data_5HIZ # _entry.id 5HIZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.311 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5HIZ WWPDB D_1000217023 # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5HIY _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HIZ _pdbx_database_status.recvd_initial_deposition_date 2016-01-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Deng, F.' 1 ? 'Peng, G.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Virol. _citation.journal_id_ASTM JOVIAM _citation.journal_id_CSD 0825 _citation.journal_id_ISSN 1098-5514 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 92 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Dimerization of Coronavirus nsp9 with Diverse Modes Enhances Its Nucleic Acid Binding Affinity.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/JVI.00692-18 _citation.pdbx_database_id_PubMed 29925659 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zeng, Z.' 1 ? primary 'Deng, F.' 2 ? primary 'Shi, K.' 3 ? primary 'Ye, G.' 4 ? primary 'Wang, G.' 5 ? primary 'Fang, L.' 6 0000-0003-1406-6409 primary 'Xiao, S.' 7 0000-0003-0023-9188 primary 'Fu, Z.' 8 ? primary 'Peng, G.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5HIZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 73.870 _cell.length_a_esd ? _cell.length_b 73.870 _cell.length_b_esd ? _cell.length_c 91.553 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HIZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 172 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Non-structural protein 9' _entity.formula_weight 12936.736 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name NSP9 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;NNEIIPGKLKQRSIKAEGDGIVGEGKALYNNEGGRTFMYAFISDKPDLRVVKWEFDGGCNTIELEPPRKFLVDSPNGAQI KYLYFVRNLNTLRRGAVLGYIGATVRLQHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;NNEIIPGKLKQRSIKAEGDGIVGEGKALYNNEGGRTFMYAFISDKPDLRVVKWEFDGGCNTIELEPPRKFLVDSPNGAQI KYLYFVRNLNTLRRGAVLGYIGATVRLQHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 ASN n 1 3 GLU n 1 4 ILE n 1 5 ILE n 1 6 PRO n 1 7 GLY n 1 8 LYS n 1 9 LEU n 1 10 LYS n 1 11 GLN n 1 12 ARG n 1 13 SER n 1 14 ILE n 1 15 LYS n 1 16 ALA n 1 17 GLU n 1 18 GLY n 1 19 ASP n 1 20 GLY n 1 21 ILE n 1 22 VAL n 1 23 GLY n 1 24 GLU n 1 25 GLY n 1 26 LYS n 1 27 ALA n 1 28 LEU n 1 29 TYR n 1 30 ASN n 1 31 ASN n 1 32 GLU n 1 33 GLY n 1 34 GLY n 1 35 ARG n 1 36 THR n 1 37 PHE n 1 38 MET n 1 39 TYR n 1 40 ALA n 1 41 PHE n 1 42 ILE n 1 43 SER n 1 44 ASP n 1 45 LYS n 1 46 PRO n 1 47 ASP n 1 48 LEU n 1 49 ARG n 1 50 VAL n 1 51 VAL n 1 52 LYS n 1 53 TRP n 1 54 GLU n 1 55 PHE n 1 56 ASP n 1 57 GLY n 1 58 GLY n 1 59 CYS n 1 60 ASN n 1 61 THR n 1 62 ILE n 1 63 GLU n 1 64 LEU n 1 65 GLU n 1 66 PRO n 1 67 PRO n 1 68 ARG n 1 69 LYS n 1 70 PHE n 1 71 LEU n 1 72 VAL n 1 73 ASP n 1 74 SER n 1 75 PRO n 1 76 ASN n 1 77 GLY n 1 78 ALA n 1 79 GLN n 1 80 ILE n 1 81 LYS n 1 82 TYR n 1 83 LEU n 1 84 TYR n 1 85 PHE n 1 86 VAL n 1 87 ARG n 1 88 ASN n 1 89 LEU n 1 90 ASN n 1 91 THR n 1 92 LEU n 1 93 ARG n 1 94 ARG n 1 95 GLY n 1 96 ALA n 1 97 VAL n 1 98 LEU n 1 99 GLY n 1 100 TYR n 1 101 ILE n 1 102 GLY n 1 103 ALA n 1 104 THR n 1 105 VAL n 1 106 ARG n 1 107 LEU n 1 108 GLN n 1 109 HIS n 1 110 HIS n 1 111 HIS n 1 112 HIS n 1 113 HIS n 1 114 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 114 _entity_src_gen.gene_src_common_name PEDV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rep, 1a-1b' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain CV777 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Porcine epidemic diarrhea virus CV777' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 229032 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-Gold(DE3)pLysS AG' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code R1AB_PEDV7 _struct_ref.pdbx_db_accession P0C6Y4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NNEIIPGKLKQRSIKAEGDGIVGEGKALYNNEGGRTFMYAFISDKPDLRVVKWEFDGGCNTIELEPPRKFLVDSPNGAQI KYLYFVRNLNTLRRGAVLGYIGATVRLQ ; _struct_ref.pdbx_align_begin 3858 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5HIZ A 1 ? 108 ? P0C6Y4 3858 ? 3965 ? 1 108 2 1 5HIZ B 1 ? 108 ? P0C6Y4 3858 ? 3965 ? 1 108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5HIZ HIS A 109 ? UNP P0C6Y4 ? ? 'expression tag' 109 1 1 5HIZ HIS A 110 ? UNP P0C6Y4 ? ? 'expression tag' 110 2 1 5HIZ HIS A 111 ? UNP P0C6Y4 ? ? 'expression tag' 111 3 1 5HIZ HIS A 112 ? UNP P0C6Y4 ? ? 'expression tag' 112 4 1 5HIZ HIS A 113 ? UNP P0C6Y4 ? ? 'expression tag' 113 5 1 5HIZ HIS A 114 ? UNP P0C6Y4 ? ? 'expression tag' 114 6 2 5HIZ HIS B 109 ? UNP P0C6Y4 ? ? 'expression tag' 109 7 2 5HIZ HIS B 110 ? UNP P0C6Y4 ? ? 'expression tag' 110 8 2 5HIZ HIS B 111 ? UNP P0C6Y4 ? ? 'expression tag' 111 9 2 5HIZ HIS B 112 ? UNP P0C6Y4 ? ? 'expression tag' 112 10 2 5HIZ HIS B 113 ? UNP P0C6Y4 ? ? 'expression tag' 113 11 2 5HIZ HIS B 114 ? UNP P0C6Y4 ? ? 'expression tag' 114 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HIZ _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.3 M Tris, 13%(v/v) tert-Butano' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-10-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97910 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97910 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5HIZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.9 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6415 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.2 _reflns.pdbx_Rmerge_I_obs 0.061 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 4.2 _reflns.pdbx_netI_over_sigmaI 36.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.9 _reflns_shell.d_res_low 3.0 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.061 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.702 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HIZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.9 _refine.ls_d_res_low 50 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6340 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.3338 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2717 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1498 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1498 _refine_hist.d_res_high 2.9 _refine_hist.d_res_low 50 # _struct.entry_id 5HIZ _struct.title 'The structure of PEDV NSP9' _struct.pdbx_descriptor 'Non-structural protein 9' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HIZ _struct_keywords.text 'RNA binding protein' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 90 ? GLY A 102 ? ASN A 90 GLY A 102 1 ? 13 HELX_P HELX_P2 AA2 ASN B 90 ? THR B 104 ? ASN B 90 THR B 104 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 59 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 59 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 59 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 59 _struct_conn.ptnr2_symmetry 5_455 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.064 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 20 A . ? GLY 20 A ILE 21 A ? ILE 21 A 1 1.75 2 GLU 32 A . ? GLU 32 A GLY 33 A ? GLY 33 A 1 9.39 3 GLY 33 A . ? GLY 33 A GLY 34 A ? GLY 34 A 1 -7.48 4 GLY 33 B . ? GLY 33 B GLY 34 B ? GLY 34 B 1 -2.46 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 5 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 10 ? GLU A 17 ? LYS A 10 GLU A 17 AA1 2 VAL A 22 ? ASN A 31 ? VAL A 22 ASN A 31 AA1 3 THR A 36 ? SER A 43 ? THR A 36 SER A 43 AA1 4 ALA A 78 ? PHE A 85 ? ALA A 78 PHE A 85 AA1 5 ARG A 68 ? ASP A 73 ? ARG A 68 ASP A 73 AA2 1 VAL A 50 ? TRP A 53 ? VAL A 50 TRP A 53 AA2 2 ASN A 60 ? GLU A 63 ? ASN A 60 GLU A 63 AA3 1 LYS B 10 ? GLU B 17 ? LYS B 10 GLU B 17 AA3 2 VAL B 22 ? ASN B 31 ? VAL B 22 ASN B 31 AA3 3 THR B 36 ? ILE B 42 ? THR B 36 ILE B 42 AA3 4 GLN B 79 ? PHE B 85 ? GLN B 79 PHE B 85 AA3 5 ARG B 68 ? VAL B 72 ? ARG B 68 VAL B 72 AA4 1 VAL B 50 ? LYS B 52 ? VAL B 50 LYS B 52 AA4 2 THR B 61 ? GLU B 63 ? THR B 61 GLU B 63 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 12 ? N ARG A 12 O ALA A 27 ? O ALA A 27 AA1 2 3 N LYS A 26 ? N LYS A 26 O ILE A 42 ? O ILE A 42 AA1 3 4 N PHE A 41 ? N PHE A 41 O TYR A 84 ? O TYR A 84 AA1 4 5 O LYS A 81 ? O LYS A 81 N PHE A 70 ? N PHE A 70 AA2 1 2 N VAL A 51 ? N VAL A 51 O ILE A 62 ? O ILE A 62 AA3 1 2 N ARG B 12 ? N ARG B 12 O ALA B 27 ? O ALA B 27 AA3 2 3 N ASN B 30 ? N ASN B 30 O PHE B 37 ? O PHE B 37 AA3 3 4 N PHE B 41 ? N PHE B 41 O TYR B 84 ? O TYR B 84 AA3 4 5 O LYS B 81 ? O LYS B 81 N PHE B 70 ? N PHE B 70 AA4 1 2 N VAL B 51 ? N VAL B 51 O ILE B 62 ? O ILE B 62 # _atom_sites.entry_id 5HIZ _atom_sites.fract_transf_matrix[1][1] 0.013537 _atom_sites.fract_transf_matrix[1][2] 0.007816 _atom_sites.fract_transf_matrix[1][3] -0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015632 _atom_sites.fract_transf_matrix[2][3] -0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010923 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 ILE 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 GLU 54 54 ? ? ? A . n A 1 55 PHE 55 55 ? ? ? A . n A 1 56 ASP 56 56 ? ? ? A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ARG 106 106 ? ? ? A . n A 1 107 LEU 107 107 ? ? ? A . n A 1 108 GLN 108 108 ? ? ? A . n A 1 109 HIS 109 109 ? ? ? A . n A 1 110 HIS 110 110 ? ? ? A . n A 1 111 HIS 111 111 ? ? ? A . n A 1 112 HIS 112 112 ? ? ? A . n A 1 113 HIS 113 113 ? ? ? A . n A 1 114 HIS 114 114 ? ? ? A . n B 1 1 ASN 1 1 ? ? ? B . n B 1 2 ASN 2 2 ? ? ? B . n B 1 3 GLU 3 3 ? ? ? B . n B 1 4 ILE 4 4 ? ? ? B . n B 1 5 ILE 5 5 ? ? ? B . n B 1 6 PRO 6 6 ? ? ? B . n B 1 7 GLY 7 7 7 GLY GLY B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 LYS 10 10 10 LYS LYS B . n B 1 11 GLN 11 11 11 GLN GLN B . n B 1 12 ARG 12 12 12 ARG ARG B . n B 1 13 SER 13 13 13 SER SER B . n B 1 14 ILE 14 14 14 ILE ILE B . n B 1 15 LYS 15 15 15 LYS LYS B . n B 1 16 ALA 16 16 16 ALA ALA B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 GLY 18 18 18 GLY GLY B . n B 1 19 ASP 19 19 19 ASP ASP B . n B 1 20 GLY 20 20 20 GLY GLY B . n B 1 21 ILE 21 21 21 ILE ILE B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 GLY 23 23 23 GLY GLY B . n B 1 24 GLU 24 24 24 GLU GLU B . n B 1 25 GLY 25 25 25 GLY GLY B . n B 1 26 LYS 26 26 26 LYS LYS B . n B 1 27 ALA 27 27 27 ALA ALA B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 TYR 29 29 29 TYR TYR B . n B 1 30 ASN 30 30 30 ASN ASN B . n B 1 31 ASN 31 31 31 ASN ASN B . n B 1 32 GLU 32 32 32 GLU GLU B . n B 1 33 GLY 33 33 33 GLY GLY B . n B 1 34 GLY 34 34 34 GLY GLY B . n B 1 35 ARG 35 35 35 ARG ARG B . n B 1 36 THR 36 36 36 THR THR B . n B 1 37 PHE 37 37 37 PHE PHE B . n B 1 38 MET 38 38 38 MET MET B . n B 1 39 TYR 39 39 39 TYR TYR B . n B 1 40 ALA 40 40 40 ALA ALA B . n B 1 41 PHE 41 41 41 PHE PHE B . n B 1 42 ILE 42 42 42 ILE ILE B . n B 1 43 SER 43 43 43 SER SER B . n B 1 44 ASP 44 44 44 ASP ASP B . n B 1 45 LYS 45 45 45 LYS LYS B . n B 1 46 PRO 46 46 46 PRO PRO B . n B 1 47 ASP 47 47 47 ASP ASP B . n B 1 48 LEU 48 48 48 LEU LEU B . n B 1 49 ARG 49 49 49 ARG ARG B . n B 1 50 VAL 50 50 50 VAL VAL B . n B 1 51 VAL 51 51 51 VAL VAL B . n B 1 52 LYS 52 52 52 LYS LYS B . n B 1 53 TRP 53 53 53 TRP TRP B . n B 1 54 GLU 54 54 ? ? ? B . n B 1 55 PHE 55 55 ? ? ? B . n B 1 56 ASP 56 56 ? ? ? B . n B 1 57 GLY 57 57 57 GLY GLY B . n B 1 58 GLY 58 58 58 GLY GLY B . n B 1 59 CYS 59 59 59 CYS CYS B . n B 1 60 ASN 60 60 60 ASN ASN B . n B 1 61 THR 61 61 61 THR THR B . n B 1 62 ILE 62 62 62 ILE ILE B . n B 1 63 GLU 63 63 63 GLU GLU B . n B 1 64 LEU 64 64 64 LEU LEU B . n B 1 65 GLU 65 65 65 GLU GLU B . n B 1 66 PRO 66 66 66 PRO PRO B . n B 1 67 PRO 67 67 67 PRO PRO B . n B 1 68 ARG 68 68 68 ARG ARG B . n B 1 69 LYS 69 69 69 LYS LYS B . n B 1 70 PHE 70 70 70 PHE PHE B . n B 1 71 LEU 71 71 71 LEU LEU B . n B 1 72 VAL 72 72 72 VAL VAL B . n B 1 73 ASP 73 73 73 ASP ASP B . n B 1 74 SER 74 74 74 SER SER B . n B 1 75 PRO 75 75 75 PRO PRO B . n B 1 76 ASN 76 76 76 ASN ASN B . n B 1 77 GLY 77 77 77 GLY GLY B . n B 1 78 ALA 78 78 78 ALA ALA B . n B 1 79 GLN 79 79 79 GLN GLN B . n B 1 80 ILE 80 80 80 ILE ILE B . n B 1 81 LYS 81 81 81 LYS LYS B . n B 1 82 TYR 82 82 82 TYR TYR B . n B 1 83 LEU 83 83 83 LEU LEU B . n B 1 84 TYR 84 84 84 TYR TYR B . n B 1 85 PHE 85 85 85 PHE PHE B . n B 1 86 VAL 86 86 86 VAL VAL B . n B 1 87 ARG 87 87 87 ARG ARG B . n B 1 88 ASN 88 88 88 ASN ASN B . n B 1 89 LEU 89 89 89 LEU LEU B . n B 1 90 ASN 90 90 90 ASN ASN B . n B 1 91 THR 91 91 91 THR THR B . n B 1 92 LEU 92 92 92 LEU LEU B . n B 1 93 ARG 93 93 93 ARG ARG B . n B 1 94 ARG 94 94 94 ARG ARG B . n B 1 95 GLY 95 95 95 GLY GLY B . n B 1 96 ALA 96 96 96 ALA ALA B . n B 1 97 VAL 97 97 97 VAL VAL B . n B 1 98 LEU 98 98 98 LEU LEU B . n B 1 99 GLY 99 99 99 GLY GLY B . n B 1 100 TYR 100 100 100 TYR TYR B . n B 1 101 ILE 101 101 101 ILE ILE B . n B 1 102 GLY 102 102 102 GLY GLY B . n B 1 103 ALA 103 103 103 ALA ALA B . n B 1 104 THR 104 104 104 THR THR B . n B 1 105 VAL 105 105 105 VAL VAL B . n B 1 106 ARG 106 106 ? ? ? B . n B 1 107 LEU 107 107 ? ? ? B . n B 1 108 GLN 108 108 ? ? ? B . n B 1 109 HIS 109 109 ? ? ? B . n B 1 110 HIS 110 110 ? ? ? B . n B 1 111 HIS 111 111 ? ? ? B . n B 1 112 HIS 112 112 ? ? ? B . n B 1 113 HIS 113 113 ? ? ? B . n B 1 114 HIS 114 114 ? ? ? B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1030 ? 1 MORE -9 ? 1 'SSA (A^2)' 11730 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-25 2 'Structure model' 1 1 2019-07-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? Blu-Ice ? ? ? . 3 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 SER _pdbx_validate_rmsd_angle.auth_seq_id_1 74 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 75 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 75 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 130.23 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 10.93 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 19 ? ? -27.65 -42.62 2 1 ILE A 21 ? ? 127.15 132.73 3 1 THR A 61 ? ? -52.67 101.79 4 1 PRO A 75 ? ? -65.96 62.92 5 1 ASN A 76 ? ? -171.58 37.42 6 1 VAL A 97 ? ? -53.30 -77.66 7 1 LEU A 98 ? ? -29.93 -53.01 8 1 ILE A 101 ? ? -43.89 -78.09 9 1 ARG B 12 ? ? -171.80 131.76 10 1 ILE B 21 ? ? -154.50 -131.71 11 1 SER B 43 ? ? -93.30 -131.38 12 1 ASP B 44 ? ? -164.13 -4.89 13 1 THR B 61 ? ? -56.44 103.65 14 1 SER B 74 ? ? 164.69 166.67 15 1 PRO B 75 ? ? -49.27 -19.98 16 1 ILE B 101 ? ? -42.92 -72.12 17 1 THR B 104 ? ? -69.43 98.40 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 1 ? A ASN 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A ILE 5 ? A ILE 5 6 1 Y 1 A PRO 6 ? A PRO 6 7 1 Y 1 A GLU 54 ? A GLU 54 8 1 Y 1 A PHE 55 ? A PHE 55 9 1 Y 1 A ASP 56 ? A ASP 56 10 1 Y 1 A ARG 106 ? A ARG 106 11 1 Y 1 A LEU 107 ? A LEU 107 12 1 Y 1 A GLN 108 ? A GLN 108 13 1 Y 1 A HIS 109 ? A HIS 109 14 1 Y 1 A HIS 110 ? A HIS 110 15 1 Y 1 A HIS 111 ? A HIS 111 16 1 Y 1 A HIS 112 ? A HIS 112 17 1 Y 1 A HIS 113 ? A HIS 113 18 1 Y 1 A HIS 114 ? A HIS 114 19 1 Y 1 B ASN 1 ? B ASN 1 20 1 Y 1 B ASN 2 ? B ASN 2 21 1 Y 1 B GLU 3 ? B GLU 3 22 1 Y 1 B ILE 4 ? B ILE 4 23 1 Y 1 B ILE 5 ? B ILE 5 24 1 Y 1 B PRO 6 ? B PRO 6 25 1 Y 1 B GLU 54 ? B GLU 54 26 1 Y 1 B PHE 55 ? B PHE 55 27 1 Y 1 B ASP 56 ? B ASP 56 28 1 Y 1 B ARG 106 ? B ARG 106 29 1 Y 1 B LEU 107 ? B LEU 107 30 1 Y 1 B GLN 108 ? B GLN 108 31 1 Y 1 B HIS 109 ? B HIS 109 32 1 Y 1 B HIS 110 ? B HIS 110 33 1 Y 1 B HIS 111 ? B HIS 111 34 1 Y 1 B HIS 112 ? B HIS 112 35 1 Y 1 B HIS 113 ? B HIS 113 36 1 Y 1 B HIS 114 ? B HIS 114 #