 AC1 5 ARG A 89 ? ARG A 86 . ? 1_555 ? 3 AC1 5 ASP A 90 ? ASP A 87 . ? 1_555 ? 4 AC1 5 VAL A 95 ? VAL A 92 . ? 1_555 ? 5 AC1 5 HIS A 134 ? HIS A 131 . ? 1_555 ? 6 AC2 2 GLU A 136 ? GLU A 133 . ? 16_555 ? 7 AC2 2 LYS A 140 ? LYS A 137 . ? 16_555 ? # _atom_sites.entry_id 5DD4 _atom_sites.fract_transf_matrix[1][1] 0.008082 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008082 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008082 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 ? ? ? A . n A 1 4 MSE 4 1 ? ? ? A . n A 1 5 LYS 5 2 ? ? ? A . n A 1 6 ASN 6 3 ? ? ? A . n A 1 7 TYR 7 4 ? ? ? A . n A 1 8 TYR 8 5 5 TYR TYR A . n A 1 9 SER 9 6 6 SER SER A . n A 1 10 SER 10 7 7 SER SER A . n A 1 11 ASN 11 8 8 ASN ASN A . n A 1 12 PRO 12 9 9 PRO PRO A . n A 1 13 THR 13 10 10 THR THR A . n A 1 14 PHE 14 11 11 PHE PHE A . n A 1 15 TYR 15 12 12 TYR TYR A . n A 1 16 LEU 16 13 13 LEU LEU A . n A 1 17 GLY 17 14 14 GLY GLY A . n A 1 18 ILE 18 15 15 ILE ILE A . n A 1 19 ASP 19 16 16 ASP ASP A . n A 1 20 CYS 20 17 17 CYS CYS A . n A 1 21 ILE 21 18 18 ILE ILE A . n A 1 22 ILE 22 19 19 ILE ILE A . n A 1 23 PHE 23 20 20 PHE PHE A . n A 1 24 GLY 24 21 21 GLY GLY A . n A 1 25 PHE 25 22 22 PHE PHE A . n A 1 26 ASN 26 23 23 ASN ASN A . n A 1 27 GLU 27 24 24 GLU GLU A . n A 1 28 GLY 28 25 25 GLY GLY A . n A 1 29 GLU 29 26 26 GLU GLU A . n A 1 30 ILE 30 27 27 ILE ILE A . n A 1 31 SER 31 28 28 SER SER A . n A 1 32 LEU 32 29 29 LEU LEU A . n A 1 33 LEU 33 30 30 LEU LEU A . n A 1 34 LEU 34 31 31 LEU LEU A . n A 1 35 LEU 35 32 32 LEU LEU A . n A 1 36 LYS 36 33 33 LYS LYS A . n A 1 37 ARG 37 34 34 ARG ARG A . n A 1 38 ASN 38 35 35 ASN ASN A . n A 1 39 PHE 39 36 36 PHE PHE A . n A 1 40 GLU 40 37 37 GLU GLU A . n A 1 41 PRO 41 38 38 PRO PRO A . n A 1 42 ALA 42 39 39 ALA ALA A . n A 1 43 MSE 43 40 40 MSE MSE A . n A 1 44 GLY 44 41 41 GLY GLY A . n A 1 45 GLU 45 42 42 GLU GLU A . n A 1 46 TRP 46 43 43 TRP TRP A . n A 1 47 SER 47 44 44 SER SER A . n A 1 48 LEU 48 45 45 LEU LEU A . n A 1 49 MSE 49 46 46 MSE MSE A . n A 1 50 GLY 50 47 47 GLY GLY A . n A 1 51 GLY 51 48 48 GLY GLY A . n A 1 52 PHE 52 49 49 PHE PHE A . n A 1 53 VAL 53 50 50 VAL VAL A . n A 1 54 GLN 54 51 51 GLN GLN A . n A 1 55 LYS 55 52 52 LYS LYS A . n A 1 56 ASP 56 53 53 ASP ASP A . n A 1 57 GLU 57 54 54 GLU GLU A . n A 1 58 SER 58 55 55 SER SER A . n A 1 59 VAL 59 56 56 VAL VAL A . n A 1 60 ASP 60 57 57 ASP ASP A . n A 1 61 ASP 61 58 58 ASP ASP A . n A 1 62 ALA 62 59 59 ALA ALA A . n A 1 63 ALA 63 60 60 ALA ALA A . n A 1 64 LYS 64 61 61 LYS LYS A . n A 1 65 ARG 65 62 62 ARG ARG A . n A 1 66 VAL 66 63 63 VAL VAL A . n A 1 67 LEU 67 64 64 LEU LEU A . n A 1 68 ALA 68 65 65 ALA ALA A . n A 1 69 GLU 69 66 66 GLU GLU A . n A 1 70 LEU 70 67 67 LEU LEU A . n A 1 71 THR 71 68 68 THR THR A . n A 1 72 GLY 72 69 69 GLY GLY A . n A 1 73 LEU 73 70 70 LEU LEU A . n A 1 74 GLU 74 71 71 GLU GLU A . n A 1 75 ASN 75 72 72 ASN ASN A . n A 1 76 VAL 76 73 73 VAL VAL A . n A 1 77 TYR 77 74 74 TYR TYR A . n A 1 78 MSE 78 75 75 MSE MSE A . n A 1 79 GLU 79 76 76 GLU GLU A . n A 1 80 GLN 80 77 77 GLN GLN A . n A 1 81 VAL 81 78 78 VAL VAL A . n A 1 82 GLY 82 79 79 GLY GLY A . n A 1 83 ALA 83 80 80 ALA ALA A . n A 1 84 PHE 84 81 81 PHE PHE A . n A 1 85 GLY 85 82 82 GLY GLY A . n A 1 86 ALA 86 83 83 ALA ALA A . n A 1 87 ILE 87 84 84 ILE ILE A . n A 1 88 ASP 88 85 85 ASP ASP A . n A 1 89 ARG 89 86 86 ARG ARG A . n A 1 90 ASP 90 87 87 ASP ASP A . n A 1 91 PRO 91 88 88 PRO PRO A . n A 1 92 GLY 92 89 89 GLY GLY A . n A 1 93 GLU 93 90 90 GLU GLU A . n A 1 94 ARG 94 91 91 ARG ARG A . n A 1 95 VAL 95 92 92 VAL VAL A . n A 1 96 VAL 96 93 93 VAL VAL A . n A 1 97 SER 97 94 94 SER SER A . n A 1 98 ILE 98 95 95 ILE ILE A . n A 1 99 ALA 99 96 96 ALA ALA A . n A 1 100 TYR 100 97 97 TYR TYR A . n A 1 101 TYR 101 98 98 TYR TYR A . n A 1 102 ALA 102 99 99 ALA ALA A . n A 1 103 LEU 103 100 100 LEU LEU A . n A 1 104 ILE 104 101 101 ILE ILE A . n A 1 105 ASN 105 102 102 ASN ASN A . n A 1 106 ILE 106 103 103 ILE ILE A . n A 1 107 ASN 107 104 104 ASN ASN A . n A 1 108 GLU 108 105 105 GLU GLU A . n A 1 109 TYR 109 106 106 TYR TYR A . n A 1 110 ASP 110 107 107 ASP ASP A . n A 1 111 ARG 111 108 108 ARG ARG A . n A 1 112 GLU 112 109 109 GLU GLU A . n A 1 113 LEU 113 110 110 LEU LEU A . n A 1 114 VAL 114 111 111 VAL VAL A . n A 1 115 GLN 115 112 112 GLN GLN A . n A 1 116 LYS 116 113 113 LYS LYS A . n A 1 117 HIS 117 114 114 HIS HIS A . n A 1 118 ASN 118 115 115 ASN ASN A . n A 1 119 ALA 119 116 116 ALA ALA A . n A 1 120 TYR 120 117 117 TYR TYR A . n A 1 121 TRP 121 118 118 TRP TRP A . n A 1 122 VAL 122 119 119 VAL VAL A . n A 1 123 ASN 123 120 120 ASN ASN A . n A 1 124 ILE 124 121 121 ILE ILE A . n A 1 125 ASN 125 122 122 ASN ASN A . n A 1 126 GLU 126 123 123 GLU GLU A . n A 1 127 LEU 127 124 124 LEU LEU A . n A 1 128 PRO 128 125 125 PRO PRO A . n A 1 129 ALA 129 126 126 ALA ALA A . n A 1 130 LEU 130 127 127 LEU LEU A . n A 1 131 ILE 131 128 128 ILE ILE A . n A 1 132 PHE 132 129 129 PHE PHE A . n A 1 133 ASP 133 130 130 ASP ASP A . n A 1 134 HIS 134 131 131 HIS HIS A . n A 1 135 PRO 135 132 132 PRO PRO A . n A 1 136 GLU 136 133 133 GLU GLU A . n A 1 137 MSE 137 134 134 MSE MSE A . n A 1 138 VAL 138 135 135 VAL VAL A . n A 1 139 ASP 139 136 136 ASP ASP A . n A 1 140 LYS 140 137 137 LYS LYS A . n A 1 141 ALA 141 138 138 ALA ALA A . n A 1 142 ARG 142 139 139 ARG ARG A . n A 1 143 GLU 143 140 140 GLU GLU A . n A 1 144 MSE 144 141 141 MSE MSE A . n A 1 145 MSE 145 142 142 MSE MSE A . n A 1 146 LYS 146 143 143 LYS LYS A . n A 1 147 GLN 147 144 144 GLN GLN A . n A 1 148 LYS 148 145 145 LYS LYS A . n A 1 149 ALA 149 146 146 ALA ALA A . n A 1 150 SER 150 147 147 SER SER A . n A 1 151 VAL 151 148 148 VAL VAL A . n A 1 152 GLU 152 149 149 GLU GLU A . n A 1 153 PRO 153 150 150 PRO PRO A . n A 1 154 ILE 154 151 151 ILE ILE A . n A 1 155 GLY 155 152 152 GLY GLY A . n A 1 156 PHE 156 153 153 PHE PHE A . n A 1 157 ASN 157 154 154 ASN ASN A . n A 1 158 LEU 158 155 155 LEU LEU A . n A 1 159 LEU 159 156 156 LEU LEU A . n A 1 160 PRO 160 157 157 PRO PRO A . n A 1 161 LYS 161 158 158 LYS LYS A . n A 1 162 LEU 162 159 159 LEU LEU A . n A 1 163 PHE 163 160 160 PHE PHE A . n A 1 164 THR 164 161 161 THR THR A . n A 1 165 LEU 165 162 162 LEU LEU A . n A 1 166 SER 166 163 163 SER SER A . n A 1 167 GLN 167 164 164 GLN GLN A . n A 1 168 LEU 168 165 165 LEU LEU A . n A 1 169 GLN 169 166 166 GLN GLN A . n A 1 170 SER 170 167 167 SER SER A . n A 1 171 LEU 171 168 168 LEU LEU A . n A 1 172 TYR 172 169 169 TYR TYR A . n A 1 173 GLU 173 170 170 GLU GLU A . n A 1 174 ALA 174 171 171 ALA ALA A . n A 1 175 ILE 175 172 172 ILE ILE A . n A 1 176 TYR 176 173 173 TYR TYR A . n A 1 177 GLY 177 174 174 GLY GLY A . n A 1 178 GLU 178 175 175 GLU GLU A . n A 1 179 PRO 179 176 176 PRO PRO A . n A 1 180 MSE 180 177 177 MSE MSE A . n A 1 181 ASP 181 178 178 ASP ASP A . n A 1 182 LYS 182 179 179 LYS LYS A . n A 1 183 ARG 183 180 180 ARG ARG A . n A 1 184 ASN 184 181 181 ASN ASN A . n A 1 185 PHE 185 182 182 PHE PHE A . n A 1 186 ARG 186 183 183 ARG ARG A . n A 1 187 LYS 187 184 184 LYS LYS A . n A 1 188 ARG 188 185 185 ARG ARG A . n A 1 189 VAL 189 186 186 VAL VAL A . n A 1 190 ALA 190 187 187 ALA ALA A . n A 1 191 GLU 191 188 188 GLU GLU A . n A 1 192 MSE 192 189 189 MSE MSE A . n A 1 193 ASP 193 190 190 ASP ASP A . n A 1 194 PHE 194 191 191 PHE PHE A . n A 1 195 ILE 195 192 192 ILE ILE A . n A 1 196 GLU 196 193 193 GLU GLU A . n A 1 197 LYS 197 194 194 LYS LYS A . n A 1 198 THR 198 195 195 THR THR A . n A 1 199 ASP 199 196 196 ASP ASP A . n A 1 200 LYS 200 197 197 LYS LYS A . n A 1 201 ILE 201 198 198 ILE ILE A . n A 1 202 ASP 202 199 199 ASP ASP A . n A 1 203 LYS 203 200 200 LYS LYS A . n A 1 204 LEU 204 201 201 LEU LEU A . n A 1 205 GLY 205 202 202 GLY GLY A . n A 1 206 SER 206 203 203 SER SER A . n A 1 207 LYS 207 204 204 LYS LYS A . n A 1 208 ARG 208 205 205 ARG ARG A . n A 1 209 GLY 209 206 206 GLY GLY A . n A 1 210 ALA 210 207 207 ALA ALA A . n A 1 211 ALA 211 208 208 ALA ALA A . n A 1 212 LEU 212 209 209 LEU LEU A . n A 1 213 TYR 213 210 210 TYR TYR A . n A 1 214 LYS 214 211 211 LYS LYS A . n A 1 215 PHE 215 212 212 PHE PHE A . n A 1 216 ASN 216 213 213 ASN ASN A . n A 1 217 GLY 217 214 214 GLY GLY A . n A 1 218 LYS 218 215 215 LYS LYS A . n A 1 219 ALA 219 216 216 ALA ALA A . n A 1 220 TYR 220 217 217 TYR TYR A . n A 1 221 ARG 221 218 218 ARG ARG A . n A 1 222 LYS 222 219 219 LYS LYS A . n A 1 223 ASP 223 220 220 ASP ASP A . n A 1 224 PRO 224 221 221 PRO PRO A . n A 1 225 LYS 225 222 222 LYS LYS A . n A 1 226 PHE 226 223 223 PHE PHE A . n A 1 227 LYS 227 224 224 LYS LYS A . n A 1 228 LEU 228 225 225 LEU LEU A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 301 1 EDO EDO A . C 3 ACT 1 302 1 ACT ACT A . D 4 HOH 1 401 6 HOH HOH A . D 4 HOH 2 402 11 HOH HOH A . D 4 HOH 3 403 10 HOH HOH A . D 4 HOH 4 404 7 HOH HOH A . D 4 HOH 5 405 8 HOH HOH A . D 4 HOH 6 406 26 HOH HOH A . D 4 HOH 7 407 13 HOH HOH A . D 4 HOH 8 408 3 HOH HOH A . D 4 HOH 9 409 15 HOH HOH A . D 4 HOH 10 410 28 HOH HOH A . D 4 HOH 11 411 18 HOH HOH A . D 4 HOH 12 412 1 HOH HOH A . D 4 HOH 13 413 16 HOH HOH A . D 4 HOH 14 414 4 HOH HOH A . D 4 HOH 15 415 5 HOH HOH A . D 4 HOH 16 416 27 HOH HOH A . D 4 HOH 17 417 25 HOH HOH A . D 4 HOH 18 418 12 HOH HOH A . D 4 HOH 19 419 24 HOH HOH A . D 4 HOH 20 420 9 HOH HOH A . D 4 HOH 21 421 2 HOH HOH A . D 4 HOH 22 422 23 HOH HOH A . D 4 HOH 23 423 21 HOH HOH A . D 4 HOH 24 424 20 HOH HOH A . D 4 HOH 25 425 19 HOH HOH A . D 4 HOH 26 426 14 HOH HOH A . D 4 HOH 27 427 17 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 43 A MSE 40 ? MET 'modified residue' 2 A MSE 49 A MSE 46 ? MET 'modified residue' 3 A MSE 78 A MSE 75 ? MET 'modified residue' 4 A MSE 137 A MSE 134 ? MET 'modified residue' 5 A MSE 144 A MSE 141 ? MET 'modified residue' 6 A MSE 145 A MSE 142 ? MET 'modified residue' 7 A MSE 180 A MSE 177 ? MET 'modified residue' 8 A MSE 192 A MSE 189 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3820 ? 1 MORE -1 ? 1 'SSA (A^2)' 22000 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 16_555 x,-y,-z+1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 61.8675000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-09 2 'Structure model' 1 1 2015-10-21 3 'Structure model' 1 2 2015-12-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 59.5665 7.2987 32.5131 0.0313 ? -0.0503 ? -0.0203 ? 0.0956 ? 0.0449 ? 0.1373 ? 10.5504 ? -6.4788 ? -2.6544 ? 5.3294 ? 1.3492 ? 2.1421 ? -0.0843 ? -0.0933 ? 0.0791 ? 0.0855 ? -0.0782 ? -0.0968 ? -0.1795 ? 0.3783 ? 0.1625 ? 2 'X-RAY DIFFRACTION' ? refined 57.8092 21.5097 30.1694 0.1486 ? -0.0615 ? -0.0530 ? 0.0370 ? 0.0353 ? 0.1321 ? 16.5673 ? 0.5532 ? -1.9691 ? 6.9419 ? -0.9767 ? 4.4514 ? -0.0045 ? -0.3486 ? 0.1680 ? -0.1067 ? -0.1304 ? -0.6239 ? -0.5491 ? 0.2804 ? 0.1349 ? 3 'X-RAY DIFFRACTION' ? refined 57.7151 14.2850 34.4151 0.0865 ? -0.0580 ? -0.0422 ? 0.0646 ? -0.0065 ? 0.0915 ? 2.0303 ? -1.3267 ? -0.3223 ? 5.1013 ? -0.5861 ? 3.6381 ? -0.0109 ? -0.1627 ? 0.1203 ? 0.2353 ? -0.0339 ? -0.2364 ? -0.3429 ? 0.2411 ? 0.0448 ? 4 'X-RAY DIFFRACTION' ? refined 37.4535 13.2435 35.9487 0.0918 ? -0.0466 ? -0.0149 ? 0.0574 ? -0.0437 ? 0.2561 ? 4.2497 ? -2.9045 ? -2.7071 ? 2.1196 ? 1.4902 ? 2.7373 ? 0.0521 ? 0.2881 ? -0.4397 ? -0.0735 ? -0.1556 ? 0.3849 ? 0.0317 ? -0.2739 ? 0.1035 ? 5 'X-RAY DIFFRACTION' ? refined 29.9055 17.2796 48.0196 0.0634 ? -0.0528 ? 0.0551 ? 0.2640 ? 0.0554 ? 0.2563 ? 5.2733 ? -2.0441 ? -2.7944 ? 9.9977 ? 5.2603 ? 6.8253 ? -0.4153 ? -0.2237 ? -0.4821 ? -0.0806 ? 0.2289 ? 0.0296 ? 0.2175 ? -0.4891 ? 0.1864 ? 6 'X-RAY DIFFRACTION' ? refined 31.6116 2.5424 43.8281 0.8577 ? -0.2218 ? 0.2879 ? 0.4808 ? -0.2239 ? 0.8123 ? 18.7541 ? 0.9378 ? -0.0998 ? 10.0314 ? -9.8382 ? 9.7090 ? -0.9688 ? 0.4351 ? -1.4813 ? -0.2124 ? 1.3109 ? 0.4201 ? 0.2905 ? -1.2686 ? -0.3421 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 5 ? ? A 25 ? ? 2 'X-RAY DIFFRACTION' 2 ? ? A 26 ? ? A 39 ? ? 3 'X-RAY DIFFRACTION' 3 ? ? A 40 ? ? A 132 ? ? 4 'X-RAY DIFFRACTION' 4 ? ? A 133 ? ? A 181 ? ? 5 'X-RAY DIFFRACTION' 5 ? ? A 182 ? ? A 218 ? ? 6 'X-RAY DIFFRACTION' 6 ? ? A 219 ? ? A 225 ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0029 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 5 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? SBC-Collect ? ? ? . 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 129 ? ? 52.31 -131.54 2 1 PRO A 150 ? ? -80.76 43.11 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 180 ? CG ? A ARG 183 CG 2 1 Y 1 A ARG 180 ? CD ? A ARG 183 CD 3 1 Y 1 A ARG 180 ? NE ? A ARG 183 NE 4 1 Y 1 A ARG 180 ? CZ ? A ARG 183 CZ 5 1 Y 1 A ARG 180 ? NH1 ? A ARG 183 NH1 6 1 Y 1 A ARG 180 ? NH2 ? A ARG 183 NH2 7 1 Y 1 A LYS 215 ? CG ? A LYS 218 CG 8 1 Y 1 A LYS 215 ? CD ? A LYS 218 CD 9 1 Y 1 A LYS 215 ? CE ? A LYS 218 CE 10 1 Y 1 A LYS 215 ? NZ ? A LYS 218 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A ALA 0 ? A ALA 3 4 1 Y 1 A MSE 1 ? A MSE 4 5 1 Y 1 A LYS 2 ? A LYS 5 6 1 Y 1 A ASN 3 ? A ASN 6 7 1 Y 1 A TYR 4 ? A TYR 7 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 'ACETATE ION' ACT 4 water HOH #