data_5IO6 # _entry.id 5IO6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5IO6 pdb_00005io6 10.2210/pdb5io6/pdb WWPDB D_1000219157 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-16 2 'Structure model' 1 1 2017-11-15 3 'Structure model' 1 2 2024-01-10 4 'Structure model' 1 3 2024-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' citation 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_initial_refinement_model 8 4 'Structure model' pdbx_entry_details 9 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 3 'Structure model' '_citation.country' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5IO6 _pdbx_database_status.recvd_initial_deposition_date 2016-03-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5IO5 unspecified PDB . 5IO7 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kurpiewska, K.' 1 'Biela, A.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Colloids Surf B Biointerfaces' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1873-4367 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 161 _citation.language ? _citation.page_first 387 _citation.page_last 393 _citation.title 'Investigation of high pressure effect on the structure and adsorption of beta-lactoglobulin.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.colsurfb.2017.10.069 _citation.pdbx_database_id_PubMed 29112912 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kurpiewska, K.' 1 ? primary 'Biela, A.' 2 ? primary 'Loch, J.I.' 3 ? primary 'Swiatek, S.' 4 ? primary 'Jachimska, B.' 5 ? primary 'Lewinski, K.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Major allergen beta-lactoglobulin' 18387.264 1 ? ? ? ? 2 non-polymer syn DODECANE 170.335 1 ? ? ? ? 3 water nat water 18.015 32 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _entity_poly.pdbx_seq_one_letter_code_can ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 DODECANE D12 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 ILE n 1 3 VAL n 1 4 THR n 1 5 GLN n 1 6 THR n 1 7 MET n 1 8 LYS n 1 9 GLY n 1 10 LEU n 1 11 ASP n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 VAL n 1 16 ALA n 1 17 GLY n 1 18 THR n 1 19 TRP n 1 20 TYR n 1 21 SER n 1 22 LEU n 1 23 ALA n 1 24 MET n 1 25 ALA n 1 26 ALA n 1 27 SER n 1 28 ASP n 1 29 ILE n 1 30 SER n 1 31 LEU n 1 32 LEU n 1 33 ASP n 1 34 ALA n 1 35 GLN n 1 36 SER n 1 37 ALA n 1 38 PRO n 1 39 LEU n 1 40 ARG n 1 41 VAL n 1 42 TYR n 1 43 VAL n 1 44 GLU n 1 45 GLU n 1 46 LEU n 1 47 LYS n 1 48 PRO n 1 49 THR n 1 50 PRO n 1 51 GLU n 1 52 GLY n 1 53 ASP n 1 54 LEU n 1 55 GLU n 1 56 ILE n 1 57 LEU n 1 58 LEU n 1 59 GLN n 1 60 LYS n 1 61 TRP n 1 62 GLU n 1 63 ASN n 1 64 ASP n 1 65 GLU n 1 66 CYS n 1 67 ALA n 1 68 GLN n 1 69 LYS n 1 70 LYS n 1 71 ILE n 1 72 ILE n 1 73 ALA n 1 74 GLU n 1 75 LYS n 1 76 THR n 1 77 LYS n 1 78 ILE n 1 79 PRO n 1 80 ALA n 1 81 VAL n 1 82 PHE n 1 83 LYS n 1 84 ILE n 1 85 ASP n 1 86 ALA n 1 87 LEU n 1 88 ASN n 1 89 GLU n 1 90 ASN n 1 91 LYS n 1 92 VAL n 1 93 LEU n 1 94 VAL n 1 95 LEU n 1 96 ASP n 1 97 THR n 1 98 ASP n 1 99 TYR n 1 100 LYS n 1 101 LYS n 1 102 TYR n 1 103 LEU n 1 104 LEU n 1 105 PHE n 1 106 CYS n 1 107 MET n 1 108 GLU n 1 109 ASN n 1 110 SER n 1 111 ALA n 1 112 GLU n 1 113 PRO n 1 114 GLU n 1 115 GLN n 1 116 SER n 1 117 LEU n 1 118 VAL n 1 119 CYS n 1 120 GLN n 1 121 CYS n 1 122 LEU n 1 123 VAL n 1 124 ARG n 1 125 THR n 1 126 PRO n 1 127 GLU n 1 128 VAL n 1 129 ASP n 1 130 ASP n 1 131 GLU n 1 132 ALA n 1 133 LEU n 1 134 GLU n 1 135 LYS n 1 136 PHE n 1 137 ASP n 1 138 LYS n 1 139 ALA n 1 140 LEU n 1 141 LYS n 1 142 ALA n 1 143 LEU n 1 144 PRO n 1 145 MET n 1 146 HIS n 1 147 ILE n 1 148 ARG n 1 149 LEU n 1 150 SER n 1 151 PHE n 1 152 ASN n 1 153 PRO n 1 154 THR n 1 155 GLN n 1 156 LEU n 1 157 GLU n 1 158 GLU n 1 159 GLN n 1 160 CYS n 1 161 HIS n 1 162 ILE n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 162 _entity_src_nat.common_name Bovine _entity_src_nat.pdbx_organism_scientific 'Bos taurus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9913 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue MILK _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 D12 non-polymer . DODECANE ? 'C12 H26' 170.335 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 CYS 160 160 160 CYS CYS A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 ILE 162 162 162 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 D12 1 201 509 D12 D12 A . C 3 HOH 1 301 18 HOH HOH A . C 3 HOH 2 302 25 HOH HOH A . C 3 HOH 3 303 9 HOH HOH A . C 3 HOH 4 304 13 HOH HOH A . C 3 HOH 5 305 16 HOH HOH A . C 3 HOH 6 306 11 HOH HOH A . C 3 HOH 7 307 10 HOH HOH A . C 3 HOH 8 308 4 HOH HOH A . C 3 HOH 9 309 26 HOH HOH A . C 3 HOH 10 310 8 HOH HOH A . C 3 HOH 11 311 20 HOH HOH A . C 3 HOH 12 312 17 HOH HOH A . C 3 HOH 13 313 27 HOH HOH A . C 3 HOH 14 314 19 HOH HOH A . C 3 HOH 15 315 21 HOH HOH A . C 3 HOH 16 316 6 HOH HOH A . C 3 HOH 17 317 23 HOH HOH A . C 3 HOH 18 318 2 HOH HOH A . C 3 HOH 19 319 5 HOH HOH A . C 3 HOH 20 320 12 HOH HOH A . C 3 HOH 21 321 15 HOH HOH A . C 3 HOH 22 322 22 HOH HOH A . C 3 HOH 23 323 14 HOH HOH A . C 3 HOH 24 324 3 HOH HOH A . C 3 HOH 25 325 24 HOH HOH A . C 3 HOH 26 326 30 HOH HOH A . C 3 HOH 27 327 32 HOH HOH A . C 3 HOH 28 328 1 HOH HOH A . C 3 HOH 29 329 31 HOH HOH A . C 3 HOH 30 330 28 HOH HOH A . C 3 HOH 31 331 7 HOH HOH A . C 3 HOH 32 332 29 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 6 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 7 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5IO6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.193 _cell.length_a_esd ? _cell.length_b 53.193 _cell.length_b_esd ? _cell.length_c 112.019 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5IO6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IO6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.34 M citric sodium' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'Nonius Kappa CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2008-11-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.71069 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'SEALED TUBE' _diffrn_source.target ? _diffrn_source.type 'OXFORD DIFFRACTION ENHANCE ULTRA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.71069 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5IO6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.85 _reflns.d_resolution_low 20.15 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4645 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.8 _reflns.pdbx_Rmerge_I_obs 0.098 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 1.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.85 _reflns_shell.d_res_low 3.04 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 97.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.495 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 4.220 _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 101.460 _refine.B_iso_mean 20.8654 _refine.B_iso_min 0.190 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5IO6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8510 _refine.ls_d_res_low 20.1500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4409 _refine.ls_number_reflns_R_free 437 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.0000 _refine.ls_percent_reflns_R_free 9.9700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2058 _refine.ls_R_factor_R_free 0.2775 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1993 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.380 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3LBG _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.6900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.8510 _refine_hist.d_res_low 20.1500 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 1330 _refine_hist.pdbx_number_residues_total 162 _refine_hist.pdbx_B_iso_mean_ligand 13.05 _refine_hist.pdbx_B_iso_mean_solvent 23.06 _refine_hist.pdbx_number_atoms_protein 1286 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 ? 1329 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.182 ? 1798 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.064 ? 210 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 228 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.258 ? 842 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8506 3.2623 1488 . 147 1341 99.0000 . . . 0.3558 . 0.2423 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.2623 4.1067 1512 . 156 1356 100.0000 . . . 0.2837 . 0.1853 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 4.1067 23.9307 1584 . 154 1430 99.0000 . . . 0.2332 . 0.1784 . . . . . . 3 . . . # _struct.entry_id 5IO6 _struct.title 'Bovine beta-lactoglobulin complex with dodecane, ambient pressure' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IO6 _struct_keywords.text 'BETA-LACTOGLOBULIN, LIPOCALIN, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B5B0D4_BOVIN _struct_ref.pdbx_db_accession B5B0D4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _struct_ref.pdbx_align_begin 17 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5IO6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B5B0D4 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 178 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 162 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 560 ? 1 MORE 5 ? 1 'SSA (A^2)' 8270 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 28 ? LEU A 32 ? ASP A 28 LEU A 32 5 ? 5 HELX_P HELX_P2 AA2 ASP A 129 ? LYS A 141 ? ASP A 129 LYS A 141 1 ? 13 HELX_P HELX_P3 AA3 ASN A 152 ? GLU A 157 ? ASN A 152 GLU A 157 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 66 SG ? ? ? 1_555 A CYS 160 SG ? ? A CYS 66 A CYS 160 1_555 ? ? ? ? ? ? ? 2.018 ? ? disulf2 disulf ? ? A CYS 106 SG ? ? ? 1_555 A CYS 119 SG ? ? A CYS 106 A CYS 119 1_555 ? ? ? ? ? ? ? 2.035 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 66 ? CYS A 160 ? CYS A 66 ? 1_555 CYS A 160 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 106 ? CYS A 119 ? CYS A 106 ? 1_555 CYS A 119 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 17 ? THR A 18 ? GLY A 17 THR A 18 AA1 2 TYR A 42 ? PRO A 48 ? TYR A 42 PRO A 48 AA1 3 LEU A 54 ? TRP A 61 ? LEU A 54 TRP A 61 AA1 4 CYS A 66 ? LYS A 75 ? CYS A 66 LYS A 75 AA1 5 VAL A 81 ? ILE A 84 ? VAL A 81 ILE A 84 AA1 6 ASN A 90 ? THR A 97 ? ASN A 90 THR A 97 AA1 7 TYR A 102 ? GLU A 108 ? TYR A 102 GLU A 108 AA1 8 VAL A 118 ? VAL A 123 ? VAL A 118 VAL A 123 AA1 9 TYR A 20 ? ALA A 26 ? TYR A 20 ALA A 26 AA1 10 ILE A 147 ? SER A 150 ? ILE A 147 SER A 150 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 17 ? N GLY A 17 O LEU A 46 ? O LEU A 46 AA1 2 3 N LYS A 47 ? N LYS A 47 O GLU A 55 ? O GLU A 55 AA1 3 4 N ILE A 56 ? N ILE A 56 O ILE A 71 ? O ILE A 71 AA1 4 5 N GLU A 74 ? N GLU A 74 O LYS A 83 ? O LYS A 83 AA1 5 6 N PHE A 82 ? N PHE A 82 O VAL A 92 ? O VAL A 92 AA1 6 7 N LEU A 95 ? N LEU A 95 O LEU A 104 ? O LEU A 104 AA1 7 8 N MET A 107 ? N MET A 107 O VAL A 118 ? O VAL A 118 AA1 8 9 O CYS A 119 ? O CYS A 119 N ALA A 25 ? N ALA A 25 AA1 9 10 N MET A 24 ? N MET A 24 O LEU A 149 ? O LEU A 149 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id D12 _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'binding site for residue D12 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 LEU A 46 ? LEU A 46 . ? 1_555 ? 2 AC1 9 LEU A 54 ? LEU A 54 . ? 1_555 ? 3 AC1 9 ILE A 56 ? ILE A 56 . ? 1_555 ? 4 AC1 9 ILE A 71 ? ILE A 71 . ? 1_555 ? 5 AC1 9 ILE A 84 ? ILE A 84 . ? 1_555 ? 6 AC1 9 VAL A 92 ? VAL A 92 . ? 1_555 ? 7 AC1 9 VAL A 94 ? VAL A 94 . ? 1_555 ? 8 AC1 9 PHE A 105 ? PHE A 105 . ? 1_555 ? 9 AC1 9 MET A 107 ? MET A 107 . ? 1_555 ? # _pdbx_entry_details.entry_id 5IO6 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PRO 113 ? ? OG A SER 116 ? ? 2.03 2 1 NZ A LYS 75 ? ? O A HOH 301 ? ? 2.16 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A THR 125 ? ? N A PRO 126 ? ? 1.550 1.338 0.212 0.019 Y 2 1 C A LEU 143 ? ? N A PRO 144 ? ? 1.161 1.338 -0.177 0.019 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 2 ? ? -162.60 -24.88 2 1 ASP A 33 ? ? -55.30 -70.53 3 1 GLU A 62 ? ? -134.20 -91.89 4 1 ASP A 64 ? ? 99.90 10.17 5 1 THR A 97 ? ? -178.16 141.79 6 1 TYR A 99 ? ? 58.11 -29.93 7 1 LYS A 101 ? ? -138.45 -32.71 8 1 ALA A 111 ? ? -9.05 -114.00 9 1 PRO A 113 ? ? -60.04 -74.23 10 1 GLU A 114 ? ? -65.27 78.43 11 1 GLN A 115 ? ? 170.42 6.67 12 1 SER A 116 ? ? -137.93 -47.65 # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 1 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 LEU _pdbx_validate_polymer_linkage.auth_seq_id_1 143 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 ? _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 PRO _pdbx_validate_polymer_linkage.auth_seq_id_2 144 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 ? _pdbx_validate_polymer_linkage.dist 1.16 # _phasing.method MR # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 D12 C1 C N N 88 D12 C2 C N N 89 D12 C3 C N N 90 D12 C4 C N N 91 D12 C5 C N N 92 D12 C6 C N N 93 D12 C7 C N N 94 D12 C8 C N N 95 D12 C9 C N N 96 D12 C10 C N N 97 D12 C11 C N N 98 D12 C12 C N N 99 D12 H11 H N N 100 D12 H12 H N N 101 D12 H13 H N N 102 D12 H21 H N N 103 D12 H22 H N N 104 D12 H31 H N N 105 D12 H32 H N N 106 D12 H41 H N N 107 D12 H42 H N N 108 D12 H51 H N N 109 D12 H52 H N N 110 D12 H61 H N N 111 D12 H62 H N N 112 D12 H71 H N N 113 D12 H72 H N N 114 D12 H81 H N N 115 D12 H82 H N N 116 D12 H91 H N N 117 D12 H92 H N N 118 D12 H101 H N N 119 D12 H102 H N N 120 D12 H111 H N N 121 D12 H112 H N N 122 D12 H121 H N N 123 D12 H122 H N N 124 D12 H123 H N N 125 GLN N N N N 126 GLN CA C N S 127 GLN C C N N 128 GLN O O N N 129 GLN CB C N N 130 GLN CG C N N 131 GLN CD C N N 132 GLN OE1 O N N 133 GLN NE2 N N N 134 GLN OXT O N N 135 GLN H H N N 136 GLN H2 H N N 137 GLN HA H N N 138 GLN HB2 H N N 139 GLN HB3 H N N 140 GLN HG2 H N N 141 GLN HG3 H N N 142 GLN HE21 H N N 143 GLN HE22 H N N 144 GLN HXT H N N 145 GLU N N N N 146 GLU CA C N S 147 GLU C C N N 148 GLU O O N N 149 GLU CB C N N 150 GLU CG C N N 151 GLU CD C N N 152 GLU OE1 O N N 153 GLU OE2 O N N 154 GLU OXT O N N 155 GLU H H N N 156 GLU H2 H N N 157 GLU HA H N N 158 GLU HB2 H N N 159 GLU HB3 H N N 160 GLU HG2 H N N 161 GLU HG3 H N N 162 GLU HE2 H N N 163 GLU HXT H N N 164 GLY N N N N 165 GLY CA C N N 166 GLY C C N N 167 GLY O O N N 168 GLY OXT O N N 169 GLY H H N N 170 GLY H2 H N N 171 GLY HA2 H N N 172 GLY HA3 H N N 173 GLY HXT H N N 174 HIS N N N N 175 HIS CA C N S 176 HIS C C N N 177 HIS O O N N 178 HIS CB C N N 179 HIS CG C Y N 180 HIS ND1 N Y N 181 HIS CD2 C Y N 182 HIS CE1 C Y N 183 HIS NE2 N Y N 184 HIS OXT O N N 185 HIS H H N N 186 HIS H2 H N N 187 HIS HA H N N 188 HIS HB2 H N N 189 HIS HB3 H N N 190 HIS HD1 H N N 191 HIS HD2 H N N 192 HIS HE1 H N N 193 HIS HE2 H N N 194 HIS HXT H N N 195 HOH O O N N 196 HOH H1 H N N 197 HOH H2 H N N 198 ILE N N N N 199 ILE CA C N S 200 ILE C C N N 201 ILE O O N N 202 ILE CB C N S 203 ILE CG1 C N N 204 ILE CG2 C N N 205 ILE CD1 C N N 206 ILE OXT O N N 207 ILE H H N N 208 ILE H2 H N N 209 ILE HA H N N 210 ILE HB H N N 211 ILE HG12 H N N 212 ILE HG13 H N N 213 ILE HG21 H N N 214 ILE HG22 H N N 215 ILE HG23 H N N 216 ILE HD11 H N N 217 ILE HD12 H N N 218 ILE HD13 H N N 219 ILE HXT H N N 220 LEU N N N N 221 LEU CA C N S 222 LEU C C N N 223 LEU O O N N 224 LEU CB C N N 225 LEU CG C N N 226 LEU CD1 C N N 227 LEU CD2 C N N 228 LEU OXT O N N 229 LEU H H N N 230 LEU H2 H N N 231 LEU HA H N N 232 LEU HB2 H N N 233 LEU HB3 H N N 234 LEU HG H N N 235 LEU HD11 H N N 236 LEU HD12 H N N 237 LEU HD13 H N N 238 LEU HD21 H N N 239 LEU HD22 H N N 240 LEU HD23 H N N 241 LEU HXT H N N 242 LYS N N N N 243 LYS CA C N S 244 LYS C C N N 245 LYS O O N N 246 LYS CB C N N 247 LYS CG C N N 248 LYS CD C N N 249 LYS CE C N N 250 LYS NZ N N N 251 LYS OXT O N N 252 LYS H H N N 253 LYS H2 H N N 254 LYS HA H N N 255 LYS HB2 H N N 256 LYS HB3 H N N 257 LYS HG2 H N N 258 LYS HG3 H N N 259 LYS HD2 H N N 260 LYS HD3 H N N 261 LYS HE2 H N N 262 LYS HE3 H N N 263 LYS HZ1 H N N 264 LYS HZ2 H N N 265 LYS HZ3 H N N 266 LYS HXT H N N 267 MET N N N N 268 MET CA C N S 269 MET C C N N 270 MET O O N N 271 MET CB C N N 272 MET CG C N N 273 MET SD S N N 274 MET CE C N N 275 MET OXT O N N 276 MET H H N N 277 MET H2 H N N 278 MET HA H N N 279 MET HB2 H N N 280 MET HB3 H N N 281 MET HG2 H N N 282 MET HG3 H N N 283 MET HE1 H N N 284 MET HE2 H N N 285 MET HE3 H N N 286 MET HXT H N N 287 PHE N N N N 288 PHE CA C N S 289 PHE C C N N 290 PHE O O N N 291 PHE CB C N N 292 PHE CG C Y N 293 PHE CD1 C Y N 294 PHE CD2 C Y N 295 PHE CE1 C Y N 296 PHE CE2 C Y N 297 PHE CZ C Y N 298 PHE OXT O N N 299 PHE H H N N 300 PHE H2 H N N 301 PHE HA H N N 302 PHE HB2 H N N 303 PHE HB3 H N N 304 PHE HD1 H N N 305 PHE HD2 H N N 306 PHE HE1 H N N 307 PHE HE2 H N N 308 PHE HZ H N N 309 PHE HXT H N N 310 PRO N N N N 311 PRO CA C N S 312 PRO C C N N 313 PRO O O N N 314 PRO CB C N N 315 PRO CG C N N 316 PRO CD C N N 317 PRO OXT O N N 318 PRO H H N N 319 PRO HA H N N 320 PRO HB2 H N N 321 PRO HB3 H N N 322 PRO HG2 H N N 323 PRO HG3 H N N 324 PRO HD2 H N N 325 PRO HD3 H N N 326 PRO HXT H N N 327 SER N N N N 328 SER CA C N S 329 SER C C N N 330 SER O O N N 331 SER CB C N N 332 SER OG O N N 333 SER OXT O N N 334 SER H H N N 335 SER H2 H N N 336 SER HA H N N 337 SER HB2 H N N 338 SER HB3 H N N 339 SER HG H N N 340 SER HXT H N N 341 THR N N N N 342 THR CA C N S 343 THR C C N N 344 THR O O N N 345 THR CB C N R 346 THR OG1 O N N 347 THR CG2 C N N 348 THR OXT O N N 349 THR H H N N 350 THR H2 H N N 351 THR HA H N N 352 THR HB H N N 353 THR HG1 H N N 354 THR HG21 H N N 355 THR HG22 H N N 356 THR HG23 H N N 357 THR HXT H N N 358 TRP N N N N 359 TRP CA C N S 360 TRP C C N N 361 TRP O O N N 362 TRP CB C N N 363 TRP CG C Y N 364 TRP CD1 C Y N 365 TRP CD2 C Y N 366 TRP NE1 N Y N 367 TRP CE2 C Y N 368 TRP CE3 C Y N 369 TRP CZ2 C Y N 370 TRP CZ3 C Y N 371 TRP CH2 C Y N 372 TRP OXT O N N 373 TRP H H N N 374 TRP H2 H N N 375 TRP HA H N N 376 TRP HB2 H N N 377 TRP HB3 H N N 378 TRP HD1 H N N 379 TRP HE1 H N N 380 TRP HE3 H N N 381 TRP HZ2 H N N 382 TRP HZ3 H N N 383 TRP HH2 H N N 384 TRP HXT H N N 385 TYR N N N N 386 TYR CA C N S 387 TYR C C N N 388 TYR O O N N 389 TYR CB C N N 390 TYR CG C Y N 391 TYR CD1 C Y N 392 TYR CD2 C Y N 393 TYR CE1 C Y N 394 TYR CE2 C Y N 395 TYR CZ C Y N 396 TYR OH O N N 397 TYR OXT O N N 398 TYR H H N N 399 TYR H2 H N N 400 TYR HA H N N 401 TYR HB2 H N N 402 TYR HB3 H N N 403 TYR HD1 H N N 404 TYR HD2 H N N 405 TYR HE1 H N N 406 TYR HE2 H N N 407 TYR HH H N N 408 TYR HXT H N N 409 VAL N N N N 410 VAL CA C N S 411 VAL C C N N 412 VAL O O N N 413 VAL CB C N N 414 VAL CG1 C N N 415 VAL CG2 C N N 416 VAL OXT O N N 417 VAL H H N N 418 VAL H2 H N N 419 VAL HA H N N 420 VAL HB H N N 421 VAL HG11 H N N 422 VAL HG12 H N N 423 VAL HG13 H N N 424 VAL HG21 H N N 425 VAL HG22 H N N 426 VAL HG23 H N N 427 VAL HXT H N N 428 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 D12 C1 C2 sing N N 83 D12 C1 H11 sing N N 84 D12 C1 H12 sing N N 85 D12 C1 H13 sing N N 86 D12 C2 C3 sing N N 87 D12 C2 H21 sing N N 88 D12 C2 H22 sing N N 89 D12 C3 C4 sing N N 90 D12 C3 H31 sing N N 91 D12 C3 H32 sing N N 92 D12 C4 C5 sing N N 93 D12 C4 H41 sing N N 94 D12 C4 H42 sing N N 95 D12 C5 C6 sing N N 96 D12 C5 H51 sing N N 97 D12 C5 H52 sing N N 98 D12 C6 C7 sing N N 99 D12 C6 H61 sing N N 100 D12 C6 H62 sing N N 101 D12 C7 C8 sing N N 102 D12 C7 H71 sing N N 103 D12 C7 H72 sing N N 104 D12 C8 C9 sing N N 105 D12 C8 H81 sing N N 106 D12 C8 H82 sing N N 107 D12 C9 C10 sing N N 108 D12 C9 H91 sing N N 109 D12 C9 H92 sing N N 110 D12 C10 C11 sing N N 111 D12 C10 H101 sing N N 112 D12 C10 H102 sing N N 113 D12 C11 C12 sing N N 114 D12 C11 H111 sing N N 115 D12 C11 H112 sing N N 116 D12 C12 H121 sing N N 117 D12 C12 H122 sing N N 118 D12 C12 H123 sing N N 119 GLN N CA sing N N 120 GLN N H sing N N 121 GLN N H2 sing N N 122 GLN CA C sing N N 123 GLN CA CB sing N N 124 GLN CA HA sing N N 125 GLN C O doub N N 126 GLN C OXT sing N N 127 GLN CB CG sing N N 128 GLN CB HB2 sing N N 129 GLN CB HB3 sing N N 130 GLN CG CD sing N N 131 GLN CG HG2 sing N N 132 GLN CG HG3 sing N N 133 GLN CD OE1 doub N N 134 GLN CD NE2 sing N N 135 GLN NE2 HE21 sing N N 136 GLN NE2 HE22 sing N N 137 GLN OXT HXT sing N N 138 GLU N CA sing N N 139 GLU N H sing N N 140 GLU N H2 sing N N 141 GLU CA C sing N N 142 GLU CA CB sing N N 143 GLU CA HA sing N N 144 GLU C O doub N N 145 GLU C OXT sing N N 146 GLU CB CG sing N N 147 GLU CB HB2 sing N N 148 GLU CB HB3 sing N N 149 GLU CG CD sing N N 150 GLU CG HG2 sing N N 151 GLU CG HG3 sing N N 152 GLU CD OE1 doub N N 153 GLU CD OE2 sing N N 154 GLU OE2 HE2 sing N N 155 GLU OXT HXT sing N N 156 GLY N CA sing N N 157 GLY N H sing N N 158 GLY N H2 sing N N 159 GLY CA C sing N N 160 GLY CA HA2 sing N N 161 GLY CA HA3 sing N N 162 GLY C O doub N N 163 GLY C OXT sing N N 164 GLY OXT HXT sing N N 165 HIS N CA sing N N 166 HIS N H sing N N 167 HIS N H2 sing N N 168 HIS CA C sing N N 169 HIS CA CB sing N N 170 HIS CA HA sing N N 171 HIS C O doub N N 172 HIS C OXT sing N N 173 HIS CB CG sing N N 174 HIS CB HB2 sing N N 175 HIS CB HB3 sing N N 176 HIS CG ND1 sing Y N 177 HIS CG CD2 doub Y N 178 HIS ND1 CE1 doub Y N 179 HIS ND1 HD1 sing N N 180 HIS CD2 NE2 sing Y N 181 HIS CD2 HD2 sing N N 182 HIS CE1 NE2 sing Y N 183 HIS CE1 HE1 sing N N 184 HIS NE2 HE2 sing N N 185 HIS OXT HXT sing N N 186 HOH O H1 sing N N 187 HOH O H2 sing N N 188 ILE N CA sing N N 189 ILE N H sing N N 190 ILE N H2 sing N N 191 ILE CA C sing N N 192 ILE CA CB sing N N 193 ILE CA HA sing N N 194 ILE C O doub N N 195 ILE C OXT sing N N 196 ILE CB CG1 sing N N 197 ILE CB CG2 sing N N 198 ILE CB HB sing N N 199 ILE CG1 CD1 sing N N 200 ILE CG1 HG12 sing N N 201 ILE CG1 HG13 sing N N 202 ILE CG2 HG21 sing N N 203 ILE CG2 HG22 sing N N 204 ILE CG2 HG23 sing N N 205 ILE CD1 HD11 sing N N 206 ILE CD1 HD12 sing N N 207 ILE CD1 HD13 sing N N 208 ILE OXT HXT sing N N 209 LEU N CA sing N N 210 LEU N H sing N N 211 LEU N H2 sing N N 212 LEU CA C sing N N 213 LEU CA CB sing N N 214 LEU CA HA sing N N 215 LEU C O doub N N 216 LEU C OXT sing N N 217 LEU CB CG sing N N 218 LEU CB HB2 sing N N 219 LEU CB HB3 sing N N 220 LEU CG CD1 sing N N 221 LEU CG CD2 sing N N 222 LEU CG HG sing N N 223 LEU CD1 HD11 sing N N 224 LEU CD1 HD12 sing N N 225 LEU CD1 HD13 sing N N 226 LEU CD2 HD21 sing N N 227 LEU CD2 HD22 sing N N 228 LEU CD2 HD23 sing N N 229 LEU OXT HXT sing N N 230 LYS N CA sing N N 231 LYS N H sing N N 232 LYS N H2 sing N N 233 LYS CA C sing N N 234 LYS CA CB sing N N 235 LYS CA HA sing N N 236 LYS C O doub N N 237 LYS C OXT sing N N 238 LYS CB CG sing N N 239 LYS CB HB2 sing N N 240 LYS CB HB3 sing N N 241 LYS CG CD sing N N 242 LYS CG HG2 sing N N 243 LYS CG HG3 sing N N 244 LYS CD CE sing N N 245 LYS CD HD2 sing N N 246 LYS CD HD3 sing N N 247 LYS CE NZ sing N N 248 LYS CE HE2 sing N N 249 LYS CE HE3 sing N N 250 LYS NZ HZ1 sing N N 251 LYS NZ HZ2 sing N N 252 LYS NZ HZ3 sing N N 253 LYS OXT HXT sing N N 254 MET N CA sing N N 255 MET N H sing N N 256 MET N H2 sing N N 257 MET CA C sing N N 258 MET CA CB sing N N 259 MET CA HA sing N N 260 MET C O doub N N 261 MET C OXT sing N N 262 MET CB CG sing N N 263 MET CB HB2 sing N N 264 MET CB HB3 sing N N 265 MET CG SD sing N N 266 MET CG HG2 sing N N 267 MET CG HG3 sing N N 268 MET SD CE sing N N 269 MET CE HE1 sing N N 270 MET CE HE2 sing N N 271 MET CE HE3 sing N N 272 MET OXT HXT sing N N 273 PHE N CA sing N N 274 PHE N H sing N N 275 PHE N H2 sing N N 276 PHE CA C sing N N 277 PHE CA CB sing N N 278 PHE CA HA sing N N 279 PHE C O doub N N 280 PHE C OXT sing N N 281 PHE CB CG sing N N 282 PHE CB HB2 sing N N 283 PHE CB HB3 sing N N 284 PHE CG CD1 doub Y N 285 PHE CG CD2 sing Y N 286 PHE CD1 CE1 sing Y N 287 PHE CD1 HD1 sing N N 288 PHE CD2 CE2 doub Y N 289 PHE CD2 HD2 sing N N 290 PHE CE1 CZ doub Y N 291 PHE CE1 HE1 sing N N 292 PHE CE2 CZ sing Y N 293 PHE CE2 HE2 sing N N 294 PHE CZ HZ sing N N 295 PHE OXT HXT sing N N 296 PRO N CA sing N N 297 PRO N CD sing N N 298 PRO N H sing N N 299 PRO CA C sing N N 300 PRO CA CB sing N N 301 PRO CA HA sing N N 302 PRO C O doub N N 303 PRO C OXT sing N N 304 PRO CB CG sing N N 305 PRO CB HB2 sing N N 306 PRO CB HB3 sing N N 307 PRO CG CD sing N N 308 PRO CG HG2 sing N N 309 PRO CG HG3 sing N N 310 PRO CD HD2 sing N N 311 PRO CD HD3 sing N N 312 PRO OXT HXT sing N N 313 SER N CA sing N N 314 SER N H sing N N 315 SER N H2 sing N N 316 SER CA C sing N N 317 SER CA CB sing N N 318 SER CA HA sing N N 319 SER C O doub N N 320 SER C OXT sing N N 321 SER CB OG sing N N 322 SER CB HB2 sing N N 323 SER CB HB3 sing N N 324 SER OG HG sing N N 325 SER OXT HXT sing N N 326 THR N CA sing N N 327 THR N H sing N N 328 THR N H2 sing N N 329 THR CA C sing N N 330 THR CA CB sing N N 331 THR CA HA sing N N 332 THR C O doub N N 333 THR C OXT sing N N 334 THR CB OG1 sing N N 335 THR CB CG2 sing N N 336 THR CB HB sing N N 337 THR OG1 HG1 sing N N 338 THR CG2 HG21 sing N N 339 THR CG2 HG22 sing N N 340 THR CG2 HG23 sing N N 341 THR OXT HXT sing N N 342 TRP N CA sing N N 343 TRP N H sing N N 344 TRP N H2 sing N N 345 TRP CA C sing N N 346 TRP CA CB sing N N 347 TRP CA HA sing N N 348 TRP C O doub N N 349 TRP C OXT sing N N 350 TRP CB CG sing N N 351 TRP CB HB2 sing N N 352 TRP CB HB3 sing N N 353 TRP CG CD1 doub Y N 354 TRP CG CD2 sing Y N 355 TRP CD1 NE1 sing Y N 356 TRP CD1 HD1 sing N N 357 TRP CD2 CE2 doub Y N 358 TRP CD2 CE3 sing Y N 359 TRP NE1 CE2 sing Y N 360 TRP NE1 HE1 sing N N 361 TRP CE2 CZ2 sing Y N 362 TRP CE3 CZ3 doub Y N 363 TRP CE3 HE3 sing N N 364 TRP CZ2 CH2 doub Y N 365 TRP CZ2 HZ2 sing N N 366 TRP CZ3 CH2 sing Y N 367 TRP CZ3 HZ3 sing N N 368 TRP CH2 HH2 sing N N 369 TRP OXT HXT sing N N 370 TYR N CA sing N N 371 TYR N H sing N N 372 TYR N H2 sing N N 373 TYR CA C sing N N 374 TYR CA CB sing N N 375 TYR CA HA sing N N 376 TYR C O doub N N 377 TYR C OXT sing N N 378 TYR CB CG sing N N 379 TYR CB HB2 sing N N 380 TYR CB HB3 sing N N 381 TYR CG CD1 doub Y N 382 TYR CG CD2 sing Y N 383 TYR CD1 CE1 sing Y N 384 TYR CD1 HD1 sing N N 385 TYR CD2 CE2 doub Y N 386 TYR CD2 HD2 sing N N 387 TYR CE1 CZ doub Y N 388 TYR CE1 HE1 sing N N 389 TYR CE2 CZ sing Y N 390 TYR CE2 HE2 sing N N 391 TYR CZ OH sing N N 392 TYR OH HH sing N N 393 TYR OXT HXT sing N N 394 VAL N CA sing N N 395 VAL N H sing N N 396 VAL N H2 sing N N 397 VAL CA C sing N N 398 VAL CA CB sing N N 399 VAL CA HA sing N N 400 VAL C O doub N N 401 VAL C OXT sing N N 402 VAL CB CG1 sing N N 403 VAL CB CG2 sing N N 404 VAL CB HB sing N N 405 VAL CG1 HG11 sing N N 406 VAL CG1 HG12 sing N N 407 VAL CG1 HG13 sing N N 408 VAL CG2 HG21 sing N N 409 VAL CG2 HG22 sing N N 410 VAL CG2 HG23 sing N N 411 VAL OXT HXT sing N N 412 # _pdbx_audit_support.funding_organization 'European Regional Development Fund' _pdbx_audit_support.country Poland _pdbx_audit_support.grant_number POIG.02.01.00-12-023/08 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3LBG _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5IO6 _atom_sites.fract_transf_matrix[1][1] 0.018799 _atom_sites.fract_transf_matrix[1][2] 0.010854 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021708 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008927 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_