data_5L1A # _entry.id 5L1A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5L1A pdb_00005l1a 10.2210/pdb5l1a/pdb WWPDB D_1000223046 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-08-10 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2019-12-25 4 'Structure model' 1 3 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_struct_oper_list 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 3 'Structure model' '_pdbx_audit_support.funding_organization' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5L1A _pdbx_database_status.recvd_initial_deposition_date 2016-07-28 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id MCSG-APC108157 _pdbx_database_related.db_name TargetTrack _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chang, C.' 1 'Xu, X.' 2 'Cui, H.' 3 'Yim, V.' 4 'Savchenko, A.' 5 'Joachimiak, A.' 6 'Midwest Center for Structural Genomics (MCSG)' 7 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of uncharacterized protein LPG2271 from Legionella pneumophila' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chang, C.' 1 ? primary 'Xu, X.' 2 ? primary 'Cui, H.' 3 ? primary 'Yim, V.' 4 ? primary 'Savchenko, A.' 5 ? primary 'Joachimiak, A.' 6 ? primary 'Midwest Center for Structural Genomics (MCSG)' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein' 12885.265 1 ? ? 'UNP residues 1-110' ? 2 non-polymer syn '5-amino-2,4,6-triiodobenzene-1,3-dicarboxylic acid' 558.835 5 ? ? ? ? 3 water nat water 18.015 65 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name LPG2271 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AMPSYNNARLLEKRLQNCDTQLNQFFNGQELSIKFLQQLNQIKYFYNSAFNKTENEDDGLEVVEEYENFISLVSQVKSGQ INADKAFETIKDTTESRQADVIIANFFKVCE ; _entity_poly.pdbx_seq_one_letter_code_can ;AMPSYNNARLLEKRLQNCDTQLNQFFNGQELSIKFLQQLNQIKYFYNSAFNKTENEDDGLEVVEEYENFISLVSQVKSGQ INADKAFETIKDTTESRQADVIIANFFKVCE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MCSG-APC108157 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-amino-2,4,6-triiodobenzene-1,3-dicarboxylic acid' I3C 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 MET n 1 3 PRO n 1 4 SER n 1 5 TYR n 1 6 ASN n 1 7 ASN n 1 8 ALA n 1 9 ARG n 1 10 LEU n 1 11 LEU n 1 12 GLU n 1 13 LYS n 1 14 ARG n 1 15 LEU n 1 16 GLN n 1 17 ASN n 1 18 CYS n 1 19 ASP n 1 20 THR n 1 21 GLN n 1 22 LEU n 1 23 ASN n 1 24 GLN n 1 25 PHE n 1 26 PHE n 1 27 ASN n 1 28 GLY n 1 29 GLN n 1 30 GLU n 1 31 LEU n 1 32 SER n 1 33 ILE n 1 34 LYS n 1 35 PHE n 1 36 LEU n 1 37 GLN n 1 38 GLN n 1 39 LEU n 1 40 ASN n 1 41 GLN n 1 42 ILE n 1 43 LYS n 1 44 TYR n 1 45 PHE n 1 46 TYR n 1 47 ASN n 1 48 SER n 1 49 ALA n 1 50 PHE n 1 51 ASN n 1 52 LYS n 1 53 THR n 1 54 GLU n 1 55 ASN n 1 56 GLU n 1 57 ASP n 1 58 ASP n 1 59 GLY n 1 60 LEU n 1 61 GLU n 1 62 VAL n 1 63 VAL n 1 64 GLU n 1 65 GLU n 1 66 TYR n 1 67 GLU n 1 68 ASN n 1 69 PHE n 1 70 ILE n 1 71 SER n 1 72 LEU n 1 73 VAL n 1 74 SER n 1 75 GLN n 1 76 VAL n 1 77 LYS n 1 78 SER n 1 79 GLY n 1 80 GLN n 1 81 ILE n 1 82 ASN n 1 83 ALA n 1 84 ASP n 1 85 LYS n 1 86 ALA n 1 87 PHE n 1 88 GLU n 1 89 THR n 1 90 ILE n 1 91 LYS n 1 92 ASP n 1 93 THR n 1 94 THR n 1 95 GLU n 1 96 SER n 1 97 ARG n 1 98 GLN n 1 99 ALA n 1 100 ASP n 1 101 VAL n 1 102 ILE n 1 103 ILE n 1 104 ALA n 1 105 ASN n 1 106 PHE n 1 107 PHE n 1 108 LYS n 1 109 VAL n 1 110 CYS n 1 111 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 111 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene lpg2271 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Philadelphia 1 / ATCC 33152 / DSM 7513' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272624 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'p15Tv lic' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 I3C non-polymer . '5-amino-2,4,6-triiodobenzene-1,3-dicarboxylic acid' '5-Amino-2,4,6-triiodoisophthalic acid' 'C8 H4 I3 N O4' 558.835 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 0 0 ALA ALA A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 PRO 3 2 2 PRO PRO A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 TYR 5 4 4 TYR TYR A . n A 1 6 ASN 6 5 5 ASN ASN A . n A 1 7 ASN 7 6 6 ASN ASN A . n A 1 8 ALA 8 7 7 ALA ALA A . n A 1 9 ARG 9 8 8 ARG ARG A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 LEU 11 10 10 LEU LEU A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 LYS 13 12 12 LYS LYS A . n A 1 14 ARG 14 13 13 ARG ARG A . n A 1 15 LEU 15 14 14 LEU LEU A . n A 1 16 GLN 16 15 15 GLN GLN A . n A 1 17 ASN 17 16 16 ASN ASN A . n A 1 18 CYS 18 17 17 CYS CYS A . n A 1 19 ASP 19 18 18 ASP ASP A . n A 1 20 THR 20 19 19 THR THR A . n A 1 21 GLN 21 20 20 GLN GLN A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 ASN 23 22 22 ASN ASN A . n A 1 24 GLN 24 23 23 GLN GLN A . n A 1 25 PHE 25 24 24 PHE PHE A . n A 1 26 PHE 26 25 25 PHE PHE A . n A 1 27 ASN 27 26 26 ASN ASN A . n A 1 28 GLY 28 27 ? ? ? A . n A 1 29 GLN 29 28 ? ? ? A . n A 1 30 GLU 30 29 ? ? ? A . n A 1 31 LEU 31 30 30 LEU LEU A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 ILE 33 32 32 ILE ILE A . n A 1 34 LYS 34 33 33 LYS LYS A . n A 1 35 PHE 35 34 34 PHE PHE A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 GLN 37 36 36 GLN GLN A . n A 1 38 GLN 38 37 37 GLN GLN A . n A 1 39 LEU 39 38 38 LEU LEU A . n A 1 40 ASN 40 39 39 ASN ASN A . n A 1 41 GLN 41 40 40 GLN GLN A . n A 1 42 ILE 42 41 41 ILE ILE A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 TYR 44 43 43 TYR TYR A . n A 1 45 PHE 45 44 44 PHE PHE A . n A 1 46 TYR 46 45 45 TYR TYR A . n A 1 47 ASN 47 46 46 ASN ASN A . n A 1 48 SER 48 47 47 SER SER A . n A 1 49 ALA 49 48 48 ALA ALA A . n A 1 50 PHE 50 49 49 PHE PHE A . n A 1 51 ASN 51 50 50 ASN ASN A . n A 1 52 LYS 52 51 51 LYS LYS A . n A 1 53 THR 53 52 52 THR THR A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 ASN 55 54 54 ASN ASN A . n A 1 56 GLU 56 55 55 GLU GLU A . n A 1 57 ASP 57 56 56 ASP ASP A . n A 1 58 ASP 58 57 57 ASP ASP A . n A 1 59 GLY 59 58 58 GLY GLY A . n A 1 60 LEU 60 59 59 LEU LEU A . n A 1 61 GLU 61 60 60 GLU GLU A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 VAL 63 62 62 VAL VAL A . n A 1 64 GLU 64 63 63 GLU GLU A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 TYR 66 65 65 TYR TYR A . n A 1 67 GLU 67 66 66 GLU GLU A . n A 1 68 ASN 68 67 67 ASN ASN A . n A 1 69 PHE 69 68 68 PHE PHE A . n A 1 70 ILE 70 69 69 ILE ILE A . n A 1 71 SER 71 70 70 SER SER A . n A 1 72 LEU 72 71 71 LEU LEU A . n A 1 73 VAL 73 72 72 VAL VAL A . n A 1 74 SER 74 73 73 SER SER A . n A 1 75 GLN 75 74 74 GLN GLN A . n A 1 76 VAL 76 75 75 VAL VAL A . n A 1 77 LYS 77 76 76 LYS LYS A . n A 1 78 SER 78 77 77 SER SER A . n A 1 79 GLY 79 78 78 GLY GLY A . n A 1 80 GLN 80 79 79 GLN GLN A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 ASN 82 81 81 ASN ASN A . n A 1 83 ALA 83 82 82 ALA ALA A . n A 1 84 ASP 84 83 83 ASP ASP A . n A 1 85 LYS 85 84 84 LYS LYS A . n A 1 86 ALA 86 85 85 ALA ALA A . n A 1 87 PHE 87 86 86 PHE PHE A . n A 1 88 GLU 88 87 87 GLU GLU A . n A 1 89 THR 89 88 88 THR THR A . n A 1 90 ILE 90 89 89 ILE ILE A . n A 1 91 LYS 91 90 90 LYS LYS A . n A 1 92 ASP 92 91 91 ASP ASP A . n A 1 93 THR 93 92 92 THR THR A . n A 1 94 THR 94 93 93 THR THR A . n A 1 95 GLU 95 94 94 GLU GLU A . n A 1 96 SER 96 95 95 SER SER A . n A 1 97 ARG 97 96 96 ARG ARG A . n A 1 98 GLN 98 97 97 GLN GLN A . n A 1 99 ALA 99 98 98 ALA ALA A . n A 1 100 ASP 100 99 99 ASP ASP A . n A 1 101 VAL 101 100 100 VAL VAL A . n A 1 102 ILE 102 101 101 ILE ILE A . n A 1 103 ILE 103 102 102 ILE ILE A . n A 1 104 ALA 104 103 103 ALA ALA A . n A 1 105 ASN 105 104 104 ASN ASN A . n A 1 106 PHE 106 105 105 PHE PHE A . n A 1 107 PHE 107 106 106 PHE PHE A . n A 1 108 LYS 108 107 107 LYS LYS A . n A 1 109 VAL 109 108 108 VAL VAL A . n A 1 110 CYS 110 109 109 CYS CYS A . n A 1 111 GLU 111 110 110 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 I3C 1 201 201 I3C I3C A . C 2 I3C 1 202 202 I3C I3C A . D 2 I3C 1 203 203 I3C I3C A . E 2 I3C 1 204 204 I3C I3C A . F 2 I3C 1 205 205 I3C I3C A . G 3 HOH 1 301 11 HOH HOH A . G 3 HOH 2 302 53 HOH HOH A . G 3 HOH 3 303 5 HOH HOH A . G 3 HOH 4 304 14 HOH HOH A . G 3 HOH 5 305 18 HOH HOH A . G 3 HOH 6 306 3 HOH HOH A . G 3 HOH 7 307 9 HOH HOH A . G 3 HOH 8 308 23 HOH HOH A . G 3 HOH 9 309 35 HOH HOH A . G 3 HOH 10 310 39 HOH HOH A . G 3 HOH 11 311 61 HOH HOH A . G 3 HOH 12 312 6 HOH HOH A . G 3 HOH 13 313 46 HOH HOH A . G 3 HOH 14 314 2 HOH HOH A . G 3 HOH 15 315 57 HOH HOH A . G 3 HOH 16 316 54 HOH HOH A . G 3 HOH 17 317 59 HOH HOH A . G 3 HOH 18 318 26 HOH HOH A . G 3 HOH 19 319 19 HOH HOH A . G 3 HOH 20 320 28 HOH HOH A . G 3 HOH 21 321 41 HOH HOH A . G 3 HOH 22 322 24 HOH HOH A . G 3 HOH 23 323 20 HOH HOH A . G 3 HOH 24 324 15 HOH HOH A . G 3 HOH 25 325 48 HOH HOH A . G 3 HOH 26 326 29 HOH HOH A . G 3 HOH 27 327 4 HOH HOH A . G 3 HOH 28 328 37 HOH HOH A . G 3 HOH 29 329 22 HOH HOH A . G 3 HOH 30 330 62 HOH HOH A . G 3 HOH 31 331 50 HOH HOH A . G 3 HOH 32 332 34 HOH HOH A . G 3 HOH 33 333 31 HOH HOH A . G 3 HOH 34 334 43 HOH HOH A . G 3 HOH 35 335 65 HOH HOH A . G 3 HOH 36 336 42 HOH HOH A . G 3 HOH 37 337 33 HOH HOH A . G 3 HOH 38 338 16 HOH HOH A . G 3 HOH 39 339 17 HOH HOH A . G 3 HOH 40 340 51 HOH HOH A . G 3 HOH 41 341 40 HOH HOH A . G 3 HOH 42 342 21 HOH HOH A . G 3 HOH 43 343 49 HOH HOH A . G 3 HOH 44 344 58 HOH HOH A . G 3 HOH 45 345 38 HOH HOH A . G 3 HOH 46 346 44 HOH HOH A . G 3 HOH 47 347 45 HOH HOH A . G 3 HOH 48 348 55 HOH HOH A . G 3 HOH 49 349 1 HOH HOH A . G 3 HOH 50 350 30 HOH HOH A . G 3 HOH 51 351 8 HOH HOH A . G 3 HOH 52 352 60 HOH HOH A . G 3 HOH 53 353 32 HOH HOH A . G 3 HOH 54 354 27 HOH HOH A . G 3 HOH 55 355 12 HOH HOH A . G 3 HOH 56 356 7 HOH HOH A . G 3 HOH 57 357 64 HOH HOH A . G 3 HOH 58 358 36 HOH HOH A . G 3 HOH 59 359 56 HOH HOH A . G 3 HOH 60 360 47 HOH HOH A . G 3 HOH 61 361 63 HOH HOH A . G 3 HOH 62 362 52 HOH HOH A . G 3 HOH 63 363 25 HOH HOH A . G 3 HOH 64 364 13 HOH HOH A . G 3 HOH 65 365 10 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 110 ? CG ? A GLU 111 CG 2 1 Y 1 A GLU 110 ? CD ? A GLU 111 CD 3 1 Y 1 A GLU 110 ? OE1 ? A GLU 111 OE1 4 1 Y 1 A GLU 110 ? OE2 ? A GLU 111 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_2386 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5L1A _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.154 _cell.length_a_esd ? _cell.length_b 44.657 _cell.length_b_esd ? _cell.length_c 54.136 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5L1A _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5L1A _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.94 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 3.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Citric acid, 25% PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-08-15 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111) double crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.7712 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.7712 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 20.240 _reflns.entry_id 5L1A _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.400 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4158 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.800 _reflns.pdbx_Rmerge_I_obs 0.097 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 15.524 _reflns.pdbx_netI_over_sigmaI 15.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.791 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 24051 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.400 2.440 ? ? ? ? ? ? ? 80.900 ? ? ? ? 0.196 ? ? ? ? ? ? ? ? 3.100 ? ? ? ? ? ? ? 1 1 ? ? 2.440 2.490 ? ? ? ? ? ? ? 87.300 ? ? ? ? 0.179 ? ? ? ? ? ? ? ? 3.500 ? ? ? ? ? ? ? 2 1 ? ? 2.490 2.530 ? ? ? ? ? ? ? 96.200 ? ? ? ? 0.159 ? ? ? ? ? ? ? ? 3.900 ? ? ? ? ? ? ? 3 1 ? ? 2.530 2.590 ? ? ? ? ? ? ? 98.500 ? ? ? ? 0.142 ? ? ? ? ? ? ? ? 4.800 ? ? ? ? ? ? ? 4 1 ? ? 2.590 2.640 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.137 ? ? ? ? ? ? ? ? 5.200 ? ? ? ? ? ? ? 5 1 ? ? 2.640 2.700 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.123 ? ? ? ? ? ? ? ? 5.900 ? ? ? ? ? ? ? 6 1 ? ? 2.700 2.770 ? ? ? ? ? ? ? 99.500 ? ? ? ? 0.120 ? ? ? ? ? ? ? ? 6.200 ? ? ? ? ? ? ? 7 1 ? ? 2.770 2.850 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 6.300 ? ? ? ? ? ? ? 8 1 ? ? 2.850 2.930 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.109 ? ? ? ? ? ? ? ? 6.500 ? ? ? ? ? ? ? 9 1 ? ? 2.930 3.020 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 6.300 ? ? ? ? ? ? ? 10 1 ? ? 3.020 3.130 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.101 ? ? ? ? ? ? ? ? 6.500 ? ? ? ? ? ? ? 11 1 ? ? 3.130 3.260 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 6.300 ? ? ? ? ? ? ? 12 1 ? ? 3.260 3.410 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.096 ? ? ? ? ? ? ? ? 6.500 ? ? ? ? ? ? ? 13 1 ? ? 3.410 3.580 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.090 ? ? ? ? ? ? ? ? 6.400 ? ? ? ? ? ? ? 14 1 ? ? 3.580 3.810 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 6.200 ? ? ? ? ? ? ? 15 1 ? ? 3.810 4.100 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 6.500 ? ? ? ? ? ? ? 16 1 ? ? 4.100 4.520 ? ? ? ? ? ? ? 99.500 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 6.500 ? ? ? ? ? ? ? 17 1 ? ? 4.520 5.170 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 6.300 ? ? ? ? ? ? ? 18 1 ? ? 5.170 6.510 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? 6.200 ? ? ? ? ? ? ? 19 1 ? ? 6.510 50.000 ? ? ? ? ? ? ? 98.400 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 5.500 ? ? ? ? ? ? ? 20 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 93.500 _refine.B_iso_mean 21.4159 _refine.B_iso_min 4.680 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5L1A _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4 _refine.ls_d_res_low 34.4490 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7314 _refine.ls_number_reflns_R_free 333 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.6700 _refine.ls_percent_reflns_R_free 4.5500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1937 _refine.ls_R_factor_R_free 0.2464 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1915 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.480 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.4900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.4 _refine_hist.d_res_low 34.4490 _refine_hist.pdbx_number_atoms_ligand 80 _refine_hist.number_atoms_solvent 65 _refine_hist.number_atoms_total 1025 _refine_hist.pdbx_number_residues_total 108 _refine_hist.pdbx_B_iso_mean_ligand 47.71 _refine_hist.pdbx_B_iso_mean_solvent 30.17 _refine_hist.pdbx_number_atoms_protein 880 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 972 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.515 ? 1320 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.033 ? 133 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 174 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.818 ? 553 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3972 3.0199 3542 . 198 3344 94.0000 . . . 0.2523 . 0.1983 . . . . . . 2 . . . 'X-RAY DIFFRACTION' 3.0199 34.4524 3772 . 135 3637 100.0000 . . . 0.2416 . 0.1880 . . . . . . 2 . . . # _struct.entry_id 5L1A _struct.title 'Crystal structure of uncharacterized protein LPG2271 from Legionella pneumophila' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5L1A _struct_keywords.text 'Structural Genomics, Midwest Center for Structural Genomics, MCSG, PSI-Biology, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5ZT91_LEGPH _struct_ref.pdbx_db_accession Q5ZT91 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPSYNNARLLEKRLQNCDTQLNQFFNGQELSIKFLQQLNQIKYFYNSAFNKTENEDDGLEVVEEYENFISLVSQVKSGQI NADKAFETIKDTTESRQADVIIANFFKVCE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5L1A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 111 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5ZT91 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 110 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 110 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5L1A _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q5ZT91 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 7 ? PHE A 26 ? ASN A 6 PHE A 25 1 ? 20 HELX_P HELX_P2 AA2 SER A 32 ? LYS A 52 ? SER A 31 LYS A 51 1 ? 21 HELX_P HELX_P3 AA3 ASN A 55 ? SER A 78 ? ASN A 54 SER A 77 1 ? 24 HELX_P HELX_P4 AA4 ASN A 82 ? LYS A 91 ? ASN A 81 LYS A 90 1 ? 10 HELX_P HELX_P5 AA5 SER A 96 ? GLU A 111 ? SER A 95 GLU A 110 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A I3C 201 ? 10 'binding site for residue I3C A 201' AC2 Software A I3C 202 ? 12 'binding site for residue I3C A 202' AC3 Software A I3C 203 ? 9 'binding site for residue I3C A 203' AC4 Software A I3C 204 ? 8 'binding site for residue I3C A 204' AC5 Software A I3C 205 ? 4 'binding site for residue I3C A 205' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 LEU A 10 ? LEU A 9 . ? 4_565 ? 2 AC1 10 ASN A 17 ? ASN A 16 . ? 4_565 ? 3 AC1 10 LYS A 34 ? LYS A 33 . ? 2_574 ? 4 AC1 10 GLU A 61 ? GLU A 60 . ? 1_555 ? 5 AC1 10 GLU A 65 ? GLU A 64 . ? 1_555 ? 6 AC1 10 THR A 89 ? THR A 88 . ? 1_555 ? 7 AC1 10 ILE A 90 ? ILE A 89 . ? 1_555 ? 8 AC1 10 THR A 93 ? THR A 92 . ? 1_555 ? 9 AC1 10 I3C C . ? I3C A 202 . ? 1_555 ? 10 AC1 10 HOH G . ? HOH A 306 . ? 1_555 ? 11 AC2 12 ARG A 14 ? ARG A 13 . ? 4_565 ? 12 AC2 12 ASN A 17 ? ASN A 16 . ? 4_565 ? 13 AC2 12 CYS A 18 ? CYS A 17 . ? 4_565 ? 14 AC2 12 GLN A 21 ? GLN A 20 . ? 4_565 ? 15 AC2 12 LYS A 34 ? LYS A 33 . ? 2_574 ? 16 AC2 12 GLN A 37 ? GLN A 36 . ? 2_574 ? 17 AC2 12 GLN A 38 ? GLN A 37 . ? 2_574 ? 18 AC2 12 GLN A 41 ? GLN A 40 . ? 2_574 ? 19 AC2 12 GLU A 67 ? GLU A 66 . ? 4_565 ? 20 AC2 12 I3C B . ? I3C A 201 . ? 1_555 ? 21 AC2 12 HOH G . ? HOH A 302 . ? 1_555 ? 22 AC2 12 HOH G . ? HOH A 308 . ? 1_555 ? 23 AC3 9 ASN A 55 ? ASN A 54 . ? 2_575 ? 24 AC3 9 ASP A 57 ? ASP A 56 . ? 2_575 ? 25 AC3 9 LYS A 85 ? LYS A 84 . ? 3_655 ? 26 AC3 9 PHE A 87 ? PHE A 86 . ? 1_555 ? 27 AC3 9 ASP A 100 ? ASP A 99 . ? 1_555 ? 28 AC3 9 I3C F . ? I3C A 205 . ? 3_655 ? 29 AC3 9 HOH G . ? HOH A 304 . ? 1_555 ? 30 AC3 9 HOH G . ? HOH A 325 . ? 1_555 ? 31 AC3 9 HOH G . ? HOH A 335 . ? 1_555 ? 32 AC4 8 LYS A 34 ? LYS A 33 . ? 2_574 ? 33 AC4 8 ALA A 49 ? ALA A 48 . ? 1_555 ? 34 AC4 8 GLU A 65 ? GLU A 64 . ? 1_555 ? 35 AC4 8 GLU A 95 ? GLU A 94 . ? 1_555 ? 36 AC4 8 VAL A 109 ? VAL A 108 . ? 2_574 ? 37 AC4 8 HOH G . ? HOH A 305 . ? 1_555 ? 38 AC4 8 HOH G . ? HOH A 320 . ? 1_555 ? 39 AC4 8 HOH G . ? HOH A 322 . ? 1_555 ? 40 AC5 4 GLY A 79 ? GLY A 78 . ? 1_555 ? 41 AC5 4 ASN A 82 ? ASN A 81 . ? 1_555 ? 42 AC5 4 ARG A 97 ? ARG A 96 . ? 3_645 ? 43 AC5 4 I3C D . ? I3C A 203 . ? 3_645 ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id PHE _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 25 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -110.33 _pdbx_validate_torsion.psi 79.29 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -7.0048 41.0461 6.4535 0.1594 0.1302 0.2472 0.0080 0.0579 -0.0282 1.0765 0.5778 6.1746 0.3732 1.4535 -0.2209 -0.0248 -0.1019 0.1733 -0.0968 0.1850 0.1748 0.1560 -0.1563 -0.4542 'X-RAY DIFFRACTION' 2 ? refined 1.5301 42.3246 6.9383 0.1080 0.0999 0.1249 -0.0173 0.0014 0.0215 1.5446 0.8597 2.1934 -0.1574 1.0040 0.0975 -0.0761 -0.0340 0.0769 0.0889 0.0568 -0.0026 0.0150 -0.1834 0.1654 'X-RAY DIFFRACTION' 3 ? refined 13.2244 34.9088 9.8577 0.1500 0.1158 0.1765 0.0288 -0.0041 0.0001 1.2460 2.9152 3.0848 1.0176 -0.9861 -1.7837 0.0120 -0.1328 0.1611 -0.0738 -0.0812 -0.2212 -0.2769 -0.0019 0.3891 'X-RAY DIFFRACTION' 4 ? refined 11.4153 42.8013 13.5723 0.1028 0.2041 0.1952 -0.0019 -0.0475 -0.0188 7.2367 6.4676 3.7608 1.4900 -1.6785 1.0596 -0.2581 0.0549 0.0948 0.1523 0.4990 -0.4895 0.1868 -0.3608 0.2828 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 0 A 31 ;chain 'A' and (resid 0 through 31 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 32 A 76 ;chain 'A' and (resid 32 through 76 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 77 A 95 ;chain 'A' and (resid 77 through 95 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 96 A 110 ;chain 'A' and (resid 96 through 110 ) ; ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 27 ? A GLY 28 2 1 Y 1 A GLN 28 ? A GLN 29 3 1 Y 1 A GLU 29 ? A GLU 30 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HOH O O N N 137 HOH H1 H N N 138 HOH H2 H N N 139 I3C I3 I N N 140 I3C I2 I N N 141 I3C I1 I N N 142 I3C O8 O N N 143 I3C O9 O N N 144 I3C C10 C N N 145 I3C N13 N N N 146 I3C C1 C Y N 147 I3C C6 C Y N 148 I3C C5 C Y N 149 I3C C4 C Y N 150 I3C C3 C Y N 151 I3C C2 C Y N 152 I3C C7 C N N 153 I3C O11 O N N 154 I3C O12 O N N 155 I3C HO9 H N N 156 I3C HN13 H N N 157 I3C HN1A H N N 158 I3C HO11 H N N 159 ILE N N N N 160 ILE CA C N S 161 ILE C C N N 162 ILE O O N N 163 ILE CB C N S 164 ILE CG1 C N N 165 ILE CG2 C N N 166 ILE CD1 C N N 167 ILE OXT O N N 168 ILE H H N N 169 ILE H2 H N N 170 ILE HA H N N 171 ILE HB H N N 172 ILE HG12 H N N 173 ILE HG13 H N N 174 ILE HG21 H N N 175 ILE HG22 H N N 176 ILE HG23 H N N 177 ILE HD11 H N N 178 ILE HD12 H N N 179 ILE HD13 H N N 180 ILE HXT H N N 181 LEU N N N N 182 LEU CA C N S 183 LEU C C N N 184 LEU O O N N 185 LEU CB C N N 186 LEU CG C N N 187 LEU CD1 C N N 188 LEU CD2 C N N 189 LEU OXT O N N 190 LEU H H N N 191 LEU H2 H N N 192 LEU HA H N N 193 LEU HB2 H N N 194 LEU HB3 H N N 195 LEU HG H N N 196 LEU HD11 H N N 197 LEU HD12 H N N 198 LEU HD13 H N N 199 LEU HD21 H N N 200 LEU HD22 H N N 201 LEU HD23 H N N 202 LEU HXT H N N 203 LYS N N N N 204 LYS CA C N S 205 LYS C C N N 206 LYS O O N N 207 LYS CB C N N 208 LYS CG C N N 209 LYS CD C N N 210 LYS CE C N N 211 LYS NZ N N N 212 LYS OXT O N N 213 LYS H H N N 214 LYS H2 H N N 215 LYS HA H N N 216 LYS HB2 H N N 217 LYS HB3 H N N 218 LYS HG2 H N N 219 LYS HG3 H N N 220 LYS HD2 H N N 221 LYS HD3 H N N 222 LYS HE2 H N N 223 LYS HE3 H N N 224 LYS HZ1 H N N 225 LYS HZ2 H N N 226 LYS HZ3 H N N 227 LYS HXT H N N 228 MET N N N N 229 MET CA C N S 230 MET C C N N 231 MET O O N N 232 MET CB C N N 233 MET CG C N N 234 MET SD S N N 235 MET CE C N N 236 MET OXT O N N 237 MET H H N N 238 MET H2 H N N 239 MET HA H N N 240 MET HB2 H N N 241 MET HB3 H N N 242 MET HG2 H N N 243 MET HG3 H N N 244 MET HE1 H N N 245 MET HE2 H N N 246 MET HE3 H N N 247 MET HXT H N N 248 PHE N N N N 249 PHE CA C N S 250 PHE C C N N 251 PHE O O N N 252 PHE CB C N N 253 PHE CG C Y N 254 PHE CD1 C Y N 255 PHE CD2 C Y N 256 PHE CE1 C Y N 257 PHE CE2 C Y N 258 PHE CZ C Y N 259 PHE OXT O N N 260 PHE H H N N 261 PHE H2 H N N 262 PHE HA H N N 263 PHE HB2 H N N 264 PHE HB3 H N N 265 PHE HD1 H N N 266 PHE HD2 H N N 267 PHE HE1 H N N 268 PHE HE2 H N N 269 PHE HZ H N N 270 PHE HXT H N N 271 PRO N N N N 272 PRO CA C N S 273 PRO C C N N 274 PRO O O N N 275 PRO CB C N N 276 PRO CG C N N 277 PRO CD C N N 278 PRO OXT O N N 279 PRO H H N N 280 PRO HA H N N 281 PRO HB2 H N N 282 PRO HB3 H N N 283 PRO HG2 H N N 284 PRO HG3 H N N 285 PRO HD2 H N N 286 PRO HD3 H N N 287 PRO HXT H N N 288 SER N N N N 289 SER CA C N S 290 SER C C N N 291 SER O O N N 292 SER CB C N N 293 SER OG O N N 294 SER OXT O N N 295 SER H H N N 296 SER H2 H N N 297 SER HA H N N 298 SER HB2 H N N 299 SER HB3 H N N 300 SER HG H N N 301 SER HXT H N N 302 THR N N N N 303 THR CA C N S 304 THR C C N N 305 THR O O N N 306 THR CB C N R 307 THR OG1 O N N 308 THR CG2 C N N 309 THR OXT O N N 310 THR H H N N 311 THR H2 H N N 312 THR HA H N N 313 THR HB H N N 314 THR HG1 H N N 315 THR HG21 H N N 316 THR HG22 H N N 317 THR HG23 H N N 318 THR HXT H N N 319 TYR N N N N 320 TYR CA C N S 321 TYR C C N N 322 TYR O O N N 323 TYR CB C N N 324 TYR CG C Y N 325 TYR CD1 C Y N 326 TYR CD2 C Y N 327 TYR CE1 C Y N 328 TYR CE2 C Y N 329 TYR CZ C Y N 330 TYR OH O N N 331 TYR OXT O N N 332 TYR H H N N 333 TYR H2 H N N 334 TYR HA H N N 335 TYR HB2 H N N 336 TYR HB3 H N N 337 TYR HD1 H N N 338 TYR HD2 H N N 339 TYR HE1 H N N 340 TYR HE2 H N N 341 TYR HH H N N 342 TYR HXT H N N 343 VAL N N N N 344 VAL CA C N S 345 VAL C C N N 346 VAL O O N N 347 VAL CB C N N 348 VAL CG1 C N N 349 VAL CG2 C N N 350 VAL OXT O N N 351 VAL H H N N 352 VAL H2 H N N 353 VAL HA H N N 354 VAL HB H N N 355 VAL HG11 H N N 356 VAL HG12 H N N 357 VAL HG13 H N N 358 VAL HG21 H N N 359 VAL HG22 H N N 360 VAL HG23 H N N 361 VAL HXT H N N 362 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HOH O H1 sing N N 129 HOH O H2 sing N N 130 I3C I3 C6 sing N N 131 I3C I2 C4 sing N N 132 I3C I1 C2 sing N N 133 I3C O8 C7 doub N N 134 I3C O9 C7 sing N N 135 I3C C10 C3 sing N N 136 I3C C10 O11 sing N N 137 I3C C10 O12 doub N N 138 I3C N13 C5 sing N N 139 I3C C1 C6 doub Y N 140 I3C C1 C2 sing Y N 141 I3C C1 C7 sing N N 142 I3C C6 C5 sing Y N 143 I3C C5 C4 doub Y N 144 I3C C4 C3 sing Y N 145 I3C C3 C2 doub Y N 146 I3C O9 HO9 sing N N 147 I3C N13 HN13 sing N N 148 I3C N13 HN1A sing N N 149 I3C O11 HO11 sing N N 150 ILE N CA sing N N 151 ILE N H sing N N 152 ILE N H2 sing N N 153 ILE CA C sing N N 154 ILE CA CB sing N N 155 ILE CA HA sing N N 156 ILE C O doub N N 157 ILE C OXT sing N N 158 ILE CB CG1 sing N N 159 ILE CB CG2 sing N N 160 ILE CB HB sing N N 161 ILE CG1 CD1 sing N N 162 ILE CG1 HG12 sing N N 163 ILE CG1 HG13 sing N N 164 ILE CG2 HG21 sing N N 165 ILE CG2 HG22 sing N N 166 ILE CG2 HG23 sing N N 167 ILE CD1 HD11 sing N N 168 ILE CD1 HD12 sing N N 169 ILE CD1 HD13 sing N N 170 ILE OXT HXT sing N N 171 LEU N CA sing N N 172 LEU N H sing N N 173 LEU N H2 sing N N 174 LEU CA C sing N N 175 LEU CA CB sing N N 176 LEU CA HA sing N N 177 LEU C O doub N N 178 LEU C OXT sing N N 179 LEU CB CG sing N N 180 LEU CB HB2 sing N N 181 LEU CB HB3 sing N N 182 LEU CG CD1 sing N N 183 LEU CG CD2 sing N N 184 LEU CG HG sing N N 185 LEU CD1 HD11 sing N N 186 LEU CD1 HD12 sing N N 187 LEU CD1 HD13 sing N N 188 LEU CD2 HD21 sing N N 189 LEU CD2 HD22 sing N N 190 LEU CD2 HD23 sing N N 191 LEU OXT HXT sing N N 192 LYS N CA sing N N 193 LYS N H sing N N 194 LYS N H2 sing N N 195 LYS CA C sing N N 196 LYS CA CB sing N N 197 LYS CA HA sing N N 198 LYS C O doub N N 199 LYS C OXT sing N N 200 LYS CB CG sing N N 201 LYS CB HB2 sing N N 202 LYS CB HB3 sing N N 203 LYS CG CD sing N N 204 LYS CG HG2 sing N N 205 LYS CG HG3 sing N N 206 LYS CD CE sing N N 207 LYS CD HD2 sing N N 208 LYS CD HD3 sing N N 209 LYS CE NZ sing N N 210 LYS CE HE2 sing N N 211 LYS CE HE3 sing N N 212 LYS NZ HZ1 sing N N 213 LYS NZ HZ2 sing N N 214 LYS NZ HZ3 sing N N 215 LYS OXT HXT sing N N 216 MET N CA sing N N 217 MET N H sing N N 218 MET N H2 sing N N 219 MET CA C sing N N 220 MET CA CB sing N N 221 MET CA HA sing N N 222 MET C O doub N N 223 MET C OXT sing N N 224 MET CB CG sing N N 225 MET CB HB2 sing N N 226 MET CB HB3 sing N N 227 MET CG SD sing N N 228 MET CG HG2 sing N N 229 MET CG HG3 sing N N 230 MET SD CE sing N N 231 MET CE HE1 sing N N 232 MET CE HE2 sing N N 233 MET CE HE3 sing N N 234 MET OXT HXT sing N N 235 PHE N CA sing N N 236 PHE N H sing N N 237 PHE N H2 sing N N 238 PHE CA C sing N N 239 PHE CA CB sing N N 240 PHE CA HA sing N N 241 PHE C O doub N N 242 PHE C OXT sing N N 243 PHE CB CG sing N N 244 PHE CB HB2 sing N N 245 PHE CB HB3 sing N N 246 PHE CG CD1 doub Y N 247 PHE CG CD2 sing Y N 248 PHE CD1 CE1 sing Y N 249 PHE CD1 HD1 sing N N 250 PHE CD2 CE2 doub Y N 251 PHE CD2 HD2 sing N N 252 PHE CE1 CZ doub Y N 253 PHE CE1 HE1 sing N N 254 PHE CE2 CZ sing Y N 255 PHE CE2 HE2 sing N N 256 PHE CZ HZ sing N N 257 PHE OXT HXT sing N N 258 PRO N CA sing N N 259 PRO N CD sing N N 260 PRO N H sing N N 261 PRO CA C sing N N 262 PRO CA CB sing N N 263 PRO CA HA sing N N 264 PRO C O doub N N 265 PRO C OXT sing N N 266 PRO CB CG sing N N 267 PRO CB HB2 sing N N 268 PRO CB HB3 sing N N 269 PRO CG CD sing N N 270 PRO CG HG2 sing N N 271 PRO CG HG3 sing N N 272 PRO CD HD2 sing N N 273 PRO CD HD3 sing N N 274 PRO OXT HXT sing N N 275 SER N CA sing N N 276 SER N H sing N N 277 SER N H2 sing N N 278 SER CA C sing N N 279 SER CA CB sing N N 280 SER CA HA sing N N 281 SER C O doub N N 282 SER C OXT sing N N 283 SER CB OG sing N N 284 SER CB HB2 sing N N 285 SER CB HB3 sing N N 286 SER OG HG sing N N 287 SER OXT HXT sing N N 288 THR N CA sing N N 289 THR N H sing N N 290 THR N H2 sing N N 291 THR CA C sing N N 292 THR CA CB sing N N 293 THR CA HA sing N N 294 THR C O doub N N 295 THR C OXT sing N N 296 THR CB OG1 sing N N 297 THR CB CG2 sing N N 298 THR CB HB sing N N 299 THR OG1 HG1 sing N N 300 THR CG2 HG21 sing N N 301 THR CG2 HG22 sing N N 302 THR CG2 HG23 sing N N 303 THR OXT HXT sing N N 304 TYR N CA sing N N 305 TYR N H sing N N 306 TYR N H2 sing N N 307 TYR CA C sing N N 308 TYR CA CB sing N N 309 TYR CA HA sing N N 310 TYR C O doub N N 311 TYR C OXT sing N N 312 TYR CB CG sing N N 313 TYR CB HB2 sing N N 314 TYR CB HB3 sing N N 315 TYR CG CD1 doub Y N 316 TYR CG CD2 sing Y N 317 TYR CD1 CE1 sing Y N 318 TYR CD1 HD1 sing N N 319 TYR CD2 CE2 doub Y N 320 TYR CD2 HD2 sing N N 321 TYR CE1 CZ doub Y N 322 TYR CE1 HE1 sing N N 323 TYR CE2 CZ sing Y N 324 TYR CE2 HE2 sing N N 325 TYR CZ OH sing N N 326 TYR OH HH sing N N 327 TYR OXT HXT sing N N 328 VAL N CA sing N N 329 VAL N H sing N N 330 VAL N H2 sing N N 331 VAL CA C sing N N 332 VAL CA CB sing N N 333 VAL CA HA sing N N 334 VAL C O doub N N 335 VAL C OXT sing N N 336 VAL CB CG1 sing N N 337 VAL CB CG2 sing N N 338 VAL CB HB sing N N 339 VAL CG1 HG11 sing N N 340 VAL CG1 HG12 sing N N 341 VAL CG1 HG13 sing N N 342 VAL CG2 HG21 sing N N 343 VAL CG2 HG22 sing N N 344 VAL CG2 HG23 sing N N 345 VAL OXT HXT sing N N 346 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM115586 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 5L1A _atom_sites.fract_transf_matrix[1][1] 0.024299 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022393 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018472 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C I N O S # loop_