data_5IWD # _entry.id 5IWD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5IWD WWPDB D_1000211931 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB ;1YYP is the crystal structure of UL44 in complex with the C terminal peptide from the HCMV Pol catalytic subunit, determined at low pH and high salt. ; 1YYP unspecified PDB '1T6L is the crystal structure of UL44 at low pH and high salt.' 1T6L unspecified PDB . 5IXA unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5IWD _pdbx_database_status.recvd_initial_deposition_date 2016-03-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chen, H.' 1 'Coen, D.M.' 2 'Hogle, J.M.' 3 'Filman, D.J.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'ACS Infect Dis' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2373-8227 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 3 _citation.language ? _citation.page_first 112 _citation.page_last 118 _citation.title 'A Small Covalent Allosteric Inhibitor of Human Cytomegalovirus DNA Polymerase Subunit Interactions.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsinfecdis.6b00079 _citation.pdbx_database_id_PubMed 28183184 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, H.' 1 ? primary 'Coseno, M.' 2 ? primary 'Ficarro, S.B.' 3 ? primary 'Mansueto, M.S.' 4 ? primary 'Komazin-Meredith, G.' 5 ? primary 'Boissel, S.' 6 ? primary 'Filman, D.J.' 7 ? primary 'Marto, J.A.' 8 ? primary 'Hogle, J.M.' 9 ? primary 'Coen, D.M.' 10 ? # _cell.entry_id 5IWD _cell.length_a 91.801 _cell.length_b 127.041 _cell.length_c 66.003 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5IWD _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA polymerase processivity factor' 32590.490 1 ? ? ? ? 2 non-polymer syn '5-methylidene-3-(methylsulfanyl)-2-benzothiophen-4(5H)-one' 208.300 3 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Polymerase accessory protein,PAP,Protein ICP36' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDRKDRLSEPPTLALRLKPYKTAIQQLRSVIRALKENTTVTFLPTPSLILQTVRSHCVSKITFNSSCLYITDKSFQPKTI NNSTPLLGNFMYLTSSKDLTKFYVQDISDLSAKISMCAPDFNMEFSSACVHGQDIVRESENSAVHVDLDFGVVADLLKWI GPHTRVKRNVKKAPCPTGTVQILVHAGPPAIKFILTNGSELEFTSNNRVSFHGVKNMRINVQLKNFYQTLLNCAVTKLPC TLRIVTEHDTLLYVASRNGLFAVENFLTEEPFQRGDPFDKNYVGNSGKSR ; _entity_poly.pdbx_seq_one_letter_code_can ;MDRKDRLSEPPTLALRLKPYKTAIQQLRSVIRALKENTTVTFLPTPSLILQTVRSHCVSKITFNSSCLYITDKSFQPKTI NNSTPLLGNFMYLTSSKDLTKFYVQDISDLSAKISMCAPDFNMEFSSACVHGQDIVRESENSAVHVDLDFGVVADLLKWI GPHTRVKRNVKKAPCPTGTVQILVHAGPPAIKFILTNGSELEFTSNNRVSFHGVKNMRINVQLKNFYQTLLNCAVTKLPC TLRIVTEHDTLLYVASRNGLFAVENFLTEEPFQRGDPFDKNYVGNSGKSR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ARG n 1 4 LYS n 1 5 ASP n 1 6 ARG n 1 7 LEU n 1 8 SER n 1 9 GLU n 1 10 PRO n 1 11 PRO n 1 12 THR n 1 13 LEU n 1 14 ALA n 1 15 LEU n 1 16 ARG n 1 17 LEU n 1 18 LYS n 1 19 PRO n 1 20 TYR n 1 21 LYS n 1 22 THR n 1 23 ALA n 1 24 ILE n 1 25 GLN n 1 26 GLN n 1 27 LEU n 1 28 ARG n 1 29 SER n 1 30 VAL n 1 31 ILE n 1 32 ARG n 1 33 ALA n 1 34 LEU n 1 35 LYS n 1 36 GLU n 1 37 ASN n 1 38 THR n 1 39 THR n 1 40 VAL n 1 41 THR n 1 42 PHE n 1 43 LEU n 1 44 PRO n 1 45 THR n 1 46 PRO n 1 47 SER n 1 48 LEU n 1 49 ILE n 1 50 LEU n 1 51 GLN n 1 52 THR n 1 53 VAL n 1 54 ARG n 1 55 SER n 1 56 HIS n 1 57 CYS n 1 58 VAL n 1 59 SER n 1 60 LYS n 1 61 ILE n 1 62 THR n 1 63 PHE n 1 64 ASN n 1 65 SER n 1 66 SER n 1 67 CYS n 1 68 LEU n 1 69 TYR n 1 70 ILE n 1 71 THR n 1 72 ASP n 1 73 LYS n 1 74 SER n 1 75 PHE n 1 76 GLN n 1 77 PRO n 1 78 LYS n 1 79 THR n 1 80 ILE n 1 81 ASN n 1 82 ASN n 1 83 SER n 1 84 THR n 1 85 PRO n 1 86 LEU n 1 87 LEU n 1 88 GLY n 1 89 ASN n 1 90 PHE n 1 91 MET n 1 92 TYR n 1 93 LEU n 1 94 THR n 1 95 SER n 1 96 SER n 1 97 LYS n 1 98 ASP n 1 99 LEU n 1 100 THR n 1 101 LYS n 1 102 PHE n 1 103 TYR n 1 104 VAL n 1 105 GLN n 1 106 ASP n 1 107 ILE n 1 108 SER n 1 109 ASP n 1 110 LEU n 1 111 SER n 1 112 ALA n 1 113 LYS n 1 114 ILE n 1 115 SER n 1 116 MET n 1 117 CYS n 1 118 ALA n 1 119 PRO n 1 120 ASP n 1 121 PHE n 1 122 ASN n 1 123 MET n 1 124 GLU n 1 125 PHE n 1 126 SER n 1 127 SER n 1 128 ALA n 1 129 CYS n 1 130 VAL n 1 131 HIS n 1 132 GLY n 1 133 GLN n 1 134 ASP n 1 135 ILE n 1 136 VAL n 1 137 ARG n 1 138 GLU n 1 139 SER n 1 140 GLU n 1 141 ASN n 1 142 SER n 1 143 ALA n 1 144 VAL n 1 145 HIS n 1 146 VAL n 1 147 ASP n 1 148 LEU n 1 149 ASP n 1 150 PHE n 1 151 GLY n 1 152 VAL n 1 153 VAL n 1 154 ALA n 1 155 ASP n 1 156 LEU n 1 157 LEU n 1 158 LYS n 1 159 TRP n 1 160 ILE n 1 161 GLY n 1 162 PRO n 1 163 HIS n 1 164 THR n 1 165 ARG n 1 166 VAL n 1 167 LYS n 1 168 ARG n 1 169 ASN n 1 170 VAL n 1 171 LYS n 1 172 LYS n 1 173 ALA n 1 174 PRO n 1 175 CYS n 1 176 PRO n 1 177 THR n 1 178 GLY n 1 179 THR n 1 180 VAL n 1 181 GLN n 1 182 ILE n 1 183 LEU n 1 184 VAL n 1 185 HIS n 1 186 ALA n 1 187 GLY n 1 188 PRO n 1 189 PRO n 1 190 ALA n 1 191 ILE n 1 192 LYS n 1 193 PHE n 1 194 ILE n 1 195 LEU n 1 196 THR n 1 197 ASN n 1 198 GLY n 1 199 SER n 1 200 GLU n 1 201 LEU n 1 202 GLU n 1 203 PHE n 1 204 THR n 1 205 SER n 1 206 ASN n 1 207 ASN n 1 208 ARG n 1 209 VAL n 1 210 SER n 1 211 PHE n 1 212 HIS n 1 213 GLY n 1 214 VAL n 1 215 LYS n 1 216 ASN n 1 217 MET n 1 218 ARG n 1 219 ILE n 1 220 ASN n 1 221 VAL n 1 222 GLN n 1 223 LEU n 1 224 LYS n 1 225 ASN n 1 226 PHE n 1 227 TYR n 1 228 GLN n 1 229 THR n 1 230 LEU n 1 231 LEU n 1 232 ASN n 1 233 CYS n 1 234 ALA n 1 235 VAL n 1 236 THR n 1 237 LYS n 1 238 LEU n 1 239 PRO n 1 240 CYS n 1 241 THR n 1 242 LEU n 1 243 ARG n 1 244 ILE n 1 245 VAL n 1 246 THR n 1 247 GLU n 1 248 HIS n 1 249 ASP n 1 250 THR n 1 251 LEU n 1 252 LEU n 1 253 TYR n 1 254 VAL n 1 255 ALA n 1 256 SER n 1 257 ARG n 1 258 ASN n 1 259 GLY n 1 260 LEU n 1 261 PHE n 1 262 ALA n 1 263 VAL n 1 264 GLU n 1 265 ASN n 1 266 PHE n 1 267 LEU n 1 268 THR n 1 269 GLU n 1 270 GLU n 1 271 PRO n 1 272 PHE n 1 273 GLN n 1 274 ARG n 1 275 GLY n 1 276 ASP n 1 277 PRO n 1 278 PHE n 1 279 ASP n 1 280 LYS n 1 281 ASN n 1 282 TYR n 1 283 VAL n 1 284 GLY n 1 285 ASN n 1 286 SER n 1 287 GLY n 1 288 LYS n 1 289 SER n 1 290 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 290 _entity_src_gen.gene_src_common_name HHV-5 _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene UL44 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain AD169 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human cytomegalovirus (strain AD169)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10360 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VPAP_HCMVA _struct_ref.pdbx_db_accession P16790 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDRKTRLSEPPTLALRLKPYKTAIQQLRSVIRALKENTTVTFLPTPSLILQTVRSHCVSKITFNSSCLYITDKSFQPKTI NNSTPLLGNFMYLTSSKDLTKFYVQDISDLSAKISMCAPDFNMEFSSACVHGQDIVRESENSAVHVDLDFGVVADLLKWI GPHTRVKRNVKKAPCPTGTVQILVHAGPPAIKFILTNGSELEFTANNRVSFHGVKNMRINVQLKNFYQTLLNCAVTKLPC TLRIVTEHDTLLYVASRNGLFAVENFLTEEPFQRGDPFDKNYVGNSGKSR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5IWD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 290 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16790 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 290 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 290 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5IWD ASP A 5 ? UNP P16790 THR 5 conflict 5 1 1 5IWD SER A 205 ? UNP P16790 ALA 205 'see remark 999' 205 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6EV non-polymer . '5-methylidene-3-(methylsulfanyl)-2-benzothiophen-4(5H)-one' ? 'C10 H8 O S2' 208.300 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IWD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1 uL of 10 mg/mL UL44 in the storage buffer (20 mM Tris (pH 7.5), 500 mM NaCl, 0.1 mM EDTA, 2 mM DTT and 5% glycerol) and 1 uL crystallization buffer (75 mM ammonium sulfate, 50 mM HEPES (pH 7.5) and 10% PEG4K) were mixed in hanging drops. Crystals were obtained by vapor diffusion over a 1.8 M NaCl solution, after one day ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-07-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5IWD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.55 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12483 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.038 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.55 _reflns_shell.d_res_low 2.64 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.478 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5IWD _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 12465 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.122 _refine.ls_d_res_high 2.560 _refine.ls_percent_reflns_obs 97.55 _refine.ls_R_factor_obs 0.2150 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2125 _refine.ls_R_factor_R_free 0.2670 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.81 _refine.ls_number_reflns_R_free 600 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model BD1YYP _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.33 _refine.pdbx_overall_phase_error 31.32 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2055 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 2095 _refine_hist.d_res_high 2.560 _refine_hist.d_res_low 27.122 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.008 ? ? 2150 'X-RAY DIFFRACTION' ? f_angle_d 1.102 ? ? 2925 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 18.297 ? ? 1343 'X-RAY DIFFRACTION' ? f_chiral_restr 0.063 ? ? 340 'X-RAY DIFFRACTION' ? f_plane_restr 0.006 ? ? 369 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.5603 2.8177 2882 0.2764 98.00 0.3271 . . 168 . . 'X-RAY DIFFRACTION' . 2.8177 3.2248 2989 0.2551 100.00 0.3088 . . 158 . . 'X-RAY DIFFRACTION' . 3.2248 4.0607 3028 0.2294 99.00 0.2812 . . 126 . . 'X-RAY DIFFRACTION' . 4.0607 27.1233 2966 0.1892 94.00 0.2443 . . 148 . . # _struct.entry_id 5IWD _struct.title 'HCMV DNA polymerase subunit UL44 complex with a small molecule' _struct.pdbx_descriptor 'DNA polymerase processivity factor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IWD _struct_keywords.text ;covalent inhibitor, HCMV Pol accessory subunit, protein-protein interaction, human cytomegalovirus, DNA polymerase, processivity factor, REPLICATION-REPLICATION INHIBITOR complex ; _struct_keywords.pdbx_keywords 'REPLICATION/REPLICATION INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 16 ? LEU A 27 ? ARG A 16 LEU A 27 1 ? 12 HELX_P HELX_P2 AA2 LEU A 27 ? ALA A 33 ? LEU A 27 ALA A 33 1 ? 7 HELX_P HELX_P3 AA3 PHE A 90 ? THR A 94 ? PHE A 90 THR A 94 1 ? 5 HELX_P HELX_P4 AA4 ASP A 149 ? ILE A 160 ? ASP A 149 ILE A 160 1 ? 12 HELX_P HELX_P5 AA5 LEU A 223 ? VAL A 235 ? LEU A 223 VAL A 235 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale none ? A LYS 4 NZ ? ? ? 1_555 B 6EV . C10 ? ? A LYS 4 A 6EV 301 1_555 ? ? ? ? ? ? ? 1.426 ? covale2 covale none ? A LYS 60 NZ ? ? ? 1_555 C 6EV . C10 ? ? A LYS 60 A 6EV 302 1_555 ? ? ? ? ? ? ? 1.428 ? covale3 covale none ? A LYS 192 NZ ? ? ? 1_555 D 6EV . C10 ? ? A LYS 192 A 6EV 303 1_555 ? ? ? ? ? ? ? 1.426 ? covale4 covale none ? B 6EV . C05 ? ? ? 1_555 D 6EV . O22 ? ? A 6EV 301 A 6EV 303 5_555 ? ? ? ? ? ? ? 1.374 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 THR 45 A . ? THR 45 A PRO 46 A ? PRO 46 A 1 5.47 2 HIS 131 A . ? HIS 131 A GLY 132 A ? GLY 132 A 1 1.98 3 GLY 132 A . ? GLY 132 A GLN 133 A ? GLN 133 A 1 3.60 4 GLY 161 A . ? GLY 161 A PRO 162 A ? PRO 162 A 1 -4.78 5 GLY 187 A . ? GLY 187 A PRO 188 A ? PRO 188 A 1 0.49 6 ARG 274 A . ? ARG 274 A GLY 275 A ? GLY 275 A 1 1.98 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 9 ? AA3 ? 2 ? AA4 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 68 ? ILE A 70 ? LEU A 68 ILE A 70 AA1 2 THR A 12 ? LEU A 15 ? THR A 12 LEU A 15 AA1 3 LYS A 101 ? GLN A 105 ? LYS A 101 GLN A 105 AA1 4 SER A 111 ? ALA A 118 ? SER A 111 ALA A 118 AA1 5 PHE A 121 ? ALA A 128 ? PHE A 121 ALA A 128 AA2 1 LYS A 78 ? ASN A 81 ? LYS A 78 ASN A 81 AA2 2 THR A 39 ? LEU A 43 ? THR A 39 LEU A 43 AA2 3 SER A 47 ? VAL A 53 ? SER A 47 VAL A 53 AA2 4 CYS A 57 ? PHE A 63 ? CYS A 57 PHE A 63 AA2 5 PHE A 261 ? THR A 268 ? PHE A 261 THR A 268 AA2 6 LEU A 251 ? ARG A 257 ? LEU A 251 ARG A 257 AA2 7 CYS A 240 ? VAL A 245 ? CYS A 240 VAL A 245 AA2 8 VAL A 144 ? LEU A 148 ? VAL A 144 LEU A 148 AA2 9 VAL A 209 ? GLY A 213 ? VAL A 209 GLY A 213 AA3 1 SER A 83 ? THR A 84 ? SER A 83 THR A 84 AA3 2 GLY A 88 ? ASN A 89 ? GLY A 88 ASN A 89 AA4 1 GLU A 200 ? THR A 204 ? GLU A 200 THR A 204 AA4 2 ALA A 190 ? LEU A 195 ? ALA A 190 LEU A 195 AA4 3 THR A 179 ? HIS A 185 ? THR A 179 HIS A 185 AA4 4 MET A 217 ? GLN A 222 ? MET A 217 GLN A 222 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 69 ? O TYR A 69 N ALA A 14 ? N ALA A 14 AA1 2 3 N LEU A 13 ? N LEU A 13 O VAL A 104 ? O VAL A 104 AA1 3 4 N TYR A 103 ? N TYR A 103 O SER A 115 ? O SER A 115 AA1 4 5 N ILE A 114 ? N ILE A 114 O PHE A 125 ? O PHE A 125 AA2 1 2 O LYS A 78 ? O LYS A 78 N PHE A 42 ? N PHE A 42 AA2 2 3 N THR A 41 ? N THR A 41 O ILE A 49 ? O ILE A 49 AA2 3 4 N LEU A 48 ? N LEU A 48 O PHE A 63 ? O PHE A 63 AA2 4 5 N LYS A 60 ? N LYS A 60 O GLU A 264 ? O GLU A 264 AA2 5 6 O LEU A 267 ? O LEU A 267 N LEU A 252 ? N LEU A 252 AA2 6 7 O ALA A 255 ? O ALA A 255 N THR A 241 ? N THR A 241 AA2 7 8 O CYS A 240 ? O CYS A 240 N LEU A 148 ? N LEU A 148 AA2 8 9 N HIS A 145 ? N HIS A 145 O GLY A 213 ? O GLY A 213 AA3 1 2 N THR A 84 ? N THR A 84 O GLY A 88 ? O GLY A 88 AA4 1 2 O LEU A 201 ? O LEU A 201 N PHE A 193 ? N PHE A 193 AA4 2 3 O LYS A 192 ? O LYS A 192 N LEU A 183 ? N LEU A 183 AA4 3 4 N VAL A 184 ? N VAL A 184 O MET A 217 ? O MET A 217 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 6EV 302 ? 8 'binding site for residue 6EV A 302' AC2 Software A 6EV 301 ? 8 'binding site for residues 6EV A 301 and 6EV A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 THR A 41 ? THR A 41 . ? 1_555 ? 2 AC1 8 ILE A 49 ? ILE A 49 . ? 1_555 ? 3 AC1 8 GLN A 51 ? GLN A 51 . ? 1_555 ? 4 AC1 8 LYS A 60 ? LYS A 60 . ? 1_555 ? 5 AC1 8 THR A 79 ? THR A 79 . ? 1_555 ? 6 AC1 8 ASP A 134 ? ASP A 134 . ? 1_555 ? 7 AC1 8 ILE A 135 ? ILE A 135 . ? 1_555 ? 8 AC1 8 VAL A 136 ? VAL A 136 . ? 1_555 ? 9 AC2 8 LYS A 4 ? LYS A 4 . ? 1_555 ? 10 AC2 8 GLN A 181 ? GLN A 181 . ? 5_555 ? 11 AC2 8 HIS A 185 ? HIS A 185 . ? 4_555 ? 12 AC2 8 LYS A 192 ? LYS A 192 . ? 1_555 ? 13 AC2 8 GLU A 200 ? GLU A 200 . ? 5_555 ? 14 AC2 8 GLU A 202 ? GLU A 202 . ? 4_555 ? 15 AC2 8 THR A 204 ? THR A 204 . ? 4_555 ? 16 AC2 8 ARG A 274 ? ARG A 274 . ? 7_554 ? # _atom_sites.entry_id 5IWD _atom_sites.fract_transf_matrix[1][1] 0.010893 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007871 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015151 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 MET 116 116 116 MET MET A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 CYS 129 129 129 CYS CYS A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 TRP 159 159 159 TRP TRP A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 HIS 163 163 ? ? ? A . n A 1 164 THR 164 164 ? ? ? A . n A 1 165 ARG 165 165 ? ? ? A . n A 1 166 VAL 166 166 ? ? ? A . n A 1 167 LYS 167 167 ? ? ? A . n A 1 168 ARG 168 168 ? ? ? A . n A 1 169 ASN 169 169 ? ? ? A . n A 1 170 VAL 170 170 ? ? ? A . n A 1 171 LYS 171 171 ? ? ? A . n A 1 172 LYS 172 172 ? ? ? A . n A 1 173 ALA 173 173 ? ? ? A . n A 1 174 PRO 174 174 ? ? ? A . n A 1 175 CYS 175 175 ? ? ? A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 HIS 185 185 185 HIS HIS A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 LYS 192 192 192 LYS LYS A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 ASN 197 197 197 ASN ASN A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 ASN 206 206 206 ASN ASN A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 ARG 208 208 208 ARG ARG A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 HIS 212 212 212 HIS HIS A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 LYS 215 215 215 LYS LYS A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 MET 217 217 217 MET MET A . n A 1 218 ARG 218 218 218 ARG ARG A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 ASN 220 220 220 ASN ASN A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 GLN 222 222 222 GLN GLN A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 ASN 225 225 225 ASN ASN A . n A 1 226 PHE 226 226 226 PHE PHE A . n A 1 227 TYR 227 227 227 TYR TYR A . n A 1 228 GLN 228 228 228 GLN GLN A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 ASN 232 232 232 ASN ASN A . n A 1 233 CYS 233 233 233 CYS CYS A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 PRO 239 239 239 PRO PRO A . n A 1 240 CYS 240 240 240 CYS CYS A . n A 1 241 THR 241 241 241 THR THR A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 VAL 245 245 245 VAL VAL A . n A 1 246 THR 246 246 246 THR THR A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 HIS 248 248 248 HIS HIS A . n A 1 249 ASP 249 249 249 ASP ASP A . n A 1 250 THR 250 250 250 THR THR A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 TYR 253 253 253 TYR TYR A . n A 1 254 VAL 254 254 254 VAL VAL A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 SER 256 256 256 SER SER A . n A 1 257 ARG 257 257 257 ARG ARG A . n A 1 258 ASN 258 258 258 ASN ASN A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 PHE 261 261 261 PHE PHE A . n A 1 262 ALA 262 262 262 ALA ALA A . n A 1 263 VAL 263 263 263 VAL VAL A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 ASN 265 265 265 ASN ASN A . n A 1 266 PHE 266 266 266 PHE PHE A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 THR 268 268 268 THR THR A . n A 1 269 GLU 269 269 269 GLU GLU A . n A 1 270 GLU 270 270 270 GLU GLU A . n A 1 271 PRO 271 271 271 PRO PRO A . n A 1 272 PHE 272 272 272 PHE PHE A . n A 1 273 GLN 273 273 273 GLN GLN A . n A 1 274 ARG 274 274 274 ARG ARG A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 ASP 276 276 276 ASP ASP A . n A 1 277 PRO 277 277 ? ? ? A . n A 1 278 PHE 278 278 ? ? ? A . n A 1 279 ASP 279 279 ? ? ? A . n A 1 280 LYS 280 280 ? ? ? A . n A 1 281 ASN 281 281 ? ? ? A . n A 1 282 TYR 282 282 ? ? ? A . n A 1 283 VAL 283 283 ? ? ? A . n A 1 284 GLY 284 284 ? ? ? A . n A 1 285 ASN 285 285 ? ? ? A . n A 1 286 SER 286 286 ? ? ? A . n A 1 287 GLY 287 287 ? ? ? A . n A 1 288 LYS 288 288 ? ? ? A . n A 1 289 SER 289 289 ? ? ? A . n A 1 290 ARG 290 290 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 6EV 1 301 4 6EV KSG A . C 2 6EV 1 302 60 6EV KSG A . D 2 6EV 1 303 192 6EV KSG A . E 3 HOH 1 401 1 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1620 ? 1 MORE -14 ? 1 'SSA (A^2)' 27210 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_654 -x+1,y,-z-1/2 -1.0000000000 0.0000000000 0.0000000000 91.8010000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -33.0015000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-11-30 2 'Structure model' 1 1 2017-03-01 3 'Structure model' 1 2 2017-09-20 4 'Structure model' 1 3 2019-12-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_audit_support 2 4 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_audit_support.funding_organization' 2 4 'Structure model' '_pdbx_audit_support.funding_organization' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 34.0614 36.5981 -7.3769 0.5002 0.4107 0.3876 -0.0307 -0.0419 -0.1631 2.5180 0.6978 1.6571 2.1743 -0.7560 -0.8895 0.1923 -0.1389 0.1701 0.3822 -0.0805 0.2235 0.3936 -0.1580 0.0106 'X-RAY DIFFRACTION' 2 ? refined 35.0868 35.9833 -11.0024 0.7033 0.6425 0.6483 -0.0402 0.0035 -0.0411 2.3390 1.3592 2.4858 0.3495 0.2921 -0.7568 -0.0422 0.3272 0.1549 0.1216 -0.0576 -0.0197 0.0749 0.0830 -0.0002 'X-RAY DIFFRACTION' 3 ? refined 16.0175 16.7340 -6.2358 0.7607 0.8040 0.8167 0.0359 0.1092 0.0118 1.9901 1.3056 0.0808 2.4461 0.1432 -1.8534 0.1023 0.1895 0.0960 0.3962 0.3130 0.7453 -0.3752 0.0380 -0.0082 'X-RAY DIFFRACTION' 4 ? refined 13.8822 13.2740 -3.1737 0.5509 0.6787 0.8549 0.0266 0.1078 0.0431 2.1658 3.1952 1.5313 0.2708 -0.5767 -2.5526 0.0316 0.0839 -0.2023 0.2351 0.4124 0.8774 -0.4488 0.0283 0.0148 'X-RAY DIFFRACTION' 5 ? refined 12.8964 16.8965 -14.4486 0.5917 1.0698 1.0895 -0.1219 -0.1775 0.2682 -0.2976 -0.6418 1.4178 0.3728 0.5215 0.2855 0.2628 0.5172 -0.8859 0.5333 1.5211 0.5919 -1.2748 -0.3150 0.6186 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 3 through 53 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 54 through 128 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 129 through 185 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 186 through 260 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 261 through 276 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.compound_details ? _pdbx_entry_details.entry_id 5IWD _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'authors have indicated that the correct residue in this position is a Ser' _pdbx_entry_details.source_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 5 ? ? -79.22 -131.65 2 1 SER A 55 ? ? -30.73 -78.68 3 1 PRO A 119 ? ? -16.74 -73.97 4 1 GLU A 138 ? ? -90.84 31.07 5 1 ASN A 207 ? ? -57.14 -6.45 6 1 PRO A 239 ? ? -56.69 171.23 7 1 GLU A 247 ? ? -49.64 -85.09 8 1 HIS A 248 ? ? -126.17 -75.67 9 1 PRO A 271 ? ? -48.41 107.20 10 1 GLN A 273 ? ? -144.07 46.97 11 1 ARG A 274 ? ? 56.55 93.80 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A HIS 163 ? A HIS 163 4 1 Y 1 A THR 164 ? A THR 164 5 1 Y 1 A ARG 165 ? A ARG 165 6 1 Y 1 A VAL 166 ? A VAL 166 7 1 Y 1 A LYS 167 ? A LYS 167 8 1 Y 1 A ARG 168 ? A ARG 168 9 1 Y 1 A ASN 169 ? A ASN 169 10 1 Y 1 A VAL 170 ? A VAL 170 11 1 Y 1 A LYS 171 ? A LYS 171 12 1 Y 1 A LYS 172 ? A LYS 172 13 1 Y 1 A ALA 173 ? A ALA 173 14 1 Y 1 A PRO 174 ? A PRO 174 15 1 Y 1 A CYS 175 ? A CYS 175 16 1 Y 1 A PRO 277 ? A PRO 277 17 1 Y 1 A PHE 278 ? A PHE 278 18 1 Y 1 A ASP 279 ? A ASP 279 19 1 Y 1 A LYS 280 ? A LYS 280 20 1 Y 1 A ASN 281 ? A ASN 281 21 1 Y 1 A TYR 282 ? A TYR 282 22 1 Y 1 A VAL 283 ? A VAL 283 23 1 Y 1 A GLY 284 ? A GLY 284 24 1 Y 1 A ASN 285 ? A ASN 285 25 1 Y 1 A SER 286 ? A SER 286 26 1 Y 1 A GLY 287 ? A GLY 287 27 1 Y 1 A LYS 288 ? A LYS 288 28 1 Y 1 A SER 289 ? A SER 289 29 1 Y 1 A ARG 290 ? A ARG 290 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R01 AI019838' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-methylidene-3-(methylsulfanyl)-2-benzothiophen-4(5H)-one' 6EV 3 water HOH #