data_5OC5 # _entry.id 5OC5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5OC5 pdb_00005oc5 10.2210/pdb5oc5/pdb WWPDB D_1200005555 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-12-26 2 'Structure model' 1 1 2019-01-16 3 'Structure model' 1 2 2019-04-17 4 'Structure model' 1 3 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' pdbx_database_proc 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5OC5 _pdbx_database_status.recvd_initial_deposition_date 2017-06-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bou-nader, C.' 1 ? 'Pecqueur, L.' 2 ? 'Hamdane, D.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 47 _citation.language ? _citation.page_first 3117 _citation.page_last 3126 _citation.title 'Molecular basis for transfer RNA recognition by the double-stranded RNA-binding domain of human dihydrouridine synthase 2.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gky1302 _citation.pdbx_database_id_PubMed 30605527 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bou-Nader, C.' 1 ? primary 'Barraud, P.' 2 ? primary 'Pecqueur, L.' 3 ? primary 'Perez, J.' 4 ? primary 'Velours, C.' 5 ? primary 'Shepard, W.' 6 ? primary 'Fontecave, M.' 7 ? primary 'Tisne, C.' 8 ? primary 'Hamdane, D.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'tRNA-dihydrouridine(20) synthase [NAD(P)+]-like' 13612.492 1 1.3.1.- ? ? ? 2 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 4 water nat water 18.015 56 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dihydrouridine synthase 2,Up-regulated in lung cancer protein 8,URLC8,tRNA-dihydrouridine synthase 2-like,hDUS2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTSEQTGEPAEDTSGVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWD KSAALAEQAAAIVCLRSQGLPEGRLGEESPSLHKHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MTSEQTGEPAEDTSGVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWD KSAALAEQAAAIVCLRSQGLPEGRLGEESPSLHKHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 SER n 1 4 GLU n 1 5 GLN n 1 6 THR n 1 7 GLY n 1 8 GLU n 1 9 PRO n 1 10 ALA n 1 11 GLU n 1 12 ASP n 1 13 THR n 1 14 SER n 1 15 GLY n 1 16 VAL n 1 17 ILE n 1 18 LYS n 1 19 MET n 1 20 ALA n 1 21 VAL n 1 22 LYS n 1 23 PHE n 1 24 ASP n 1 25 ARG n 1 26 ARG n 1 27 ALA n 1 28 TYR n 1 29 PRO n 1 30 ALA n 1 31 GLN n 1 32 ILE n 1 33 THR n 1 34 PRO n 1 35 LYS n 1 36 MET n 1 37 CYS n 1 38 LEU n 1 39 LEU n 1 40 GLU n 1 41 TRP n 1 42 CYS n 1 43 ARG n 1 44 ARG n 1 45 GLU n 1 46 LYS n 1 47 LEU n 1 48 ALA n 1 49 GLN n 1 50 PRO n 1 51 VAL n 1 52 TYR n 1 53 GLU n 1 54 THR n 1 55 VAL n 1 56 GLN n 1 57 ARG n 1 58 PRO n 1 59 LEU n 1 60 ASP n 1 61 ARG n 1 62 LEU n 1 63 PHE n 1 64 SER n 1 65 SER n 1 66 ILE n 1 67 VAL n 1 68 THR n 1 69 VAL n 1 70 ALA n 1 71 GLU n 1 72 GLN n 1 73 LYS n 1 74 TYR n 1 75 GLN n 1 76 SER n 1 77 THR n 1 78 LEU n 1 79 TRP n 1 80 ASP n 1 81 LYS n 1 82 SER n 1 83 ALA n 1 84 ALA n 1 85 LEU n 1 86 ALA n 1 87 GLU n 1 88 GLN n 1 89 ALA n 1 90 ALA n 1 91 ALA n 1 92 ILE n 1 93 VAL n 1 94 CYS n 1 95 LEU n 1 96 ARG n 1 97 SER n 1 98 GLN n 1 99 GLY n 1 100 LEU n 1 101 PRO n 1 102 GLU n 1 103 GLY n 1 104 ARG n 1 105 LEU n 1 106 GLY n 1 107 GLU n 1 108 GLU n 1 109 SER n 1 110 PRO n 1 111 SER n 1 112 LEU n 1 113 HIS n 1 114 LYS n 1 115 HIS n 1 116 HIS n 1 117 HIS n 1 118 HIS n 1 119 HIS n 1 120 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 120 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DUS2, DUS2L' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11d _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 337 ? ? ? A . n A 1 2 THR 2 338 ? ? ? A . n A 1 3 SER 3 339 ? ? ? A . n A 1 4 GLU 4 340 ? ? ? A . n A 1 5 GLN 5 341 ? ? ? A . n A 1 6 THR 6 342 ? ? ? A . n A 1 7 GLY 7 343 ? ? ? A . n A 1 8 GLU 8 344 ? ? ? A . n A 1 9 PRO 9 345 ? ? ? A . n A 1 10 ALA 10 346 ? ? ? A . n A 1 11 GLU 11 347 ? ? ? A . n A 1 12 ASP 12 348 ? ? ? A . n A 1 13 THR 13 349 349 THR THR A . n A 1 14 SER 14 350 350 SER SER A . n A 1 15 GLY 15 351 351 GLY GLY A . n A 1 16 VAL 16 352 352 VAL VAL A . n A 1 17 ILE 17 353 353 ILE ILE A . n A 1 18 LYS 18 354 354 LYS LYS A . n A 1 19 MET 19 355 355 MET MET A . n A 1 20 ALA 20 356 356 ALA ALA A . n A 1 21 VAL 21 357 357 VAL VAL A . n A 1 22 LYS 22 358 358 LYS LYS A . n A 1 23 PHE 23 359 359 PHE PHE A . n A 1 24 ASP 24 360 360 ASP ASP A . n A 1 25 ARG 25 361 361 ARG ARG A . n A 1 26 ARG 26 362 362 ARG ARG A . n A 1 27 ALA 27 363 363 ALA ALA A . n A 1 28 TYR 28 364 364 TYR TYR A . n A 1 29 PRO 29 365 365 PRO PRO A . n A 1 30 ALA 30 366 366 ALA ALA A . n A 1 31 GLN 31 367 367 GLN GLN A . n A 1 32 ILE 32 368 368 ILE ILE A . n A 1 33 THR 33 369 369 THR THR A . n A 1 34 PRO 34 370 370 PRO PRO A . n A 1 35 LYS 35 371 371 LYS LYS A . n A 1 36 MET 36 372 372 MET MET A . n A 1 37 CYS 37 373 373 CYS CYS A . n A 1 38 LEU 38 374 374 LEU LEU A . n A 1 39 LEU 39 375 375 LEU LEU A . n A 1 40 GLU 40 376 376 GLU GLU A . n A 1 41 TRP 41 377 377 TRP TRP A . n A 1 42 CYS 42 378 378 CYS CYS A . n A 1 43 ARG 43 379 379 ARG ARG A . n A 1 44 ARG 44 380 380 ARG ARG A . n A 1 45 GLU 45 381 381 GLU GLU A . n A 1 46 LYS 46 382 382 LYS LYS A . n A 1 47 LEU 47 383 383 LEU LEU A . n A 1 48 ALA 48 384 384 ALA ALA A . n A 1 49 GLN 49 385 385 GLN GLN A . n A 1 50 PRO 50 386 386 PRO PRO A . n A 1 51 VAL 51 387 387 VAL VAL A . n A 1 52 TYR 52 388 388 TYR TYR A . n A 1 53 GLU 53 389 389 GLU GLU A . n A 1 54 THR 54 390 390 THR THR A . n A 1 55 VAL 55 391 391 VAL VAL A . n A 1 56 GLN 56 392 392 GLN GLN A . n A 1 57 ARG 57 393 393 ARG ARG A . n A 1 58 PRO 58 394 394 PRO PRO A . n A 1 59 LEU 59 395 395 LEU LEU A . n A 1 60 ASP 60 396 396 ASP ASP A . n A 1 61 ARG 61 397 397 ARG ARG A . n A 1 62 LEU 62 398 398 LEU LEU A . n A 1 63 PHE 63 399 399 PHE PHE A . n A 1 64 SER 64 400 400 SER SER A . n A 1 65 SER 65 401 401 SER SER A . n A 1 66 ILE 66 402 402 ILE ILE A . n A 1 67 VAL 67 403 403 VAL VAL A . n A 1 68 THR 68 404 404 THR THR A . n A 1 69 VAL 69 405 405 VAL VAL A . n A 1 70 ALA 70 406 406 ALA ALA A . n A 1 71 GLU 71 407 407 GLU GLU A . n A 1 72 GLN 72 408 408 GLN GLN A . n A 1 73 LYS 73 409 409 LYS LYS A . n A 1 74 TYR 74 410 410 TYR TYR A . n A 1 75 GLN 75 411 411 GLN GLN A . n A 1 76 SER 76 412 412 SER SER A . n A 1 77 THR 77 413 413 THR THR A . n A 1 78 LEU 78 414 414 LEU LEU A . n A 1 79 TRP 79 415 415 TRP TRP A . n A 1 80 ASP 80 416 416 ASP ASP A . n A 1 81 LYS 81 417 417 LYS LYS A . n A 1 82 SER 82 418 418 SER SER A . n A 1 83 ALA 83 419 419 ALA ALA A . n A 1 84 ALA 84 420 420 ALA ALA A . n A 1 85 LEU 85 421 421 LEU LEU A . n A 1 86 ALA 86 422 422 ALA ALA A . n A 1 87 GLU 87 423 423 GLU GLU A . n A 1 88 GLN 88 424 424 GLN GLN A . n A 1 89 ALA 89 425 425 ALA ALA A . n A 1 90 ALA 90 426 426 ALA ALA A . n A 1 91 ALA 91 427 427 ALA ALA A . n A 1 92 ILE 92 428 428 ILE ILE A . n A 1 93 VAL 93 429 429 VAL VAL A . n A 1 94 CYS 94 430 430 CYS CYS A . n A 1 95 LEU 95 431 431 LEU LEU A . n A 1 96 ARG 96 432 432 ARG ARG A . n A 1 97 SER 97 433 433 SER SER A . n A 1 98 GLN 98 434 434 GLN GLN A . n A 1 99 GLY 99 435 435 GLY GLY A . n A 1 100 LEU 100 436 436 LEU LEU A . n A 1 101 PRO 101 437 437 PRO PRO A . n A 1 102 GLU 102 438 438 GLU GLU A . n A 1 103 GLY 103 439 439 GLY GLY A . n A 1 104 ARG 104 440 440 ARG ARG A . n A 1 105 LEU 105 441 441 LEU LEU A . n A 1 106 GLY 106 442 ? ? ? A . n A 1 107 GLU 107 443 ? ? ? A . n A 1 108 GLU 108 444 ? ? ? A . n A 1 109 SER 109 445 ? ? ? A . n A 1 110 PRO 110 446 ? ? ? A . n A 1 111 SER 111 447 ? ? ? A . n A 1 112 LEU 112 448 ? ? ? A . n A 1 113 HIS 113 449 ? ? ? A . n A 1 114 LYS 114 450 ? ? ? A . n A 1 115 HIS 115 451 ? ? ? A . n A 1 116 HIS 116 452 ? ? ? A . n A 1 117 HIS 117 453 ? ? ? A . n A 1 118 HIS 118 454 ? ? ? A . n A 1 119 HIS 119 455 ? ? ? A . n A 1 120 HIS 120 456 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 501 442 GOL GOL A . C 2 GOL 1 502 443 GOL GOL A . D 2 GOL 1 503 444 GOL GOL A . E 3 CL 1 504 445 CL CL A . F 3 CL 1 505 446 CL CL A . G 4 HOH 1 601 499 HOH HOH A . G 4 HOH 2 602 492 HOH HOH A . G 4 HOH 3 603 463 HOH HOH A . G 4 HOH 4 604 469 HOH HOH A . G 4 HOH 5 605 462 HOH HOH A . G 4 HOH 6 606 447 HOH HOH A . G 4 HOH 7 607 466 HOH HOH A . G 4 HOH 8 608 473 HOH HOH A . G 4 HOH 9 609 451 HOH HOH A . G 4 HOH 10 610 453 HOH HOH A . G 4 HOH 11 611 461 HOH HOH A . G 4 HOH 12 612 477 HOH HOH A . G 4 HOH 13 613 496 HOH HOH A . G 4 HOH 14 614 454 HOH HOH A . G 4 HOH 15 615 456 HOH HOH A . G 4 HOH 16 616 478 HOH HOH A . G 4 HOH 17 617 468 HOH HOH A . G 4 HOH 18 618 480 HOH HOH A . G 4 HOH 19 619 450 HOH HOH A . G 4 HOH 20 620 474 HOH HOH A . G 4 HOH 21 621 483 HOH HOH A . G 4 HOH 22 622 448 HOH HOH A . G 4 HOH 23 623 489 HOH HOH A . G 4 HOH 24 624 470 HOH HOH A . G 4 HOH 25 625 464 HOH HOH A . G 4 HOH 26 626 484 HOH HOH A . G 4 HOH 27 627 482 HOH HOH A . G 4 HOH 28 628 455 HOH HOH A . G 4 HOH 29 629 449 HOH HOH A . G 4 HOH 30 630 458 HOH HOH A . G 4 HOH 31 631 488 HOH HOH A . G 4 HOH 32 632 479 HOH HOH A . G 4 HOH 33 633 498 HOH HOH A . G 4 HOH 34 634 481 HOH HOH A . G 4 HOH 35 635 472 HOH HOH A . G 4 HOH 36 636 475 HOH HOH A . G 4 HOH 37 637 471 HOH HOH A . G 4 HOH 38 638 476 HOH HOH A . G 4 HOH 39 639 502 HOH HOH A . G 4 HOH 40 640 494 HOH HOH A . G 4 HOH 41 641 452 HOH HOH A . G 4 HOH 42 642 465 HOH HOH A . G 4 HOH 43 643 490 HOH HOH A . G 4 HOH 44 644 457 HOH HOH A . G 4 HOH 45 645 487 HOH HOH A . G 4 HOH 46 646 493 HOH HOH A . G 4 HOH 47 647 485 HOH HOH A . G 4 HOH 48 648 460 HOH HOH A . G 4 HOH 49 649 459 HOH HOH A . G 4 HOH 50 650 467 HOH HOH A . G 4 HOH 51 651 501 HOH HOH A . G 4 HOH 52 652 495 HOH HOH A . G 4 HOH 53 653 491 HOH HOH A . G 4 HOH 54 654 500 HOH HOH A . G 4 HOH 55 655 486 HOH HOH A . G 4 HOH 56 656 497 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5OC5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 36.170 _cell.length_a_esd ? _cell.length_b 36.170 _cell.length_b_esd ? _cell.length_c 75.090 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5OC5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 76 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5OC5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;35% PEG 4K 1 M LiCl 100 mM Tris ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-02-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98011 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98011 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 2' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5OC5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.893 _reflns.d_resolution_low 36.17 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7680 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.51 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.4 _reflns.pdbx_Rmerge_I_obs 0.099 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.893 _reflns_shell.d_res_low 1.961 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.29 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 710 _reflns_shell.percent_possible_all 96.33 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.468 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5OC5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.893 _refine.ls_d_res_low 36.170 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7670 _refine.ls_number_reflns_R_free 768 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.26 _refine.ls_percent_reflns_R_free 10.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1747 _refine.ls_R_factor_R_free 0.2262 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1688 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.40 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4wft _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.08 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.35 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 737 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 813 _refine_hist.d_res_high 1.893 _refine_hist.d_res_low 36.170 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 ? 765 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.138 ? 1029 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 18.072 ? 474 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.073 ? 119 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 128 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8926 2.0387 . . 146 1342 97.00 . . . 0.3746 . 0.3208 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0387 2.2439 . . 155 1396 100.00 . . . 0.2577 . 0.1944 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2439 2.5685 . . 151 1365 100.00 . . . 0.2596 . 0.1704 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5685 3.2357 . . 158 1397 100.00 . . . 0.2294 . 0.1743 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2357 36.1766 . . 158 1402 100.00 . . . 0.1926 . 0.1437 . . . . . . . . . . # _struct.entry_id 5OC5 _struct.title 'Crystal structure of human tRNA-dihydrouridine(20) synthase dsRBD K419A-K420A mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5OC5 _struct_keywords.text 'double-stranded RNA-binding domain, RNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DUS2L_HUMAN _struct_ref.pdbx_db_accession Q9NX74 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TSEQTGEPAEDTSGVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDK SKKLAEQAAAIVCLRSQGLPEGRLGEESPSLHK ; _struct_ref.pdbx_align_begin 338 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5OC5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NX74 _struct_ref_seq.db_align_beg 338 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 450 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 338 _struct_ref_seq.pdbx_auth_seq_align_end 450 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5OC5 MET A 1 ? UNP Q9NX74 ? ? 'initiating methionine' 337 1 1 5OC5 ALA A 83 ? UNP Q9NX74 LYS 419 'engineered mutation' 419 2 1 5OC5 ALA A 84 ? UNP Q9NX74 LYS 420 'engineered mutation' 420 3 1 5OC5 HIS A 115 ? UNP Q9NX74 ? ? 'expression tag' 451 4 1 5OC5 HIS A 116 ? UNP Q9NX74 ? ? 'expression tag' 452 5 1 5OC5 HIS A 117 ? UNP Q9NX74 ? ? 'expression tag' 453 6 1 5OC5 HIS A 118 ? UNP Q9NX74 ? ? 'expression tag' 454 7 1 5OC5 HIS A 119 ? UNP Q9NX74 ? ? 'expression tag' 455 8 1 5OC5 HIS A 120 ? UNP Q9NX74 ? ? 'expression tag' 456 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 740 ? 1 MORE -17 ? 1 'SSA (A^2)' 6270 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 24 ? TYR A 28 ? ASP A 360 TYR A 364 5 ? 5 HELX_P HELX_P2 AA2 THR A 33 ? GLU A 45 ? THR A 369 GLU A 381 1 ? 13 HELX_P HELX_P3 AA3 SER A 82 ? GLN A 98 ? SER A 418 GLN A 434 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 16 ? MET A 19 ? VAL A 352 MET A 355 AA1 2 GLN A 72 ? SER A 76 ? GLN A 408 SER A 412 AA1 3 PHE A 63 ? VAL A 69 ? PHE A 399 VAL A 405 AA1 4 VAL A 51 ? GLN A 56 ? VAL A 387 GLN A 392 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 17 ? N ILE A 353 O GLN A 75 ? O GLN A 411 AA1 2 3 O GLN A 72 ? O GLN A 408 N VAL A 69 ? N VAL A 405 AA1 3 4 O ILE A 66 ? O ILE A 402 N GLU A 53 ? N GLU A 389 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 501 ? 4 'binding site for residue GOL A 501' AC2 Software A GOL 502 ? 4 'binding site for residue GOL A 502' AC3 Software A GOL 503 ? 3 'binding site for residue GOL A 503' AC4 Software A CL 504 ? 4 'binding site for residue CL A 504' AC5 Software A CL 505 ? 2 'binding site for residue CL A 505' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 THR A 54 ? THR A 390 . ? 1_555 ? 2 AC1 4 GOL D . ? GOL A 503 . ? 1_555 ? 3 AC1 4 HOH G . ? HOH A 605 . ? 1_555 ? 4 AC1 4 HOH G . ? HOH A 633 . ? 1_555 ? 5 AC2 4 ARG A 61 ? ARG A 397 . ? 1_555 ? 6 AC2 4 LYS A 81 ? LYS A 417 . ? 1_555 ? 7 AC2 4 HOH G . ? HOH A 637 . ? 1_555 ? 8 AC2 4 HOH G . ? HOH A 654 . ? 1_555 ? 9 AC3 3 GLN A 56 ? GLN A 392 . ? 1_555 ? 10 AC3 3 GOL B . ? GOL A 501 . ? 1_555 ? 11 AC3 3 HOH G . ? HOH A 618 . ? 1_555 ? 12 AC4 4 ARG A 25 ? ARG A 361 . ? 1_555 ? 13 AC4 4 TRP A 41 ? TRP A 377 . ? 3_555 ? 14 AC4 4 ARG A 44 ? ARG A 380 . ? 3_555 ? 15 AC4 4 SER A 82 ? SER A 418 . ? 1_555 ? 16 AC5 2 HOH G . ? HOH A 606 . ? 1_555 ? 17 AC5 2 HOH G . ? HOH A 641 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 618 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 637 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 601 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 644 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_555 _pdbx_validate_symm_contact.dist 2.02 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 407 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 70.71 _pdbx_validate_torsion.psi -1.44 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 337 ? A MET 1 2 1 Y 1 A THR 338 ? A THR 2 3 1 Y 1 A SER 339 ? A SER 3 4 1 Y 1 A GLU 340 ? A GLU 4 5 1 Y 1 A GLN 341 ? A GLN 5 6 1 Y 1 A THR 342 ? A THR 6 7 1 Y 1 A GLY 343 ? A GLY 7 8 1 Y 1 A GLU 344 ? A GLU 8 9 1 Y 1 A PRO 345 ? A PRO 9 10 1 Y 1 A ALA 346 ? A ALA 10 11 1 Y 1 A GLU 347 ? A GLU 11 12 1 Y 1 A ASP 348 ? A ASP 12 13 1 Y 1 A GLY 442 ? A GLY 106 14 1 Y 1 A GLU 443 ? A GLU 107 15 1 Y 1 A GLU 444 ? A GLU 108 16 1 Y 1 A SER 445 ? A SER 109 17 1 Y 1 A PRO 446 ? A PRO 110 18 1 Y 1 A SER 447 ? A SER 111 19 1 Y 1 A LEU 448 ? A LEU 112 20 1 Y 1 A HIS 449 ? A HIS 113 21 1 Y 1 A LYS 450 ? A LYS 114 22 1 Y 1 A HIS 451 ? A HIS 115 23 1 Y 1 A HIS 452 ? A HIS 116 24 1 Y 1 A HIS 453 ? A HIS 117 25 1 Y 1 A HIS 454 ? A HIS 118 26 1 Y 1 A HIS 455 ? A HIS 119 27 1 Y 1 A HIS 456 ? A HIS 120 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CL CL CL N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 GOL C1 C N N 121 GOL O1 O N N 122 GOL C2 C N N 123 GOL O2 O N N 124 GOL C3 C N N 125 GOL O3 O N N 126 GOL H11 H N N 127 GOL H12 H N N 128 GOL HO1 H N N 129 GOL H2 H N N 130 GOL HO2 H N N 131 GOL H31 H N N 132 GOL H32 H N N 133 GOL HO3 H N N 134 HIS N N N N 135 HIS CA C N S 136 HIS C C N N 137 HIS O O N N 138 HIS CB C N N 139 HIS CG C Y N 140 HIS ND1 N Y N 141 HIS CD2 C Y N 142 HIS CE1 C Y N 143 HIS NE2 N Y N 144 HIS OXT O N N 145 HIS H H N N 146 HIS H2 H N N 147 HIS HA H N N 148 HIS HB2 H N N 149 HIS HB3 H N N 150 HIS HD1 H N N 151 HIS HD2 H N N 152 HIS HE1 H N N 153 HIS HE2 H N N 154 HIS HXT H N N 155 HOH O O N N 156 HOH H1 H N N 157 HOH H2 H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 GOL C1 O1 sing N N 113 GOL C1 C2 sing N N 114 GOL C1 H11 sing N N 115 GOL C1 H12 sing N N 116 GOL O1 HO1 sing N N 117 GOL C2 O2 sing N N 118 GOL C2 C3 sing N N 119 GOL C2 H2 sing N N 120 GOL O2 HO2 sing N N 121 GOL C3 O3 sing N N 122 GOL C3 H31 sing N N 123 GOL C3 H32 sing N N 124 GOL O3 HO3 sing N N 125 HIS N CA sing N N 126 HIS N H sing N N 127 HIS N H2 sing N N 128 HIS CA C sing N N 129 HIS CA CB sing N N 130 HIS CA HA sing N N 131 HIS C O doub N N 132 HIS C OXT sing N N 133 HIS CB CG sing N N 134 HIS CB HB2 sing N N 135 HIS CB HB3 sing N N 136 HIS CG ND1 sing Y N 137 HIS CG CD2 doub Y N 138 HIS ND1 CE1 doub Y N 139 HIS ND1 HD1 sing N N 140 HIS CD2 NE2 sing Y N 141 HIS CD2 HD2 sing N N 142 HIS CE1 NE2 sing Y N 143 HIS CE1 HE1 sing N N 144 HIS NE2 HE2 sing N N 145 HIS OXT HXT sing N N 146 HOH O H1 sing N N 147 HOH O H2 sing N N 148 ILE N CA sing N N 149 ILE N H sing N N 150 ILE N H2 sing N N 151 ILE CA C sing N N 152 ILE CA CB sing N N 153 ILE CA HA sing N N 154 ILE C O doub N N 155 ILE C OXT sing N N 156 ILE CB CG1 sing N N 157 ILE CB CG2 sing N N 158 ILE CB HB sing N N 159 ILE CG1 CD1 sing N N 160 ILE CG1 HG12 sing N N 161 ILE CG1 HG13 sing N N 162 ILE CG2 HG21 sing N N 163 ILE CG2 HG22 sing N N 164 ILE CG2 HG23 sing N N 165 ILE CD1 HD11 sing N N 166 ILE CD1 HD12 sing N N 167 ILE CD1 HD13 sing N N 168 ILE OXT HXT sing N N 169 LEU N CA sing N N 170 LEU N H sing N N 171 LEU N H2 sing N N 172 LEU CA C sing N N 173 LEU CA CB sing N N 174 LEU CA HA sing N N 175 LEU C O doub N N 176 LEU C OXT sing N N 177 LEU CB CG sing N N 178 LEU CB HB2 sing N N 179 LEU CB HB3 sing N N 180 LEU CG CD1 sing N N 181 LEU CG CD2 sing N N 182 LEU CG HG sing N N 183 LEU CD1 HD11 sing N N 184 LEU CD1 HD12 sing N N 185 LEU CD1 HD13 sing N N 186 LEU CD2 HD21 sing N N 187 LEU CD2 HD22 sing N N 188 LEU CD2 HD23 sing N N 189 LEU OXT HXT sing N N 190 LYS N CA sing N N 191 LYS N H sing N N 192 LYS N H2 sing N N 193 LYS CA C sing N N 194 LYS CA CB sing N N 195 LYS CA HA sing N N 196 LYS C O doub N N 197 LYS C OXT sing N N 198 LYS CB CG sing N N 199 LYS CB HB2 sing N N 200 LYS CB HB3 sing N N 201 LYS CG CD sing N N 202 LYS CG HG2 sing N N 203 LYS CG HG3 sing N N 204 LYS CD CE sing N N 205 LYS CD HD2 sing N N 206 LYS CD HD3 sing N N 207 LYS CE NZ sing N N 208 LYS CE HE2 sing N N 209 LYS CE HE3 sing N N 210 LYS NZ HZ1 sing N N 211 LYS NZ HZ2 sing N N 212 LYS NZ HZ3 sing N N 213 LYS OXT HXT sing N N 214 MET N CA sing N N 215 MET N H sing N N 216 MET N H2 sing N N 217 MET CA C sing N N 218 MET CA CB sing N N 219 MET CA HA sing N N 220 MET C O doub N N 221 MET C OXT sing N N 222 MET CB CG sing N N 223 MET CB HB2 sing N N 224 MET CB HB3 sing N N 225 MET CG SD sing N N 226 MET CG HG2 sing N N 227 MET CG HG3 sing N N 228 MET SD CE sing N N 229 MET CE HE1 sing N N 230 MET CE HE2 sing N N 231 MET CE HE3 sing N N 232 MET OXT HXT sing N N 233 PHE N CA sing N N 234 PHE N H sing N N 235 PHE N H2 sing N N 236 PHE CA C sing N N 237 PHE CA CB sing N N 238 PHE CA HA sing N N 239 PHE C O doub N N 240 PHE C OXT sing N N 241 PHE CB CG sing N N 242 PHE CB HB2 sing N N 243 PHE CB HB3 sing N N 244 PHE CG CD1 doub Y N 245 PHE CG CD2 sing Y N 246 PHE CD1 CE1 sing Y N 247 PHE CD1 HD1 sing N N 248 PHE CD2 CE2 doub Y N 249 PHE CD2 HD2 sing N N 250 PHE CE1 CZ doub Y N 251 PHE CE1 HE1 sing N N 252 PHE CE2 CZ sing Y N 253 PHE CE2 HE2 sing N N 254 PHE CZ HZ sing N N 255 PHE OXT HXT sing N N 256 PRO N CA sing N N 257 PRO N CD sing N N 258 PRO N H sing N N 259 PRO CA C sing N N 260 PRO CA CB sing N N 261 PRO CA HA sing N N 262 PRO C O doub N N 263 PRO C OXT sing N N 264 PRO CB CG sing N N 265 PRO CB HB2 sing N N 266 PRO CB HB3 sing N N 267 PRO CG CD sing N N 268 PRO CG HG2 sing N N 269 PRO CG HG3 sing N N 270 PRO CD HD2 sing N N 271 PRO CD HD3 sing N N 272 PRO OXT HXT sing N N 273 SER N CA sing N N 274 SER N H sing N N 275 SER N H2 sing N N 276 SER CA C sing N N 277 SER CA CB sing N N 278 SER CA HA sing N N 279 SER C O doub N N 280 SER C OXT sing N N 281 SER CB OG sing N N 282 SER CB HB2 sing N N 283 SER CB HB3 sing N N 284 SER OG HG sing N N 285 SER OXT HXT sing N N 286 THR N CA sing N N 287 THR N H sing N N 288 THR N H2 sing N N 289 THR CA C sing N N 290 THR CA CB sing N N 291 THR CA HA sing N N 292 THR C O doub N N 293 THR C OXT sing N N 294 THR CB OG1 sing N N 295 THR CB CG2 sing N N 296 THR CB HB sing N N 297 THR OG1 HG1 sing N N 298 THR CG2 HG21 sing N N 299 THR CG2 HG22 sing N N 300 THR CG2 HG23 sing N N 301 THR OXT HXT sing N N 302 TRP N CA sing N N 303 TRP N H sing N N 304 TRP N H2 sing N N 305 TRP CA C sing N N 306 TRP CA CB sing N N 307 TRP CA HA sing N N 308 TRP C O doub N N 309 TRP C OXT sing N N 310 TRP CB CG sing N N 311 TRP CB HB2 sing N N 312 TRP CB HB3 sing N N 313 TRP CG CD1 doub Y N 314 TRP CG CD2 sing Y N 315 TRP CD1 NE1 sing Y N 316 TRP CD1 HD1 sing N N 317 TRP CD2 CE2 doub Y N 318 TRP CD2 CE3 sing Y N 319 TRP NE1 CE2 sing Y N 320 TRP NE1 HE1 sing N N 321 TRP CE2 CZ2 sing Y N 322 TRP CE3 CZ3 doub Y N 323 TRP CE3 HE3 sing N N 324 TRP CZ2 CH2 doub Y N 325 TRP CZ2 HZ2 sing N N 326 TRP CZ3 CH2 sing Y N 327 TRP CZ3 HZ3 sing N N 328 TRP CH2 HH2 sing N N 329 TRP OXT HXT sing N N 330 TYR N CA sing N N 331 TYR N H sing N N 332 TYR N H2 sing N N 333 TYR CA C sing N N 334 TYR CA CB sing N N 335 TYR CA HA sing N N 336 TYR C O doub N N 337 TYR C OXT sing N N 338 TYR CB CG sing N N 339 TYR CB HB2 sing N N 340 TYR CB HB3 sing N N 341 TYR CG CD1 doub Y N 342 TYR CG CD2 sing Y N 343 TYR CD1 CE1 sing Y N 344 TYR CD1 HD1 sing N N 345 TYR CD2 CE2 doub Y N 346 TYR CD2 HD2 sing N N 347 TYR CE1 CZ doub Y N 348 TYR CE1 HE1 sing N N 349 TYR CE2 CZ sing Y N 350 TYR CE2 HE2 sing N N 351 TYR CZ OH sing N N 352 TYR OH HH sing N N 353 TYR OXT HXT sing N N 354 VAL N CA sing N N 355 VAL N H sing N N 356 VAL N H2 sing N N 357 VAL CA C sing N N 358 VAL CA CB sing N N 359 VAL CA HA sing N N 360 VAL C O doub N N 361 VAL C OXT sing N N 362 VAL CB CG1 sing N N 363 VAL CB CG2 sing N N 364 VAL CB HB sing N N 365 VAL CG1 HG11 sing N N 366 VAL CG1 HG12 sing N N 367 VAL CG1 HG13 sing N N 368 VAL CG2 HG21 sing N N 369 VAL CG2 HG22 sing N N 370 VAL CG2 HG23 sing N N 371 VAL OXT HXT sing N N 372 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4WFT _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5OC5 _atom_sites.fract_transf_matrix[1][1] 0.027647 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027647 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013317 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL H N O S # loop_