data_5JUF # _entry.id 5JUF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5JUF WWPDB D_1000221089 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5JUF _pdbx_database_status.recvd_initial_deposition_date 2016-05-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Talagas, A.' 1 'Fontaine, L.' 2 'Ledesma, L.' 3 'Li de la Sierra-Gallay, I.' 4 'Hols, P.' 5 'Nessler, S.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'PLoS Pathog.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1553-7374 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first e1005980 _citation.page_last e1005980 _citation.title 'Structural Insights into Streptococcal Competence Regulation by the Cell-to-Cell Communication System ComRS.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1005980 _citation.pdbx_database_id_PubMed 27907189 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Talagas, A.' 1 primary 'Fontaine, L.' 2 primary 'Ledesma-Garca, L.' 3 primary 'Mignolet, J.' 4 primary 'Li de la Sierra-Gallay, I.' 5 primary 'Lazar, N.' 6 primary 'Aumont-Nicaise, M.' 7 primary 'Federle, M.J.' 8 primary 'Prehna, G.' 9 primary 'Hols, P.' 10 primary 'Nessler, S.' 11 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5JUF _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.820 _cell.length_a_esd ? _cell.length_b 141.680 _cell.length_b_esd ? _cell.length_c 78.550 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5JUF _symmetry.cell_setting ? _symmetry.Int_Tables_number 21 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional regulator' 36547.996 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 4 ? ? ? ? 3 water nat water 18.015 117 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNLKDSIGLRIKTERERQQMSREVLCLDGAELTVRQLIRIEKGESLPSLDRLSYIAKRLGKSMTELLDQDNITIPDEYYE MKNRLIKFPTYRNPDRIKSKLTLIEEVYEKFFDILPEEELLTLDILENILSFTSWEESPKVEEIYEDLFEQVKRKRKFST NDLLVIDYYFFHLYGRKQYDKKLFERIIKRVLNQEIWTDDVYNIVLFNDLMAIAALKIFHNSFSDFLTVVDKALAVIEKS QLYSYKPSVFVLKAKYELLHKENKKEAAENYDKAIVFASVLEDSVLEESIKAGKLADGLGAGWSHPQFEK ; _entity_poly.pdbx_seq_one_letter_code_can ;MNLKDSIGLRIKTERERQQMSREVLCLDGAELTVRQLIRIEKGESLPSLDRLSYIAKRLGKSMTELLDQDNITIPDEYYE MKNRLIKFPTYRNPDRIKSKLTLIEEVYEKFFDILPEEELLTLDILENILSFTSWEESPKVEEIYEDLFEQVKRKRKFST NDLLVIDYYFFHLYGRKQYDKKLFERIIKRVLNQEIWTDDVYNIVLFNDLMAIAALKIFHNSFSDFLTVVDKALAVIEKS QLYSYKPSVFVLKAKYELLHKENKKEAAENYDKAIVFASVLEDSVLEESIKAGKLADGLGAGWSHPQFEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 LEU n 1 4 LYS n 1 5 ASP n 1 6 SER n 1 7 ILE n 1 8 GLY n 1 9 LEU n 1 10 ARG n 1 11 ILE n 1 12 LYS n 1 13 THR n 1 14 GLU n 1 15 ARG n 1 16 GLU n 1 17 ARG n 1 18 GLN n 1 19 GLN n 1 20 MET n 1 21 SER n 1 22 ARG n 1 23 GLU n 1 24 VAL n 1 25 LEU n 1 26 CYS n 1 27 LEU n 1 28 ASP n 1 29 GLY n 1 30 ALA n 1 31 GLU n 1 32 LEU n 1 33 THR n 1 34 VAL n 1 35 ARG n 1 36 GLN n 1 37 LEU n 1 38 ILE n 1 39 ARG n 1 40 ILE n 1 41 GLU n 1 42 LYS n 1 43 GLY n 1 44 GLU n 1 45 SER n 1 46 LEU n 1 47 PRO n 1 48 SER n 1 49 LEU n 1 50 ASP n 1 51 ARG n 1 52 LEU n 1 53 SER n 1 54 TYR n 1 55 ILE n 1 56 ALA n 1 57 LYS n 1 58 ARG n 1 59 LEU n 1 60 GLY n 1 61 LYS n 1 62 SER n 1 63 MET n 1 64 THR n 1 65 GLU n 1 66 LEU n 1 67 LEU n 1 68 ASP n 1 69 GLN n 1 70 ASP n 1 71 ASN n 1 72 ILE n 1 73 THR n 1 74 ILE n 1 75 PRO n 1 76 ASP n 1 77 GLU n 1 78 TYR n 1 79 TYR n 1 80 GLU n 1 81 MET n 1 82 LYS n 1 83 ASN n 1 84 ARG n 1 85 LEU n 1 86 ILE n 1 87 LYS n 1 88 PHE n 1 89 PRO n 1 90 THR n 1 91 TYR n 1 92 ARG n 1 93 ASN n 1 94 PRO n 1 95 ASP n 1 96 ARG n 1 97 ILE n 1 98 LYS n 1 99 SER n 1 100 LYS n 1 101 LEU n 1 102 THR n 1 103 LEU n 1 104 ILE n 1 105 GLU n 1 106 GLU n 1 107 VAL n 1 108 TYR n 1 109 GLU n 1 110 LYS n 1 111 PHE n 1 112 PHE n 1 113 ASP n 1 114 ILE n 1 115 LEU n 1 116 PRO n 1 117 GLU n 1 118 GLU n 1 119 GLU n 1 120 LEU n 1 121 LEU n 1 122 THR n 1 123 LEU n 1 124 ASP n 1 125 ILE n 1 126 LEU n 1 127 GLU n 1 128 ASN n 1 129 ILE n 1 130 LEU n 1 131 SER n 1 132 PHE n 1 133 THR n 1 134 SER n 1 135 TRP n 1 136 GLU n 1 137 GLU n 1 138 SER n 1 139 PRO n 1 140 LYS n 1 141 VAL n 1 142 GLU n 1 143 GLU n 1 144 ILE n 1 145 TYR n 1 146 GLU n 1 147 ASP n 1 148 LEU n 1 149 PHE n 1 150 GLU n 1 151 GLN n 1 152 VAL n 1 153 LYS n 1 154 ARG n 1 155 LYS n 1 156 ARG n 1 157 LYS n 1 158 PHE n 1 159 SER n 1 160 THR n 1 161 ASN n 1 162 ASP n 1 163 LEU n 1 164 LEU n 1 165 VAL n 1 166 ILE n 1 167 ASP n 1 168 TYR n 1 169 TYR n 1 170 PHE n 1 171 PHE n 1 172 HIS n 1 173 LEU n 1 174 TYR n 1 175 GLY n 1 176 ARG n 1 177 LYS n 1 178 GLN n 1 179 TYR n 1 180 ASP n 1 181 LYS n 1 182 LYS n 1 183 LEU n 1 184 PHE n 1 185 GLU n 1 186 ARG n 1 187 ILE n 1 188 ILE n 1 189 LYS n 1 190 ARG n 1 191 VAL n 1 192 LEU n 1 193 ASN n 1 194 GLN n 1 195 GLU n 1 196 ILE n 1 197 TRP n 1 198 THR n 1 199 ASP n 1 200 ASP n 1 201 VAL n 1 202 TYR n 1 203 ASN n 1 204 ILE n 1 205 VAL n 1 206 LEU n 1 207 PHE n 1 208 ASN n 1 209 ASP n 1 210 LEU n 1 211 MET n 1 212 ALA n 1 213 ILE n 1 214 ALA n 1 215 ALA n 1 216 LEU n 1 217 LYS n 1 218 ILE n 1 219 PHE n 1 220 HIS n 1 221 ASN n 1 222 SER n 1 223 PHE n 1 224 SER n 1 225 ASP n 1 226 PHE n 1 227 LEU n 1 228 THR n 1 229 VAL n 1 230 VAL n 1 231 ASP n 1 232 LYS n 1 233 ALA n 1 234 LEU n 1 235 ALA n 1 236 VAL n 1 237 ILE n 1 238 GLU n 1 239 LYS n 1 240 SER n 1 241 GLN n 1 242 LEU n 1 243 TYR n 1 244 SER n 1 245 TYR n 1 246 LYS n 1 247 PRO n 1 248 SER n 1 249 VAL n 1 250 PHE n 1 251 VAL n 1 252 LEU n 1 253 LYS n 1 254 ALA n 1 255 LYS n 1 256 TYR n 1 257 GLU n 1 258 LEU n 1 259 LEU n 1 260 HIS n 1 261 LYS n 1 262 GLU n 1 263 ASN n 1 264 LYS n 1 265 LYS n 1 266 GLU n 1 267 ALA n 1 268 ALA n 1 269 GLU n 1 270 ASN n 1 271 TYR n 1 272 ASP n 1 273 LYS n 1 274 ALA n 1 275 ILE n 1 276 VAL n 1 277 PHE n 1 278 ALA n 1 279 SER n 1 280 VAL n 1 281 LEU n 1 282 GLU n 1 283 ASP n 1 284 SER n 1 285 VAL n 1 286 LEU n 1 287 GLU n 1 288 GLU n 1 289 SER n 1 290 ILE n 1 291 LYS n 1 292 ALA n 1 293 GLY n 1 294 LYS n 1 295 LEU n 1 296 ALA n 1 297 ASP n 1 298 GLY n 1 299 LEU n 1 300 GLY n 1 301 ALA n 1 302 GLY n 1 303 TRP n 1 304 SER n 1 305 HIS n 1 306 PRO n 1 307 GLN n 1 308 PHE n 1 309 GLU n 1 310 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 310 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BN551_00358 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus thermophilus LMD-9' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 322159 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'Gold pLysS AG' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector pBAD _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5JUF _struct_ref.pdbx_db_accession 5JUF _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5JUF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 310 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5JUF _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 310 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 310 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5JUF _exptl.crystals_number 2 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # loop_ _exptl_crystal.colour _exptl_crystal.density_diffrn _exptl_crystal.density_Matthews _exptl_crystal.density_method _exptl_crystal.density_percent_sol _exptl_crystal.description _exptl_crystal.F_000 _exptl_crystal.id _exptl_crystal.preparation _exptl_crystal.size_max _exptl_crystal.size_mid _exptl_crystal.size_min _exptl_crystal.size_rad _exptl_crystal.colour_lustre _exptl_crystal.colour_modifier _exptl_crystal.colour_primary _exptl_crystal.density_meas _exptl_crystal.density_meas_esd _exptl_crystal.density_meas_gt _exptl_crystal.density_meas_lt _exptl_crystal.density_meas_temp _exptl_crystal.density_meas_temp_esd _exptl_crystal.density_meas_temp_gt _exptl_crystal.density_meas_temp_lt _exptl_crystal.pdbx_crystal_image_url _exptl_crystal.pdbx_crystal_image_format _exptl_crystal.pdbx_mosaicity _exptl_crystal.pdbx_mosaicity_esd ? ? 2.35 ? 47.73 ? ? 1 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.35 ? 47.73 ? ? 2 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _exptl_crystal_grow.apparatus _exptl_crystal_grow.atmosphere _exptl_crystal_grow.crystal_id _exptl_crystal_grow.details _exptl_crystal_grow.method _exptl_crystal_grow.method_ref _exptl_crystal_grow.pH _exptl_crystal_grow.pressure _exptl_crystal_grow.pressure_esd _exptl_crystal_grow.seeding _exptl_crystal_grow.seeding_ref _exptl_crystal_grow.temp _exptl_crystal_grow.temp_details _exptl_crystal_grow.temp_esd _exptl_crystal_grow.time _exptl_crystal_grow.pdbx_details _exptl_crystal_grow.pdbx_pH_range ? ? 1 ? 'VAPOR DIFFUSION, HANGING DROP' ? 6.4 ? ? ? ? 291.15 ? ? ? '20% PEG 8000, 0.1M sodium cacodylate pH=6.4, 0.2M amonium sulfate' ? ? ? 2 ? 'VAPOR DIFFUSION, HANGING DROP' ? 6.4 ? ? ? ? 291.15 ? ? ? '20% PEG 8000, 0.1M sodium cacodylate pH=6.4, 0.2M amonium sulfate' ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt ? 100 ? ? 1 ? ? ? 1 ? ? ? ? ? ? ? 100 ? ? 2 ? ? ? 2 ? ? ? ? ? ? # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date ? PIXEL 1 'DECTRIS PILATUS3 6M' ? ? ? ? 2015-03-03 ? PIXEL 2 'DECTRIS PILATUS3 6M' ? ? ? ? 2014-07-07 # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.976250 1.0 2 0.979316 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'ESRF BEAMLINE ID29' ? ? 0.976250 ? ID29 ESRF ? ? 2 ? ? SYNCHROTRON ? 'ESRF BEAMLINE ID29' ? ? 0.979316 ? ID29 ESRF # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_R_split ? 5JUF ? ? 1.9460 45.953 ? ? ? ? ? ? ? ? 25537 ? ? ? ? ? ? ? 99.2 ? ? ? ? ? ? 10.9 ? ? ? ? 12.53 ? ? ? ? ? ? ? ? ? ? ? ? 1 1 0.996 ? ? 5JUF ? ? 2.78 45.44 ? ? ? ? ? ? ? ? 16117 ? ? ? ? ? ? ? 98.3 ? ? ? ? ? ? 5.2 ? ? ? ? 15.24 ? ? ? ? ? ? ? ? ? ? ? ? 2 2 0.997 ? # _reflns_shell.d_res_high 1.946 _reflns_shell.d_res_low 2.05 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.48 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 96.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5JUF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.946 _refine.ls_d_res_low 45.953 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 25533 _refine.ls_number_reflns_R_free 1277 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.19 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1840 _refine.ls_R_factor_R_free 0.2163 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1822 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.84 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2488 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 117 _refine_hist.number_atoms_total 2625 _refine_hist.d_res_high 1.946 _refine_hist.d_res_low 45.953 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 2548 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.753 ? 3430 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 17.200 ? 1565 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.048 ? 384 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 429 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9462 2.0241 . . 132 2519 94.00 . . . 0.3545 . 0.2851 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0241 2.1162 . . 141 2665 100.00 . . . 0.2581 . 0.2062 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1162 2.2278 . . 141 2683 100.00 . . . 0.2165 . 0.1836 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2278 2.3674 . . 141 2675 100.00 . . . 0.2321 . 0.1808 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3674 2.5501 . . 142 2696 100.00 . . . 0.2220 . 0.1845 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5501 2.8067 . . 142 2698 100.00 . . . 0.2423 . 0.1800 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8067 3.2128 . . 143 2728 100.00 . . . 0.2037 . 0.1801 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2128 4.0474 . . 144 2739 100.00 . . . 0.1961 . 0.1642 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0474 45.9660 . . 151 2853 100.00 . . . 0.2039 . 0.1842 . . . . . . . . . . # _struct.entry_id 5JUF _struct.title 'Crystal structure of the apo form of ComR from S. thermophilus.' _struct.pdbx_descriptor 'Transcriptional regulator' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5JUF _struct_keywords.text 'RNPP, Transcriptional activator, TPR, HTH, apo, quorum-sensor, competence regulator, transcription' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 2 ? GLN A 18 ? ASN A 2 GLN A 18 1 ? 17 HELX_P HELX_P2 AA2 SER A 21 ? LEU A 27 ? SER A 21 LEU A 27 1 ? 7 HELX_P HELX_P3 AA3 THR A 33 ? LYS A 42 ? THR A 33 LYS A 42 1 ? 10 HELX_P HELX_P4 AA4 SER A 48 ? GLY A 60 ? SER A 48 GLY A 60 1 ? 13 HELX_P HELX_P5 AA5 SER A 62 ? ASP A 68 ? SER A 62 ASP A 68 1 ? 7 HELX_P HELX_P6 AA6 PRO A 75 ? LYS A 87 ? PRO A 75 LYS A 87 1 ? 13 HELX_P HELX_P7 AA7 ASN A 93 ? PHE A 112 ? ASN A 93 PHE A 112 1 ? 20 HELX_P HELX_P8 AA8 ASP A 113 ? LEU A 115 ? ASP A 113 LEU A 115 5 ? 3 HELX_P HELX_P9 AA9 PRO A 116 ? SER A 131 ? PRO A 116 SER A 131 1 ? 16 HELX_P HELX_P10 AB1 SER A 134 ? GLU A 137 ? SER A 134 GLU A 137 5 ? 4 HELX_P HELX_P11 AB2 SER A 138 ? LYS A 153 ? SER A 138 LYS A 153 1 ? 16 HELX_P HELX_P12 AB3 SER A 159 ? TYR A 174 ? SER A 159 TYR A 174 1 ? 16 HELX_P HELX_P13 AB4 ASP A 180 ? ASN A 193 ? ASP A 180 ASN A 193 1 ? 14 HELX_P HELX_P14 AB5 ASP A 199 ? HIS A 220 ? ASP A 199 HIS A 220 1 ? 22 HELX_P HELX_P15 AB6 ASP A 225 ? GLN A 241 ? ASP A 225 GLN A 241 1 ? 17 HELX_P HELX_P16 AB7 LEU A 242 ? SER A 244 ? LEU A 242 SER A 244 5 ? 3 HELX_P HELX_P17 AB8 TYR A 245 ? HIS A 260 ? TYR A 245 HIS A 260 1 ? 16 HELX_P HELX_P18 AB9 ASN A 263 ? LEU A 281 ? ASN A 263 LEU A 281 1 ? 19 HELX_P HELX_P19 AC1 ASP A 283 ? ASP A 297 ? ASP A 283 ASP A 297 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ARG _struct_conn.ptnr1_label_seq_id 156 _struct_conn.ptnr1_label_atom_id NH1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id D _struct_conn.ptnr2_label_comp_id SO4 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id O3 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ARG _struct_conn.ptnr1_auth_seq_id 156 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id SO4 _struct_conn.ptnr2_auth_seq_id 403 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.297 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 401 ? 7 'binding site for residue SO4 A 401' AC2 Software A SO4 402 ? 5 'binding site for residue SO4 A 402' AC3 Software A SO4 403 ? 6 'binding site for residue SO4 A 403' AC4 Software A SO4 404 ? 3 'binding site for residue SO4 A 404' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 PRO A 89 ? PRO A 89 . ? 1_555 ? 2 AC1 7 THR A 90 ? THR A 90 . ? 1_555 ? 3 AC1 7 LYS A 100 ? LYS A 100 . ? 1_555 ? 4 AC1 7 LEU A 130 ? LEU A 130 . ? 1_555 ? 5 AC1 7 ASN A 208 ? ASN A 208 . ? 1_555 ? 6 AC1 7 HOH F . ? HOH A 577 . ? 1_555 ? 7 AC1 7 HOH F . ? HOH A 578 . ? 1_555 ? 8 AC2 5 GLU A 137 ? GLU A 137 . ? 1_555 ? 9 AC2 5 SER A 138 ? SER A 138 . ? 1_555 ? 10 AC2 5 PRO A 139 ? PRO A 139 . ? 1_555 ? 11 AC2 5 LYS A 140 ? LYS A 140 . ? 1_555 ? 12 AC2 5 VAL A 141 ? VAL A 141 . ? 1_555 ? 13 AC3 6 ARG A 17 ? ARG A 17 . ? 3_557 ? 14 AC3 6 ARG A 156 ? ARG A 156 . ? 1_555 ? 15 AC3 6 LYS A 189 ? LYS A 189 . ? 1_555 ? 16 AC3 6 ARG A 190 ? ARG A 190 . ? 1_555 ? 17 AC3 6 HOH F . ? HOH A 507 . ? 1_555 ? 18 AC3 6 HOH F . ? HOH A 593 . ? 1_555 ? 19 AC4 3 ARG A 176 ? ARG A 176 . ? 1_555 ? 20 AC4 3 LYS A 177 ? LYS A 177 . ? 1_555 ? 21 AC4 3 GLN A 178 ? GLN A 178 . ? 1_555 ? # _atom_sites.entry_id 5JUF _atom_sites.fract_transf_matrix[1][1] 0.016176 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007058 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012731 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 TRP 135 135 135 TRP TRP A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 TYR 174 174 174 TYR TYR A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 ARG 176 176 176 ARG ARG A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 GLN 194 194 194 GLN GLN A . n A 1 195 GLU 195 195 195 GLU GLU A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 TRP 197 197 197 TRP TRP A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 ASN 203 203 203 ASN ASN A . n A 1 204 ILE 204 204 204 ILE ILE A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 PHE 207 207 207 PHE PHE A . n A 1 208 ASN 208 208 208 ASN ASN A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 MET 211 211 211 MET MET A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 HIS 220 220 220 HIS HIS A . n A 1 221 ASN 221 221 221 ASN ASN A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 PHE 223 223 223 PHE PHE A . n A 1 224 SER 224 224 224 SER SER A . n A 1 225 ASP 225 225 225 ASP ASP A . n A 1 226 PHE 226 226 226 PHE PHE A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 THR 228 228 228 THR THR A . n A 1 229 VAL 229 229 229 VAL VAL A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 ASP 231 231 231 ASP ASP A . n A 1 232 LYS 232 232 232 LYS LYS A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 ALA 235 235 235 ALA ALA A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 ILE 237 237 237 ILE ILE A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 GLN 241 241 241 GLN GLN A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 TYR 243 243 243 TYR TYR A . n A 1 244 SER 244 244 244 SER SER A . n A 1 245 TYR 245 245 245 TYR TYR A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 PRO 247 247 247 PRO PRO A . n A 1 248 SER 248 248 248 SER SER A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 PHE 250 250 250 PHE PHE A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 ALA 254 254 254 ALA ALA A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 TYR 256 256 256 TYR TYR A . n A 1 257 GLU 257 257 257 GLU GLU A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 LEU 259 259 259 LEU LEU A . n A 1 260 HIS 260 260 260 HIS HIS A . n A 1 261 LYS 261 261 261 LYS LYS A . n A 1 262 GLU 262 262 262 GLU GLU A . n A 1 263 ASN 263 263 263 ASN ASN A . n A 1 264 LYS 264 264 264 LYS LYS A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 GLU 266 266 266 GLU GLU A . n A 1 267 ALA 267 267 267 ALA ALA A . n A 1 268 ALA 268 268 268 ALA ALA A . n A 1 269 GLU 269 269 269 GLU GLU A . n A 1 270 ASN 270 270 270 ASN ASN A . n A 1 271 TYR 271 271 271 TYR TYR A . n A 1 272 ASP 272 272 272 ASP ASP A . n A 1 273 LYS 273 273 273 LYS LYS A . n A 1 274 ALA 274 274 274 ALA ALA A . n A 1 275 ILE 275 275 275 ILE ILE A . n A 1 276 VAL 276 276 276 VAL VAL A . n A 1 277 PHE 277 277 277 PHE PHE A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 VAL 280 280 280 VAL VAL A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 GLU 282 282 282 GLU GLU A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 SER 284 284 284 SER SER A . n A 1 285 VAL 285 285 285 VAL VAL A . n A 1 286 LEU 286 286 286 LEU LEU A . n A 1 287 GLU 287 287 287 GLU GLU A . n A 1 288 GLU 288 288 288 GLU GLU A . n A 1 289 SER 289 289 289 SER SER A . n A 1 290 ILE 290 290 290 ILE ILE A . n A 1 291 LYS 291 291 291 LYS LYS A . n A 1 292 ALA 292 292 292 ALA ALA A . n A 1 293 GLY 293 293 293 GLY GLY A . n A 1 294 LYS 294 294 294 LYS LYS A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 ALA 296 296 296 ALA ALA A . n A 1 297 ASP 297 297 297 ASP ASP A . n A 1 298 GLY 298 298 298 GLY GLY A . n A 1 299 LEU 299 299 299 LEU LEU A . n A 1 300 GLY 300 300 ? ? ? A . n A 1 301 ALA 301 301 ? ? ? A . n A 1 302 GLY 302 302 ? ? ? A . n A 1 303 TRP 303 303 ? ? ? A . n A 1 304 SER 304 304 ? ? ? A . n A 1 305 HIS 305 305 ? ? ? A . n A 1 306 PRO 306 306 ? ? ? A . n A 1 307 GLN 307 307 ? ? ? A . n A 1 308 PHE 308 308 ? ? ? A . n A 1 309 GLU 309 309 ? ? ? A . n A 1 310 LYS 310 310 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 401 311 SO4 SO4 A . C 2 SO4 1 402 312 SO4 SO4 A . D 2 SO4 1 403 313 SO4 SO4 A . E 2 SO4 1 404 314 SO4 SO4 A . F 3 HOH 1 501 110 HOH HOH A . F 3 HOH 2 502 106 HOH HOH A . F 3 HOH 3 503 8 HOH HOH A . F 3 HOH 4 504 115 HOH HOH A . F 3 HOH 5 505 44 HOH HOH A . F 3 HOH 6 506 54 HOH HOH A . F 3 HOH 7 507 105 HOH HOH A . F 3 HOH 8 508 49 HOH HOH A . F 3 HOH 9 509 117 HOH HOH A . F 3 HOH 10 510 21 HOH HOH A . F 3 HOH 11 511 61 HOH HOH A . F 3 HOH 12 512 103 HOH HOH A . F 3 HOH 13 513 50 HOH HOH A . F 3 HOH 14 514 72 HOH HOH A . F 3 HOH 15 515 29 HOH HOH A . F 3 HOH 16 516 13 HOH HOH A . F 3 HOH 17 517 24 HOH HOH A . F 3 HOH 18 518 66 HOH HOH A . F 3 HOH 19 519 111 HOH HOH A . F 3 HOH 20 520 26 HOH HOH A . F 3 HOH 21 521 75 HOH HOH A . F 3 HOH 22 522 51 HOH HOH A . F 3 HOH 23 523 56 HOH HOH A . F 3 HOH 24 524 71 HOH HOH A . F 3 HOH 25 525 2 HOH HOH A . F 3 HOH 26 526 83 HOH HOH A . F 3 HOH 27 527 46 HOH HOH A . F 3 HOH 28 528 47 HOH HOH A . F 3 HOH 29 529 16 HOH HOH A . F 3 HOH 30 530 12 HOH HOH A . F 3 HOH 31 531 23 HOH HOH A . F 3 HOH 32 532 48 HOH HOH A . F 3 HOH 33 533 28 HOH HOH A . F 3 HOH 34 534 35 HOH HOH A . F 3 HOH 35 535 33 HOH HOH A . F 3 HOH 36 536 7 HOH HOH A . F 3 HOH 37 537 81 HOH HOH A . F 3 HOH 38 538 45 HOH HOH A . F 3 HOH 39 539 37 HOH HOH A . F 3 HOH 40 540 63 HOH HOH A . F 3 HOH 41 541 6 HOH HOH A . F 3 HOH 42 542 17 HOH HOH A . F 3 HOH 43 543 42 HOH HOH A . F 3 HOH 44 544 80 HOH HOH A . F 3 HOH 45 545 73 HOH HOH A . F 3 HOH 46 546 53 HOH HOH A . F 3 HOH 47 547 92 HOH HOH A . F 3 HOH 48 548 1 HOH HOH A . F 3 HOH 49 549 9 HOH HOH A . F 3 HOH 50 550 18 HOH HOH A . F 3 HOH 51 551 3 HOH HOH A . F 3 HOH 52 552 78 HOH HOH A . F 3 HOH 53 553 4 HOH HOH A . F 3 HOH 54 554 27 HOH HOH A . F 3 HOH 55 555 32 HOH HOH A . F 3 HOH 56 556 94 HOH HOH A . F 3 HOH 57 557 57 HOH HOH A . F 3 HOH 58 558 65 HOH HOH A . F 3 HOH 59 559 43 HOH HOH A . F 3 HOH 60 560 101 HOH HOH A . F 3 HOH 61 561 41 HOH HOH A . F 3 HOH 62 562 22 HOH HOH A . F 3 HOH 63 563 68 HOH HOH A . F 3 HOH 64 564 10 HOH HOH A . F 3 HOH 65 565 76 HOH HOH A . F 3 HOH 66 566 31 HOH HOH A . F 3 HOH 67 567 11 HOH HOH A . F 3 HOH 68 568 89 HOH HOH A . F 3 HOH 69 569 19 HOH HOH A . F 3 HOH 70 570 60 HOH HOH A . F 3 HOH 71 571 34 HOH HOH A . F 3 HOH 72 572 39 HOH HOH A . F 3 HOH 73 573 108 HOH HOH A . F 3 HOH 74 574 52 HOH HOH A . F 3 HOH 75 575 99 HOH HOH A . F 3 HOH 76 576 25 HOH HOH A . F 3 HOH 77 577 59 HOH HOH A . F 3 HOH 78 578 69 HOH HOH A . F 3 HOH 79 579 58 HOH HOH A . F 3 HOH 80 580 14 HOH HOH A . F 3 HOH 81 581 15 HOH HOH A . F 3 HOH 82 582 114 HOH HOH A . F 3 HOH 83 583 40 HOH HOH A . F 3 HOH 84 584 30 HOH HOH A . F 3 HOH 85 585 38 HOH HOH A . F 3 HOH 86 586 62 HOH HOH A . F 3 HOH 87 587 36 HOH HOH A . F 3 HOH 88 588 84 HOH HOH A . F 3 HOH 89 589 95 HOH HOH A . F 3 HOH 90 590 116 HOH HOH A . F 3 HOH 91 591 93 HOH HOH A . F 3 HOH 92 592 82 HOH HOH A . F 3 HOH 93 593 107 HOH HOH A . F 3 HOH 94 594 85 HOH HOH A . F 3 HOH 95 595 88 HOH HOH A . F 3 HOH 96 596 5 HOH HOH A . F 3 HOH 97 597 113 HOH HOH A . F 3 HOH 98 598 20 HOH HOH A . F 3 HOH 99 599 100 HOH HOH A . F 3 HOH 100 600 98 HOH HOH A . F 3 HOH 101 601 74 HOH HOH A . F 3 HOH 102 602 104 HOH HOH A . F 3 HOH 103 603 70 HOH HOH A . F 3 HOH 104 604 87 HOH HOH A . F 3 HOH 105 605 64 HOH HOH A . F 3 HOH 106 606 109 HOH HOH A . F 3 HOH 107 607 86 HOH HOH A . F 3 HOH 108 608 102 HOH HOH A . F 3 HOH 109 609 91 HOH HOH A . F 3 HOH 110 610 67 HOH HOH A . F 3 HOH 111 611 112 HOH HOH A . F 3 HOH 112 612 96 HOH HOH A . F 3 HOH 113 613 90 HOH HOH A . F 3 HOH 114 614 97 HOH HOH A . F 3 HOH 115 615 55 HOH HOH A . F 3 HOH 116 616 79 HOH HOH A . F 3 HOH 117 617 77 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 790 ? 1 MORE -58 ? 1 'SSA (A^2)' 15480 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 597 ? F HOH . 2 1 A HOH 617 ? F HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-10-26 2 'Structure model' 1 1 2016-12-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? CRANK2 ? ? ? . 3 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 504 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 582 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.05 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 2 ? ? -124.14 -168.92 2 1 LEU A 27 ? ? 52.01 -123.14 3 1 ASP A 68 ? ? 51.44 -118.85 4 1 TRP A 197 ? ? -111.44 -148.84 5 1 LEU A 242 ? ? -91.03 58.39 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 616 ? 5.96 . 2 1 O ? A HOH 617 ? 7.10 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 300 ? A GLY 300 2 1 Y 1 A ALA 301 ? A ALA 301 3 1 Y 1 A GLY 302 ? A GLY 302 4 1 Y 1 A TRP 303 ? A TRP 303 5 1 Y 1 A SER 304 ? A SER 304 6 1 Y 1 A HIS 305 ? A HIS 305 7 1 Y 1 A PRO 306 ? A PRO 306 8 1 Y 1 A GLN 307 ? A GLN 307 9 1 Y 1 A PHE 308 ? A PHE 308 10 1 Y 1 A GLU 309 ? A GLU 309 11 1 Y 1 A LYS 310 ? A LYS 310 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #