data_5KGQ # _entry.id 5KGQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5KGQ pdb_00005kgq 10.2210/pdb5kgq/pdb WWPDB D_1000222036 ? ? BMRB 26025 ? 10.13018/BMR26025 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-07-05 2 'Structure model' 1 1 2019-04-17 3 'Structure model' 1 2 2020-01-08 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Data collection' 3 3 'Structure model' 'Author supporting evidence' 4 3 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_audit_support 4 3 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 2 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_audit_support.funding_organization' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5KGQ _pdbx_database_status.recvd_initial_deposition_date 2016-06-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details '1H, 13C, and 15N Chemical Shift Assignments for Q4DY78' _pdbx_database_related.db_id 26025 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal ;D'Andrea, E.D. ; 1 'Retel, J.S.' 2 'Diehl, A.' 3 'Schmieder, P.' 4 'Oschkinat, H.' 5 'Pires, J.R.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'NMR structure and dynamics of Q4DY78, a conserved kinetoplasid-specific protein from Trypanosoma cruzi' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary ;D'Andrea, E.D. ; 1 ? primary 'Retel, J.S.' 2 ? primary 'Diehl, A.' 3 ? primary 'Schmieder, P.' 4 ? primary 'Oschkinat, H.' 5 ? primary 'Pires, J.R.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 12526.128 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSAMGHMVKISHEDTQRIKTAFLSYAQGQDKVTEAMIDQLICGAFPGLSWEQLQEKKKGRAAANGYDRSAFFSLVASDEQ YVRFIAQHFPCAPEEEKPPEIDALELKTQKGF ; _entity_poly.pdbx_seq_one_letter_code_can ;GSAMGHMVKISHEDTQRIKTAFLSYAQGQDKVTEAMIDQLICGAFPGLSWEQLQEKKKGRAAANGYDRSAFFSLVASDEQ YVRFIAQHFPCAPEEEKPPEIDALELKTQKGF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 MET n 1 5 GLY n 1 6 HIS n 1 7 MET n 1 8 VAL n 1 9 LYS n 1 10 ILE n 1 11 SER n 1 12 HIS n 1 13 GLU n 1 14 ASP n 1 15 THR n 1 16 GLN n 1 17 ARG n 1 18 ILE n 1 19 LYS n 1 20 THR n 1 21 ALA n 1 22 PHE n 1 23 LEU n 1 24 SER n 1 25 TYR n 1 26 ALA n 1 27 GLN n 1 28 GLY n 1 29 GLN n 1 30 ASP n 1 31 LYS n 1 32 VAL n 1 33 THR n 1 34 GLU n 1 35 ALA n 1 36 MET n 1 37 ILE n 1 38 ASP n 1 39 GLN n 1 40 LEU n 1 41 ILE n 1 42 CYS n 1 43 GLY n 1 44 ALA n 1 45 PHE n 1 46 PRO n 1 47 GLY n 1 48 LEU n 1 49 SER n 1 50 TRP n 1 51 GLU n 1 52 GLN n 1 53 LEU n 1 54 GLN n 1 55 GLU n 1 56 LYS n 1 57 LYS n 1 58 LYS n 1 59 GLY n 1 60 ARG n 1 61 ALA n 1 62 ALA n 1 63 ALA n 1 64 ASN n 1 65 GLY n 1 66 TYR n 1 67 ASP n 1 68 ARG n 1 69 SER n 1 70 ALA n 1 71 PHE n 1 72 PHE n 1 73 SER n 1 74 LEU n 1 75 VAL n 1 76 ALA n 1 77 SER n 1 78 ASP n 1 79 GLU n 1 80 GLN n 1 81 TYR n 1 82 VAL n 1 83 ARG n 1 84 PHE n 1 85 ILE n 1 86 ALA n 1 87 GLN n 1 88 HIS n 1 89 PHE n 1 90 PRO n 1 91 CYS n 1 92 ALA n 1 93 PRO n 1 94 GLU n 1 95 GLU n 1 96 GLU n 1 97 LYS n 1 98 PRO n 1 99 PRO n 1 100 GLU n 1 101 ILE n 1 102 ASP n 1 103 ALA n 1 104 LEU n 1 105 GLU n 1 106 LEU n 1 107 LYS n 1 108 THR n 1 109 GLN n 1 110 LYS n 1 111 GLY n 1 112 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 112 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Tc00.1047053511907.89 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'CL Brener' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Trypanosoma cruzi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5693 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) Star' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-4T2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 PHE 112 112 112 PHE PHE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5KGQ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5KGQ _struct.title 'NMR structure and dynamics of Q4DY78, a conserved kinetoplasid-specific protein from Trypanosoma cruzi' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5KGQ _struct_keywords.text 'hypothetical protein, conserved, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q4DY78_TRYCC _struct_ref.pdbx_db_accession Q4DY78 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVKISHEDTQRIKTAFLSYAQGQDKVTEAMIDQLICGAFPGLSWEQLQEKKKGRAAANGYDRSAFFSLVASDEQYVRFIA QHFPCAPEEEKPPEIDALELKTQKGF ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5KGQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 112 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q4DY78 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 106 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 7 _struct_ref_seq.pdbx_auth_seq_align_end 112 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5KGQ GLY A 1 ? UNP Q4DY78 ? ? 'expression tag' 1 1 1 5KGQ SER A 2 ? UNP Q4DY78 ? ? 'expression tag' 2 2 1 5KGQ ALA A 3 ? UNP Q4DY78 ? ? 'expression tag' 3 3 1 5KGQ MET A 4 ? UNP Q4DY78 ? ? 'expression tag' 4 4 1 5KGQ GLY A 5 ? UNP Q4DY78 ? ? 'expression tag' 5 5 1 5KGQ HIS A 6 ? UNP Q4DY78 ? ? 'expression tag' 6 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 11 ? GLN A 27 ? SER A 11 GLN A 27 1 ? 17 HELX_P HELX_P2 AA2 THR A 33 ? PHE A 45 ? THR A 33 PHE A 45 1 ? 13 HELX_P HELX_P3 AA3 SER A 49 ? LYS A 57 ? SER A 49 LYS A 57 1 ? 9 HELX_P HELX_P4 AA4 ARG A 68 ? ALA A 76 ? ARG A 68 ALA A 76 1 ? 9 HELX_P HELX_P5 AA5 ASP A 78 ? PHE A 89 ? ASP A 78 PHE A 89 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 31 ? VAL A 32 ? LYS A 31 VAL A 32 AA1 2 TYR A 66 ? ASP A 67 ? TYR A 66 ASP A 67 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 32 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 32 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 66 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 66 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 7 HZ2 A LYS 9 ? ? OE2 A GLU 79 ? ? 1.58 2 9 H1 A GLY 1 ? ? OE1 A GLU 105 ? ? 1.56 3 9 OD2 A ASP 67 ? ? HG A SER 69 ? ? 1.59 4 11 O A ILE 85 ? ? H A PHE 89 ? ? 1.60 5 12 HZ2 A LYS 9 ? ? OE2 A GLU 79 ? ? 1.56 6 20 O A THR 20 ? ? HG A SER 24 ? ? 1.59 7 20 HZ2 A LYS 57 ? ? O A ALA 63 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 8 ? ? -144.63 -125.11 2 1 LYS A 9 ? ? -79.72 48.84 3 1 ALA A 62 ? ? 61.15 -87.88 4 1 GLU A 94 ? ? 51.38 15.38 5 1 LYS A 97 ? ? -174.00 79.99 6 1 GLU A 100 ? ? -141.04 -65.67 7 1 ALA A 103 ? ? -142.38 -72.07 8 2 VAL A 8 ? ? -140.51 -110.14 9 2 LYS A 9 ? ? -78.99 41.44 10 2 ALA A 62 ? ? 59.53 -107.74 11 2 ALA A 63 ? ? -94.99 -72.00 12 2 GLU A 100 ? ? 53.03 78.20 13 2 ASP A 102 ? ? 78.62 -14.04 14 2 LEU A 104 ? ? 168.23 -19.82 15 2 THR A 108 ? ? 54.07 -173.70 16 2 GLN A 109 ? ? -169.83 -163.07 17 3 MET A 7 ? ? 64.92 108.82 18 3 VAL A 8 ? ? -106.52 -112.51 19 3 LYS A 9 ? ? -79.00 23.93 20 3 LYS A 58 ? ? -44.29 158.09 21 3 ALA A 62 ? ? 58.42 -93.15 22 3 ALA A 63 ? ? -100.85 -62.91 23 3 GLU A 96 ? ? -147.88 -69.12 24 3 LYS A 97 ? ? -151.05 -45.91 25 3 GLU A 100 ? ? -118.43 -98.15 26 3 LEU A 104 ? ? 71.36 -2.22 27 3 GLU A 105 ? ? 64.87 -169.00 28 3 LEU A 106 ? ? 62.23 -162.77 29 4 ALA A 3 ? ? -116.36 -79.38 30 4 VAL A 8 ? ? -140.85 -138.85 31 4 LYS A 9 ? ? -82.97 37.30 32 4 ALA A 26 ? ? -70.71 -70.15 33 4 GLN A 29 ? ? -75.01 -164.90 34 4 ALA A 62 ? ? 59.14 -101.78 35 4 ALA A 76 ? ? -68.22 5.77 36 4 GLU A 95 ? ? 63.15 161.87 37 4 LYS A 97 ? ? -135.46 -56.83 38 4 GLU A 100 ? ? 42.50 71.07 39 4 ILE A 101 ? ? -97.05 -62.55 40 4 ASP A 102 ? ? -157.35 -49.57 41 4 ALA A 103 ? ? -52.81 -82.01 42 4 LEU A 104 ? ? -144.99 -70.24 43 4 LEU A 106 ? ? 64.87 174.21 44 4 GLN A 109 ? ? 69.89 -77.47 45 5 SER A 2 ? ? -109.50 52.37 46 5 MET A 4 ? ? -155.73 -78.13 47 5 VAL A 8 ? ? -138.04 -118.84 48 5 LYS A 9 ? ? -81.50 49.73 49 5 ALA A 26 ? ? -73.66 -70.61 50 5 GLN A 29 ? ? -74.45 -167.46 51 5 ALA A 44 ? ? -90.19 -63.04 52 5 PRO A 46 ? ? -75.42 -159.28 53 5 ALA A 63 ? ? -84.72 -73.89 54 5 ASN A 64 ? ? -163.96 100.78 55 5 GLU A 95 ? ? -81.41 -70.37 56 5 GLU A 96 ? ? -167.85 70.77 57 5 LYS A 97 ? ? -164.31 -50.63 58 5 GLU A 100 ? ? -159.56 -56.89 59 5 ILE A 101 ? ? -138.91 -34.79 60 5 LYS A 107 ? ? -163.39 -79.52 61 5 THR A 108 ? ? -143.71 43.34 62 6 SER A 2 ? ? 57.36 83.41 63 6 ALA A 3 ? ? 65.34 94.26 64 6 HIS A 6 ? ? -141.25 23.41 65 6 VAL A 8 ? ? -144.93 -63.77 66 6 GLN A 29 ? ? -76.74 -167.63 67 6 ALA A 62 ? ? 52.17 -141.56 68 6 PHE A 89 ? ? -160.38 112.24 69 6 PRO A 90 ? ? -49.67 155.68 70 6 GLU A 100 ? ? -76.94 -89.68 71 6 ILE A 101 ? ? -143.40 -74.04 72 6 ASP A 102 ? ? 174.86 -54.94 73 6 ALA A 103 ? ? -40.54 -76.85 74 6 LEU A 104 ? ? -146.62 -82.33 75 6 LYS A 107 ? ? 172.07 -31.19 76 7 MET A 7 ? ? -142.34 39.13 77 7 VAL A 8 ? ? -172.61 -141.18 78 7 LYS A 9 ? ? -74.00 47.63 79 7 ALA A 26 ? ? -73.21 -71.56 80 7 ARG A 60 ? ? -152.84 42.43 81 7 ALA A 63 ? ? 66.59 -66.61 82 7 GLU A 95 ? ? 74.64 151.89 83 7 PRO A 98 ? ? -47.17 103.19 84 7 GLU A 105 ? ? -152.72 -159.46 85 7 LEU A 106 ? ? -82.27 -74.75 86 7 THR A 108 ? ? 179.66 146.14 87 8 MET A 4 ? ? -145.24 30.24 88 8 VAL A 8 ? ? -142.35 -132.00 89 8 LYS A 9 ? ? -71.11 29.00 90 8 ALA A 26 ? ? -73.58 -70.49 91 8 GLN A 29 ? ? -76.13 -166.24 92 8 ARG A 60 ? ? -152.03 -39.47 93 8 ALA A 62 ? ? -25.95 111.50 94 8 ALA A 63 ? ? 60.84 -83.77 95 8 PRO A 93 ? ? -78.36 27.96 96 8 GLU A 95 ? ? -120.62 -158.11 97 8 LYS A 97 ? ? 59.05 73.65 98 8 GLU A 100 ? ? -152.36 -80.09 99 8 ALA A 103 ? ? -123.47 -147.15 100 8 GLU A 105 ? ? 66.79 -159.12 101 8 LYS A 107 ? ? 69.95 -72.36 102 9 VAL A 8 ? ? -164.97 -141.34 103 9 ALA A 26 ? ? -72.63 -70.38 104 9 GLN A 29 ? ? -77.62 -165.51 105 9 ALA A 63 ? ? 64.83 -66.25 106 9 PHE A 89 ? ? -162.31 111.11 107 9 GLU A 94 ? ? 66.86 120.80 108 9 GLU A 95 ? ? 65.03 -84.26 109 9 GLU A 96 ? ? -169.04 -49.54 110 9 GLU A 100 ? ? -165.07 -63.39 111 9 ILE A 101 ? ? -146.86 -69.95 112 9 ASP A 102 ? ? 161.61 -35.43 113 9 LEU A 104 ? ? 57.53 16.65 114 9 GLU A 105 ? ? 63.28 -87.08 115 9 LEU A 106 ? ? -158.42 -53.74 116 9 LYS A 110 ? ? -97.72 33.19 117 10 MET A 4 ? ? 62.41 71.44 118 10 VAL A 8 ? ? -147.47 -150.64 119 10 LYS A 9 ? ? -74.57 44.19 120 10 ALA A 26 ? ? -73.39 -71.69 121 10 ALA A 62 ? ? 55.49 -138.36 122 10 ASN A 64 ? ? 91.54 130.50 123 10 GLU A 94 ? ? -76.04 43.10 124 10 GLU A 100 ? ? -165.84 -85.93 125 10 ILE A 101 ? ? -142.44 -11.44 126 10 ASP A 102 ? ? 68.39 -57.02 127 10 ALA A 103 ? ? -37.10 -73.98 128 10 LEU A 104 ? ? -102.53 45.31 129 10 GLU A 105 ? ? -79.38 49.45 130 10 LEU A 106 ? ? 173.63 -70.73 131 10 LYS A 107 ? ? 60.41 -80.51 132 11 HIS A 6 ? ? 74.68 140.96 133 11 VAL A 8 ? ? -155.54 -105.53 134 11 LYS A 9 ? ? -78.85 47.56 135 11 ALA A 26 ? ? -75.38 -71.16 136 11 ASN A 64 ? ? 76.66 98.68 137 11 PRO A 93 ? ? -80.58 41.72 138 11 GLU A 95 ? ? -75.27 -81.51 139 11 GLU A 100 ? ? -133.29 -79.58 140 11 ASP A 102 ? ? -165.99 -48.09 141 11 LEU A 104 ? ? 76.54 -37.46 142 11 GLU A 105 ? ? 60.74 -76.13 143 12 MET A 4 ? ? 62.51 -179.68 144 12 VAL A 8 ? ? -145.94 -70.42 145 12 ALA A 26 ? ? -74.42 -71.10 146 12 PRO A 46 ? ? -75.84 -164.14 147 12 ARG A 60 ? ? -142.37 38.09 148 12 ALA A 61 ? ? 175.42 33.09 149 12 ASN A 64 ? ? 73.53 89.86 150 12 ALA A 103 ? ? -18.74 -73.89 151 13 ALA A 3 ? ? -94.42 54.52 152 13 HIS A 6 ? ? -152.51 46.57 153 13 VAL A 8 ? ? -160.95 -55.66 154 13 ALA A 26 ? ? -75.07 -70.24 155 13 ALA A 62 ? ? 67.83 -67.59 156 13 ALA A 63 ? ? -137.65 -59.70 157 13 GLU A 96 ? ? -102.49 43.37 158 13 LYS A 97 ? ? 77.39 101.76 159 13 GLU A 100 ? ? -161.56 -83.59 160 13 LYS A 107 ? ? 47.64 70.64 161 14 ARG A 60 ? ? -152.33 -37.60 162 14 ALA A 62 ? ? 57.80 -144.71 163 14 ASN A 64 ? ? 82.45 123.99 164 14 PHE A 89 ? ? -167.59 113.56 165 14 GLU A 95 ? ? -55.64 -72.08 166 14 GLU A 96 ? ? -105.56 -83.96 167 14 GLU A 100 ? ? -166.78 -55.15 168 14 ALA A 103 ? ? -142.11 -72.18 169 14 LEU A 106 ? ? 67.74 158.75 170 15 ALA A 3 ? ? -142.14 15.57 171 15 MET A 7 ? ? 66.71 98.30 172 15 VAL A 8 ? ? -98.09 -101.01 173 15 ALA A 26 ? ? -73.61 -70.31 174 15 GLN A 29 ? ? -74.83 -168.46 175 15 LYS A 58 ? ? -43.60 152.47 176 15 ALA A 63 ? ? -87.81 38.00 177 15 ASN A 64 ? ? 68.77 91.83 178 15 PHE A 89 ? ? -160.21 109.40 179 15 GLU A 100 ? ? -92.56 55.51 180 15 ALA A 103 ? ? -127.64 -89.99 181 16 MET A 4 ? ? -105.89 45.18 182 16 VAL A 8 ? ? -140.38 -82.42 183 16 LYS A 9 ? ? -114.54 51.79 184 16 ALA A 61 ? ? -158.63 43.38 185 16 ALA A 63 ? ? -108.62 -83.89 186 16 LYS A 97 ? ? -138.31 -48.76 187 16 GLU A 100 ? ? -73.80 -74.74 188 16 ILE A 101 ? ? -154.79 -28.56 189 16 ASP A 102 ? ? 75.23 -0.47 190 16 THR A 108 ? ? -164.65 -20.99 191 16 LYS A 110 ? ? -91.45 44.22 192 17 VAL A 8 ? ? -126.66 -101.30 193 17 LYS A 9 ? ? -83.93 39.18 194 17 ALA A 26 ? ? -73.53 -71.12 195 17 GLN A 29 ? ? -74.54 -165.18 196 17 ARG A 60 ? ? -150.94 42.75 197 17 ALA A 63 ? ? 69.99 -59.01 198 17 ALA A 76 ? ? -69.14 0.66 199 17 GLU A 94 ? ? -65.50 -70.52 200 17 GLU A 95 ? ? 67.78 160.60 201 17 PRO A 99 ? ? -49.79 155.87 202 17 ILE A 101 ? ? -150.03 -78.66 203 17 ASP A 102 ? ? 158.13 -49.12 204 17 ALA A 103 ? ? -55.14 -72.28 205 17 LEU A 106 ? ? 63.75 67.40 206 17 THR A 108 ? ? -142.86 49.16 207 17 LYS A 110 ? ? 68.49 -72.24 208 18 SER A 2 ? ? -146.58 42.08 209 18 VAL A 8 ? ? -132.56 -123.52 210 18 LYS A 9 ? ? -81.27 45.98 211 18 ALA A 26 ? ? -73.39 -70.46 212 18 GLN A 29 ? ? -76.61 -165.04 213 18 ALA A 61 ? ? -149.46 23.50 214 18 ASN A 64 ? ? 70.26 93.22 215 18 GLU A 96 ? ? -109.51 -63.86 216 18 LYS A 97 ? ? -172.78 -52.66 217 18 PRO A 99 ? ? -65.20 -140.94 218 18 ILE A 101 ? ? -97.88 -64.33 219 18 ASP A 102 ? ? 173.96 -54.99 220 18 ALA A 103 ? ? -42.45 -73.04 221 18 GLU A 105 ? ? 34.06 -119.83 222 18 LEU A 106 ? ? -141.91 -83.12 223 18 THR A 108 ? ? 49.09 -156.37 224 19 SER A 2 ? ? -120.55 -55.13 225 19 MET A 7 ? ? 65.49 -94.54 226 19 VAL A 8 ? ? -168.46 -125.64 227 19 LYS A 9 ? ? -73.70 39.34 228 19 LYS A 58 ? ? -63.10 21.61 229 19 ALA A 62 ? ? 61.58 -142.19 230 19 GLU A 105 ? ? 58.51 -97.56 231 20 VAL A 8 ? ? -123.30 -51.89 232 20 LYS A 9 ? ? -144.73 45.45 233 20 ALA A 26 ? ? -73.82 -70.76 234 20 GLN A 29 ? ? -78.13 -169.14 235 20 ARG A 60 ? ? -150.14 54.54 236 20 ALA A 63 ? ? 66.79 -63.55 237 20 GLU A 95 ? ? -78.43 29.99 238 20 LYS A 97 ? ? -131.74 -52.44 239 20 GLU A 100 ? ? -79.86 -88.05 240 20 ILE A 101 ? ? -145.03 46.32 # _pdbx_nmr_ensemble.entry_id 5KGQ _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5KGQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.4 mM Unlabeled Q4DY78, 90% H2O/10% D2O' '90% H2O/10% D2O' Unlabeled solution 'Unlabeled, 0.4 mM, PBS buffer (10 mM Na2HPO4, 1.8 mM KH2PO4, 140 mM NaCl, 2.7 mM KCl), pH 7.4, added 10 mM DTT' 2 '0.3 mM [U-100% 15N] Q4DY78, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N labeled' solution '15N labeled, 0.3 mM, PBS buffer (10 mM Na2HPO4, 1.8 mM KH2PO4, 140 mM NaCl, 2.7 mM KCl), pH 7.4, added 10 mM DTT' 3 '0.8 mM [U-100% 13C; U-100% 15N] Q4DY78, 90% H2O/10% D2O' '90% H2O/10% D2O' '13C, 15N double-labeled' solution '13C, 15N double-labeled, 0.8 mM, in PBS buffer (10 mM Na2HPO4, 1.8 mM KH2PO4, 140 mM NaCl, 2.7 mM KCl), pH 7.4, added 10 mM DTT' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Q4DY78 0.4 ? mM Unlabeled 2 Q4DY78 0.3 ? mM '[U-100% 15N]' 3 Q4DY78 0.8 ? mM '[U-100% 13C; U-100% 15N]' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 7.4 '10 mM Na2HPO4, 1.8 mM KH2PO4, 140 mM NaCl, 2.7 mM KCl' 'Unlabeled, 0.4 mM, PBS buffer (10 mM Na2HPO4, 1.8 mM KH2PO4, 140 mM NaCl, 2.7 mM KCl), pH 7.4, added 10 mM DTT' ? mM unlabeled ? pH ? ? K 2 298 atm 1 7.4 '10 mM Na2HPO4, 1.8 mM KH2PO4, 140 mM NaCl, 2.7 mM KCl' '15N labeled, 0.3 mM, PBS buffer (10 mM Na2HPO4, 1.8 mM KH2PO4, 140 mM NaCl, 2.7 mM KCl), pH 7.4, added 10 mM DTT' ? mM '15N labeled' ? pH ? ? K 3 298 atm 1 7.4 '10 mM Na2HPO4, 1.8 mM KH2PO4, 140 mM NaCl, 2.7 mM KCl' '13C, 15N double-labeled, 0.8 mM, in PBS buffer (10 mM Na2HPO4, 1.8 mM KH2PO4, 140 mM NaCl, 2.7 mM KCl), pH 7.4, added 10 mM DTT' ? mM '13C, 15N double-labeled' ? pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 2 2 '2D 1H-15N HSQC' 1 isotropic 2 3 3 '2D 1H-13C HSQC' 2 isotropic 3 1 1 '2D 1H-1H TOCSY' 1 isotropic 4 1 1 '2D 1H-1H NOESY' 1 isotropic 5 3 3 '3D CBCA(CO)NH' 2 isotropic 6 3 3 '3D HNCACB' 2 isotropic 7 2 2 '3D HBHA(CO)NH' 1 isotropic 8 2 2 '3D 1H-15N TOCSY' 1 isotropic 9 3 3 '3D HCCH-COSY' 1 isotropic 10 3 3 '3D HCCH-TOCSY' 2 isotropic 11 3 3 '3D HNCO' 1 isotropic 12 2 2 '3D 1H-15N NOESY' 2 isotropic 13 3 3 '3D 1H-13C NOESY' 2 isotropic # _pdbx_nmr_refine.entry_id 5KGQ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;structures are based on a total of 2387 restraints, 2171 are NOE-derived distance constraints, 144 dihedral angle restraints, 72 distance restraints from hydrogen bonds ; _pdbx_nmr_refine.software_ordinal 6 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 3.1 'Bruker Biospin' 2 processing TopSpin 3.1 'Bruker Biospin' 3 'peak picking' Sparky 3.114 Goddard 4 'chemical shift assignment' Sparky 3.114 Goddard 5 'structure calculation' ARIA 2.3 ;Linge, O'Donoghue and Nilges ; 6 refinement CNS 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Brazilian National Council for Scientific and Technological Development (CNPq)' Brazil 141688/2011-4 1 CAPES Brazil 99999.011648/2013-09 2 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 800 'Triple resonance probe' 2 'AVANCE III' ? Bruker 600 'Triple resonance cryoprobe' # _atom_sites.entry_id 5KGQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_