data_5JOJ # _entry.id 5JOJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5JOJ pdb_00005joj 10.2210/pdb5joj/pdb WWPDB D_1000220856 ? ? BMRB 30071 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB . 30071 unspecified PDB . 5JOL unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5JOJ _pdbx_database_status.recvd_initial_deposition_date 2016-05-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ishida, H.' 1 'Jensen, K.V.' 2 'Woodman, G.W.' 3 'Hyndman, M.E.' 4 'Vogel, H.J.' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 40662 _citation.page_last 40662 _citation.title 'The Calcium-Dependent Switch Helix of L-Plastin Regulates Actin Bundling.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/srep40662 _citation.pdbx_database_id_PubMed 28145401 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ishida, H.' 1 ? primary 'Jensen, K.V.' 2 ? primary 'Woodman, A.G.' 3 ? primary 'Hyndman, M.E.' 4 ? primary 'Vogel, H.J.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Plastin-2 10968.452 1 ? ? 'EF-hand domain (UNP residue 1-97)' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'L-plastin,LC64P,Lymphocyte cytosolic protein 1,LCP-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHG LKSTDVAKTFRKAINKK ; _entity_poly.pdbx_seq_one_letter_code_can ;MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHG LKSTDVAKTFRKAINKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ARG n 1 4 GLY n 1 5 SER n 1 6 VAL n 1 7 SER n 1 8 ASP n 1 9 GLU n 1 10 GLU n 1 11 MET n 1 12 MET n 1 13 GLU n 1 14 LEU n 1 15 ARG n 1 16 GLU n 1 17 ALA n 1 18 PHE n 1 19 ALA n 1 20 LYS n 1 21 VAL n 1 22 ASP n 1 23 THR n 1 24 ASP n 1 25 GLY n 1 26 ASN n 1 27 GLY n 1 28 TYR n 1 29 ILE n 1 30 SER n 1 31 PHE n 1 32 ASN n 1 33 GLU n 1 34 LEU n 1 35 ASN n 1 36 ASP n 1 37 LEU n 1 38 PHE n 1 39 LYS n 1 40 ALA n 1 41 ALA n 1 42 CYS n 1 43 LEU n 1 44 PRO n 1 45 LEU n 1 46 PRO n 1 47 GLY n 1 48 TYR n 1 49 ARG n 1 50 VAL n 1 51 ARG n 1 52 GLU n 1 53 ILE n 1 54 THR n 1 55 GLU n 1 56 ASN n 1 57 LEU n 1 58 MET n 1 59 ALA n 1 60 THR n 1 61 GLY n 1 62 ASP n 1 63 LEU n 1 64 ASP n 1 65 GLN n 1 66 ASP n 1 67 GLY n 1 68 ARG n 1 69 ILE n 1 70 SER n 1 71 PHE n 1 72 ASP n 1 73 GLU n 1 74 PHE n 1 75 ILE n 1 76 LYS n 1 77 ILE n 1 78 PHE n 1 79 HIS n 1 80 GLY n 1 81 LEU n 1 82 LYS n 1 83 SER n 1 84 THR n 1 85 ASP n 1 86 VAL n 1 87 ALA n 1 88 LYS n 1 89 THR n 1 90 PHE n 1 91 ARG n 1 92 LYS n 1 93 ALA n 1 94 ILE n 1 95 ASN n 1 96 LYS n 1 97 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 97 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'LCP1, PLS2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PLSL_HUMAN _struct_ref.pdbx_db_accession P13796 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHG LKSTDVAKTFRKAINKK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5JOJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 97 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P13796 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 97 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 97 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '3D HNCACB' 2 isotropic 2 1 2 '3D CBCA(CO)NH' 2 isotropic 3 1 2 '3D HN(CA)CO' 2 isotropic 4 1 2 '3D HNCO' 2 isotropic 5 1 2 '3D HNCA' 2 isotropic 7 1 2 '3D HN(CO)CA' 2 isotropic 6 1 1 '3D 1H-15N NOESY' 1 isotropic 8 1 3 '3D 1H-13C NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 25 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units C # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1.0 mM [U-98% 15N] EF-hand domain of L-plastin, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '0.5 mM [U-99% 13C; U-98% 15N] EF-hand domain of L-plastin, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C,15N_sample solution ? 3 '0.5 mM [U-99% 13C; U-98% 15N] EF-hand domain of L-plastin, 100% D2O' '100% D2O' 13C,15N-sample solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 700 ? 2 AVANCE ? Bruker 600 ? # _pdbx_nmr_refine.entry_id 5JOJ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # _pdbx_nmr_ensemble.entry_id 5JOJ _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5JOJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 5 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 6 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 7 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5JOJ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5JOJ _struct.title 'Calcium-loaded EF-hand domain of L-plastin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5JOJ _struct_keywords.text 'Calcium-binding, EF-hand, L-plastin, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 7 ? ASP A 22 ? SER A 7 ASP A 22 1 ? 16 HELX_P HELX_P2 AA2 SER A 30 ? ALA A 41 ? SER A 30 ALA A 41 1 ? 12 HELX_P HELX_P3 AA3 PRO A 46 ? THR A 60 ? PRO A 46 THR A 60 1 ? 15 HELX_P HELX_P4 AA4 PHE A 71 ? LEU A 81 ? PHE A 71 LEU A 81 1 ? 11 HELX_P HELX_P5 AA5 THR A 84 ? ASN A 95 ? THR A 84 ASN A 95 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 22 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 22 A CA 101 1_555 ? ? ? ? ? ? ? 3.071 ? ? metalc2 metalc ? ? A ASP 24 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 24 A CA 101 1_555 ? ? ? ? ? ? ? 3.066 ? ? metalc3 metalc ? ? A ASN 26 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 26 A CA 101 1_555 ? ? ? ? ? ? ? 3.078 ? ? metalc4 metalc ? ? A TYR 28 O ? ? ? 1_555 B CA . CA ? ? A TYR 28 A CA 101 1_555 ? ? ? ? ? ? ? 3.082 ? ? metalc5 metalc ? ? A GLU 33 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 33 A CA 101 1_555 ? ? ? ? ? ? ? 3.068 ? ? metalc6 metalc ? ? A GLU 33 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 33 A CA 101 1_555 ? ? ? ? ? ? ? 3.068 ? ? metalc7 metalc ? ? A ASP 62 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 62 A CA 102 1_555 ? ? ? ? ? ? ? 3.073 ? ? metalc8 metalc ? ? A ASP 64 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 64 A CA 102 1_555 ? ? ? ? ? ? ? 3.071 ? ? metalc9 metalc ? ? A ASP 66 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 66 A CA 102 1_555 ? ? ? ? ? ? ? 3.063 ? ? metalc10 metalc ? ? A ARG 68 O ? ? ? 1_555 C CA . CA ? ? A ARG 68 A CA 102 1_555 ? ? ? ? ? ? ? 3.063 ? ? metalc11 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 73 A CA 102 1_555 ? ? ? ? ? ? ? 3.067 ? ? metalc12 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 73 A CA 102 1_555 ? ? ? ? ? ? ? 3.067 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 28 ? ILE A 29 ? TYR A 28 ILE A 29 AA1 2 ILE A 69 ? SER A 70 ? ILE A 69 SER A 70 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 29 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 29 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 69 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 69 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 101 ? 5 'binding site for residue CA A 101' AC2 Software A CA 102 ? 5 'binding site for residue CA A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 22 ? ASP A 22 . ? 1_555 ? 2 AC1 5 ASP A 24 ? ASP A 24 . ? 1_555 ? 3 AC1 5 ASN A 26 ? ASN A 26 . ? 1_555 ? 4 AC1 5 TYR A 28 ? TYR A 28 . ? 1_555 ? 5 AC1 5 GLU A 33 ? GLU A 33 . ? 1_555 ? 6 AC2 5 ASP A 62 ? ASP A 62 . ? 1_555 ? 7 AC2 5 ASP A 64 ? ASP A 64 . ? 1_555 ? 8 AC2 5 ASP A 66 ? ASP A 66 . ? 1_555 ? 9 AC2 5 ARG A 68 ? ARG A 68 . ? 1_555 ? 10 AC2 5 GLU A 73 ? GLU A 73 . ? 1_555 ? # _atom_sites.entry_id 5JOJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LYS 97 97 97 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 101 127 CA CA A . C 2 CA 1 102 140 CA CA A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 102.4 ? 2 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASN 26 ? A ASN 26 ? 1_555 68.0 ? 3 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASN 26 ? A ASN 26 ? 1_555 65.9 ? 4 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A TYR 28 ? A TYR 28 ? 1_555 55.1 ? 5 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A TYR 28 ? A TYR 28 ? 1_555 128.0 ? 6 OD1 ? A ASN 26 ? A ASN 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A TYR 28 ? A TYR 28 ? 1_555 62.2 ? 7 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 71.8 ? 8 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 148.1 ? 9 OD1 ? A ASN 26 ? A ASN 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 133.1 ? 10 O ? A TYR 28 ? A TYR 28 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 75.4 ? 11 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 33 ? A GLU 33 ? 1_555 111.3 ? 12 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 33 ? A GLU 33 ? 1_555 122.8 ? 13 OD1 ? A ASN 26 ? A ASN 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 33 ? A GLU 33 ? 1_555 170.4 ? 14 O ? A TYR 28 ? A TYR 28 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 33 ? A GLU 33 ? 1_555 109.2 ? 15 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 33 ? A GLU 33 ? 1_555 42.0 ? 16 OD1 ? A ASP 62 ? A ASP 62 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 64 ? A ASP 64 ? 1_555 97.7 ? 17 OD1 ? A ASP 62 ? A ASP 62 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 65.7 ? 18 OD2 ? A ASP 64 ? A ASP 64 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 134.7 ? 19 OD1 ? A ASP 62 ? A ASP 62 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A ARG 68 ? A ARG 68 ? 1_555 73.7 ? 20 OD2 ? A ASP 64 ? A ASP 64 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A ARG 68 ? A ARG 68 ? 1_555 162.4 ? 21 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A ARG 68 ? A ARG 68 ? 1_555 56.3 ? 22 OD1 ? A ASP 62 ? A ASP 62 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73 ? 1_555 64.1 ? 23 OD2 ? A ASP 64 ? A ASP 64 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73 ? 1_555 92.5 ? 24 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73 ? 1_555 113.7 ? 25 O ? A ARG 68 ? A ARG 68 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73 ? 1_555 69.9 ? 26 OD1 ? A ASP 62 ? A ASP 62 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73 ? 1_555 105.3 ? 27 OD2 ? A ASP 64 ? A ASP 64 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73 ? 1_555 95.2 ? 28 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73 ? 1_555 129.3 ? 29 O ? A ARG 68 ? A ARG 68 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73 ? 1_555 73.0 ? 30 OE1 ? A GLU 73 ? A GLU 73 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73 ? 1_555 42.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-04-19 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'EF-hand domain of L-plastin' 1.0 ? mM '[U-98% 15N]' 2 'EF-hand domain of L-plastin' 0.5 ? mM '[U-99% 13C; U-98% 15N]' 3 'EF-hand domain of L-plastin' 0.5 ? mM '[U-99% 13C; U-98% 15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -57.41 175.20 2 1 ASP A 22 ? ? -69.51 86.36 3 1 CYS A 42 ? ? 57.96 76.66 4 1 PRO A 44 ? ? -69.79 73.84 5 1 PRO A 46 ? ? -69.81 -168.79 6 1 LYS A 82 ? ? -58.83 -176.21 7 1 SER A 83 ? ? -51.69 103.27 8 2 PRO A 44 ? ? -69.74 76.72 9 2 PRO A 46 ? ? -69.83 -168.86 10 2 LEU A 81 ? ? -104.94 68.55 11 3 ALA A 2 ? ? -123.12 -75.43 12 3 SER A 5 ? ? -54.68 174.03 13 3 ASP A 22 ? ? -67.39 88.83 14 3 PRO A 44 ? ? -69.80 78.32 15 3 PRO A 46 ? ? -69.72 -169.15 16 3 LYS A 82 ? ? -57.79 -178.61 17 3 SER A 83 ? ? -52.52 102.86 18 4 ARG A 3 ? ? -65.22 91.99 19 4 SER A 5 ? ? -61.31 -172.88 20 4 CYS A 42 ? ? 59.24 84.67 21 4 PRO A 46 ? ? -69.71 -169.36 22 4 LYS A 82 ? ? -58.21 -176.04 23 4 SER A 83 ? ? -55.51 100.66 24 5 ALA A 2 ? ? -173.48 146.42 25 5 ASP A 22 ? ? -69.83 84.89 26 5 PRO A 46 ? ? -69.84 -165.37 27 5 LYS A 82 ? ? -51.24 -74.82 28 5 SER A 83 ? ? -153.00 85.80 29 6 ARG A 3 ? ? -56.98 105.05 30 6 SER A 5 ? ? -54.37 174.23 31 6 PRO A 44 ? ? -69.86 76.52 32 6 PRO A 46 ? ? -69.72 -169.69 33 6 LYS A 82 ? ? -53.07 172.87 34 6 SER A 83 ? ? -51.48 103.42 35 7 ASP A 22 ? ? -60.51 96.45 36 7 PRO A 44 ? ? -69.82 74.21 37 7 PRO A 46 ? ? -69.74 -166.95 38 8 ALA A 2 ? ? -168.01 -54.83 39 8 SER A 7 ? ? -55.66 173.56 40 8 ASP A 22 ? ? -66.10 90.31 41 8 PRO A 44 ? ? -69.84 72.32 42 8 PRO A 46 ? ? -69.75 -169.76 43 8 SER A 83 ? ? -178.88 110.65 44 9 ARG A 3 ? ? -99.99 -73.34 45 9 VAL A 6 ? ? -168.40 115.59 46 9 ASP A 22 ? ? -58.95 97.26 47 9 CYS A 42 ? ? 56.65 83.95 48 9 PRO A 46 ? ? -69.69 -165.26 49 9 SER A 83 ? ? -51.68 102.98 50 10 ARG A 3 ? ? -52.80 170.32 51 10 SER A 5 ? ? -53.74 173.08 52 10 ASP A 22 ? ? -57.43 98.56 53 10 PRO A 44 ? ? -69.84 75.26 54 10 PRO A 46 ? ? -69.76 -165.99 55 11 SER A 5 ? ? -61.71 -170.21 56 11 ASP A 22 ? ? -69.40 86.09 57 11 CYS A 42 ? ? 50.93 71.81 58 11 PRO A 44 ? ? -69.72 77.96 59 11 PRO A 46 ? ? -69.75 -169.54 60 11 SER A 83 ? ? -178.31 109.75 61 12 ALA A 2 ? ? -176.22 115.15 62 12 SER A 5 ? ? -53.22 172.47 63 12 PRO A 44 ? ? -69.81 75.49 64 12 PRO A 46 ? ? -69.76 -169.75 65 12 LEU A 81 ? ? -112.96 75.93 66 13 SER A 5 ? ? -55.44 175.89 67 13 PRO A 44 ? ? -69.79 77.23 68 13 LYS A 82 ? ? -92.54 43.25 69 13 SER A 83 ? ? -151.54 30.28 70 14 ASP A 22 ? ? -59.85 98.33 71 14 CYS A 42 ? ? 53.77 76.90 72 14 PRO A 44 ? ? -69.76 76.35 73 14 PRO A 46 ? ? -69.82 -166.92 74 14 SER A 83 ? ? 46.16 70.62 75 15 SER A 5 ? ? -60.34 -175.78 76 15 ASP A 22 ? ? -59.22 97.72 77 15 PRO A 44 ? ? -69.71 82.01 78 15 PRO A 46 ? ? -69.86 -165.02 79 15 LYS A 82 ? ? -59.89 -173.00 80 15 SER A 83 ? ? -51.62 103.44 81 16 SER A 5 ? ? 67.16 128.67 82 16 VAL A 6 ? ? -178.67 119.16 83 16 PRO A 44 ? ? -69.81 76.27 84 16 PRO A 46 ? ? -69.72 -168.10 85 16 LYS A 82 ? ? -55.85 178.25 86 16 SER A 83 ? ? -51.64 103.15 87 17 SER A 5 ? ? -62.54 -170.00 88 17 SER A 7 ? ? -58.11 171.41 89 17 ASP A 22 ? ? -65.09 89.31 90 17 PRO A 44 ? ? -69.71 77.21 91 17 PRO A 46 ? ? -69.74 -170.47 92 18 CYS A 42 ? ? 58.75 82.36 93 18 PRO A 46 ? ? -69.79 -167.82 94 18 SER A 83 ? ? -52.02 103.07 95 18 LYS A 96 ? ? 59.49 18.51 96 19 ARG A 3 ? ? -170.36 127.38 97 19 SER A 5 ? ? -53.70 173.57 98 19 ASP A 22 ? ? -64.77 93.14 99 19 CYS A 42 ? ? 53.09 84.32 100 19 PRO A 46 ? ? -69.84 -170.60 101 19 LYS A 82 ? ? -60.38 -169.28 102 20 ARG A 3 ? ? -53.34 107.36 103 20 SER A 5 ? ? -56.40 177.32 104 20 ASP A 22 ? ? -68.44 93.06 105 20 CYS A 42 ? ? 56.77 85.12 106 20 PRO A 46 ? ? -69.73 -168.15 107 20 LYS A 82 ? ? -60.44 -168.91 108 20 SER A 83 ? ? -55.52 99.57 109 21 ALA A 2 ? ? -107.25 -75.24 110 21 SER A 5 ? ? -54.78 174.99 111 21 CYS A 42 ? ? 64.76 80.66 112 21 PRO A 46 ? ? -69.80 -166.60 113 22 SER A 5 ? ? -54.64 174.09 114 22 PRO A 46 ? ? -69.82 -168.79 115 22 LEU A 81 ? ? -49.32 151.15 116 22 LYS A 82 ? ? -54.25 175.19 117 23 ARG A 3 ? ? -107.79 56.66 118 23 CYS A 42 ? ? 52.05 81.90 119 23 PRO A 44 ? ? -69.75 75.05 120 23 PRO A 46 ? ? -69.65 -170.87 121 23 SER A 83 ? ? -53.94 101.56 122 24 PRO A 44 ? ? -69.69 75.91 123 24 PRO A 46 ? ? -69.79 -165.17 124 24 LYS A 82 ? ? -60.59 -169.13 125 25 SER A 7 ? ? -58.93 172.28 126 25 CYS A 42 ? ? 65.25 97.82 127 25 PRO A 46 ? ? -69.78 -167.31 128 25 LEU A 81 ? ? -90.72 -73.58 129 25 SER A 83 ? ? -151.65 23.19 130 26 SER A 5 ? ? -55.11 175.09 131 26 PRO A 46 ? ? -69.77 -169.27 132 26 LYS A 82 ? ? -60.40 -171.11 133 26 SER A 83 ? ? -61.73 95.23 134 26 LYS A 96 ? ? 58.86 19.43 135 27 SER A 5 ? ? -67.46 90.32 136 27 SER A 7 ? ? -57.98 173.31 137 27 ASP A 22 ? ? -61.48 95.31 138 27 PRO A 46 ? ? -69.81 -166.95 139 28 SER A 5 ? ? -61.00 -171.56 140 28 PRO A 44 ? ? -69.71 90.98 141 28 SER A 83 ? ? -140.79 28.13 142 29 PRO A 46 ? ? -69.78 -165.37 143 29 LEU A 81 ? ? -113.84 72.32 144 30 ALA A 2 ? ? -67.80 -71.01 145 30 ARG A 3 ? ? -52.52 108.34 146 30 SER A 5 ? ? -61.39 -169.74 147 30 PRO A 44 ? ? -69.77 76.90 148 30 PRO A 46 ? ? -69.72 -169.19 149 30 GLN A 65 ? ? 64.34 60.55 150 30 LYS A 82 ? ? -93.04 44.92 151 30 SER A 83 ? ? -155.22 34.50 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #