data_5VL4 # _entry.id 5VL4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5VL4 pdb_00005vl4 10.2210/pdb5vl4/pdb WWPDB D_1000227335 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details '5CY5 is a 2-component designed tetrahedral cage formed from proteins homologous to the protein in this deposition' _pdbx_database_related.db_id 5CY5 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5VL4 _pdbx_database_status.recvd_initial_deposition_date 2017-04-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cannon, K.A.' 1 ? 'Cascio, D.' 2 ? 'Sawaya, M.R.' 3 ? 'Park, R.' 4 ? 'Boyken, S.' 5 ? 'King, N.' 6 ? 'Yeates, T.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 919 _citation.page_last 929 _citation.title 'Design and structure of two new protein cages illustrate successes and ongoing challenges in protein engineering.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.3802 _citation.pdbx_database_id_PubMed 31840320 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cannon, K.A.' 1 ? primary 'Park, R.U.' 2 ? primary 'Boyken, S.E.' 3 ? primary 'Nattermann, U.' 4 ? primary 'Yi, S.' 5 ? primary 'Baker, D.' 6 ? primary 'King, N.P.' 7 ? primary 'Yeates, T.O.' 8 0000-0001-5709-9839 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5VL4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 138.380 _cell.length_a_esd ? _cell.length_b 138.380 _cell.length_b_esd ? _cell.length_c 138.380 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5VL4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description T33-53H-B _entity.formula_weight 21029.189 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MFTRRGDQGETDLANRARVGKDSPVVEVQGTIDELNSFIGYALVLSRWDDIRNDLFRIQNDLFVLGEDVSTGGKGRTVTL EMILYLVERVTEMKAEIGKIELFVVPGGSVESASLHMARAVSRRLERRIKAASRLTEINDNVLLYAAMLSSILFMHALIS NKRLNIPEKIWSIHRVSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MFTRRGDQGETDLANRARVGKDSPVVEVQGTIDELNSFIGYALVLSRWDDIRNDLFRIQNDLFVLGEDVSTGGKGRTVTL EMILYLVERVTEMKAEIGKIELFVVPGGSVESASLHMARAVSRRLERRIKAASRLTEINDNVLLYAAMLSSILFMHALIS NKRLNIPEKIWSIHRVSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 THR n 1 4 ARG n 1 5 ARG n 1 6 GLY n 1 7 ASP n 1 8 GLN n 1 9 GLY n 1 10 GLU n 1 11 THR n 1 12 ASP n 1 13 LEU n 1 14 ALA n 1 15 ASN n 1 16 ARG n 1 17 ALA n 1 18 ARG n 1 19 VAL n 1 20 GLY n 1 21 LYS n 1 22 ASP n 1 23 SER n 1 24 PRO n 1 25 VAL n 1 26 VAL n 1 27 GLU n 1 28 VAL n 1 29 GLN n 1 30 GLY n 1 31 THR n 1 32 ILE n 1 33 ASP n 1 34 GLU n 1 35 LEU n 1 36 ASN n 1 37 SER n 1 38 PHE n 1 39 ILE n 1 40 GLY n 1 41 TYR n 1 42 ALA n 1 43 LEU n 1 44 VAL n 1 45 LEU n 1 46 SER n 1 47 ARG n 1 48 TRP n 1 49 ASP n 1 50 ASP n 1 51 ILE n 1 52 ARG n 1 53 ASN n 1 54 ASP n 1 55 LEU n 1 56 PHE n 1 57 ARG n 1 58 ILE n 1 59 GLN n 1 60 ASN n 1 61 ASP n 1 62 LEU n 1 63 PHE n 1 64 VAL n 1 65 LEU n 1 66 GLY n 1 67 GLU n 1 68 ASP n 1 69 VAL n 1 70 SER n 1 71 THR n 1 72 GLY n 1 73 GLY n 1 74 LYS n 1 75 GLY n 1 76 ARG n 1 77 THR n 1 78 VAL n 1 79 THR n 1 80 LEU n 1 81 GLU n 1 82 MET n 1 83 ILE n 1 84 LEU n 1 85 TYR n 1 86 LEU n 1 87 VAL n 1 88 GLU n 1 89 ARG n 1 90 VAL n 1 91 THR n 1 92 GLU n 1 93 MET n 1 94 LYS n 1 95 ALA n 1 96 GLU n 1 97 ILE n 1 98 GLY n 1 99 LYS n 1 100 ILE n 1 101 GLU n 1 102 LEU n 1 103 PHE n 1 104 VAL n 1 105 VAL n 1 106 PRO n 1 107 GLY n 1 108 GLY n 1 109 SER n 1 110 VAL n 1 111 GLU n 1 112 SER n 1 113 ALA n 1 114 SER n 1 115 LEU n 1 116 HIS n 1 117 MET n 1 118 ALA n 1 119 ARG n 1 120 ALA n 1 121 VAL n 1 122 SER n 1 123 ARG n 1 124 ARG n 1 125 LEU n 1 126 GLU n 1 127 ARG n 1 128 ARG n 1 129 ILE n 1 130 LYS n 1 131 ALA n 1 132 ALA n 1 133 SER n 1 134 ARG n 1 135 LEU n 1 136 THR n 1 137 GLU n 1 138 ILE n 1 139 ASN n 1 140 ASP n 1 141 ASN n 1 142 VAL n 1 143 LEU n 1 144 LEU n 1 145 TYR n 1 146 ALA n 1 147 ALA n 1 148 MET n 1 149 LEU n 1 150 SER n 1 151 SER n 1 152 ILE n 1 153 LEU n 1 154 PHE n 1 155 MET n 1 156 HIS n 1 157 ALA n 1 158 LEU n 1 159 ILE n 1 160 SER n 1 161 ASN n 1 162 LYS n 1 163 ARG n 1 164 LEU n 1 165 ASN n 1 166 ILE n 1 167 PRO n 1 168 GLU n 1 169 LYS n 1 170 ILE n 1 171 TRP n 1 172 SER n 1 173 ILE n 1 174 HIS n 1 175 ARG n 1 176 VAL n 1 177 SER n 1 178 LEU n 1 179 GLU n 1 180 HIS n 1 181 HIS n 1 182 HIS n 1 183 HIS n 1 184 HIS n 1 185 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 185 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermoplasma acidophilum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2303 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET29b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5VL4 _struct_ref.pdbx_db_accession 5VL4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5VL4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 185 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5VL4 _struct_ref_seq.db_align_beg -21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 163 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -21 _struct_ref_seq.pdbx_auth_seq_align_end 163 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5VL4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.25 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 76.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Na citrate pH 5.6, 2.5M 1,6-hexanediol, 0.01M manganese chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-03-06 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97920 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97920 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 135.490 _reflns.entry_id 5VL4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 4.100 _reflns.d_resolution_low 97.850 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3554 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 98.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.992 _reflns.pdbx_Rmerge_I_obs 0.147 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.570 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.742 _reflns.pdbx_scaling_rejects 47 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.162 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 21295 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 4.100 4.200 ? 2.310 ? ? ? ? 240 94.900 ? ? ? ? 0.776 ? ? ? ? ? ? ? ? 4.983 ? ? ? ? 0.865 ? ? 1 1 0.742 ? 4.200 4.320 ? 3.060 ? ? ? ? 257 99.600 ? ? ? ? 0.648 ? ? ? ? ? ? ? ? 6.144 ? ? ? ? 0.708 ? ? 2 1 0.864 ? 4.320 4.450 ? 3.640 ? ? ? ? 255 99.600 ? ? ? ? 0.532 ? ? ? ? ? ? ? ? 6.125 ? ? ? ? 0.582 ? ? 3 1 0.901 ? 4.450 4.580 ? 4.260 ? ? ? ? 239 99.600 ? ? ? ? 0.467 ? ? ? ? ? ? ? ? 6.126 ? ? ? ? 0.512 ? ? 4 1 0.885 ? 4.580 4.730 ? 4.250 ? ? ? ? 213 98.600 ? ? ? ? 0.448 ? ? ? ? ? ? ? ? 6.075 ? ? ? ? 0.491 ? ? 5 1 0.890 ? 4.730 4.900 ? 4.740 ? ? ? ? 233 99.600 ? ? ? ? 0.404 ? ? ? ? ? ? ? ? 5.948 ? ? ? ? 0.443 ? ? 6 1 0.897 ? 4.900 5.080 ? 4.860 ? ? ? ? 215 98.200 ? ? ? ? 0.372 ? ? ? ? ? ? ? ? 6.060 ? ? ? ? 0.408 ? ? 7 1 0.933 ? 5.080 5.290 ? 5.140 ? ? ? ? 210 98.100 ? ? ? ? 0.347 ? ? ? ? ? ? ? ? 5.810 ? ? ? ? 0.382 ? ? 8 1 0.923 ? 5.290 5.530 ? 4.660 ? ? ? ? 199 99.500 ? ? ? ? 0.334 ? ? ? ? ? ? ? ? 5.191 ? ? ? ? 0.371 ? ? 9 1 0.944 ? 5.530 5.800 ? 4.610 ? ? ? ? 192 99.500 ? ? ? ? 0.395 ? ? ? ? ? ? ? ? 6.151 ? ? ? ? 0.433 ? ? 10 1 0.910 ? 5.800 6.110 ? 5.050 ? ? ? ? 192 99.500 ? ? ? ? 0.363 ? ? ? ? ? ? ? ? 6.271 ? ? ? ? 0.396 ? ? 11 1 0.944 ? 6.110 6.480 ? 6.930 ? ? ? ? 170 100.000 ? ? ? ? 0.246 ? ? ? ? ? ? ? ? 6.265 ? ? ? ? 0.269 ? ? 12 1 0.953 ? 6.480 6.930 ? 8.920 ? ? ? ? 168 99.400 ? ? ? ? 0.150 ? ? ? ? ? ? ? ? 6.208 ? ? ? ? 0.163 ? ? 13 1 0.989 ? 6.930 7.480 ? 11.250 ? ? ? ? 151 100.000 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 6.358 ? ? ? ? 0.127 ? ? 14 1 0.990 ? 7.480 8.200 ? 11.890 ? ? ? ? 151 98.700 ? ? ? ? 0.109 ? ? ? ? ? ? ? ? 5.490 ? ? ? ? 0.120 ? ? 15 1 0.990 ? 8.200 9.160 ? 14.480 ? ? ? ? 129 100.000 ? ? ? ? 0.096 ? ? ? ? ? ? ? ? 6.744 ? ? ? ? 0.104 ? ? 16 1 0.992 ? 9.160 10.580 ? 14.730 ? ? ? ? 111 99.100 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 6.577 ? ? ? ? 0.105 ? ? 17 1 0.992 ? 10.580 12.960 ? 15.470 ? ? ? ? 101 99.000 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 6.277 ? ? ? ? 0.081 ? ? 18 1 0.994 ? 12.960 18.330 ? 14.520 ? ? ? ? 79 97.500 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 5.608 ? ? ? ? 0.088 ? ? 19 1 0.991 ? 18.330 97.850 ? 15.680 ? ? ? ? 49 94.200 ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 6.102 ? ? ? ? 0.078 ? ? 20 1 1.000 ? # _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.0000 _refine.B_iso_max 300.000 _refine.B_iso_mean 267.2400 _refine.B_iso_min 209.820 _refine.correlation_coeff_Fo_to_Fc 0.9200 _refine.correlation_coeff_Fo_to_Fc_free 0.8370 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5VL4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 4.1000 _refine.ls_d_res_low 97.8500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3551 _refine.ls_number_reflns_R_free 355 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.0000 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2150 _refine.ls_R_factor_R_free 0.2640 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2100 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1NOG _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI 0.6120 _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5VL4 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.540 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 4.1000 _refine_hist.d_res_low 97.8500 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1179 _refine_hist.pdbx_number_residues_total 149 _refine_hist.pdbx_number_atoms_protein 1179 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 437 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 29 ? t_trig_c_planes 2.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 172 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1195 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 159 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1536 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.011 ? 1195 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.240 ? 1614 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 2.460 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 23.240 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 4.1000 _refine_ls_shell.d_res_low 4.5800 _refine_ls_shell.number_reflns_all 990 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 99 _refine_ls_shell.number_reflns_R_work 891 _refine_ls_shell.percent_reflns_obs 98.9000 _refine_ls_shell.percent_reflns_R_free 10.0000 _refine_ls_shell.R_factor_all 0.2839 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3242 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2792 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5VL4 _struct.title 'Accidental minimum contact crystal lattice formed by a redesigned protein oligomer' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5VL4 _struct_keywords.text 'BIONANOTECHNOLOGY, SYMMETRY, BIOMATERIALS, DE NOVO PROTEIN, COMPUTATIONAL DESIGN, ROSETTA, SELF-ASSEMBLY, NANOMATERIAL, SOLUBILITY' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 25 ? SER A 46 ? VAL A 3 SER A 24 1 ? 22 HELX_P HELX_P2 AA2 TRP A 48 ? THR A 71 ? TRP A 26 THR A 49 1 ? 24 HELX_P HELX_P3 AA3 THR A 79 ? GLY A 98 ? THR A 57 GLY A 76 1 ? 20 HELX_P HELX_P4 AA4 SER A 109 ? THR A 136 ? SER A 87 THR A 114 1 ? 28 HELX_P HELX_P5 AA5 ASN A 139 ? LEU A 164 ? ASN A 117 LEU A 142 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 5VL4 _atom_sites.fract_transf_matrix[1][1] 0.007226 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007226 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007226 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -21 ? ? ? A . n A 1 2 PHE 2 -20 ? ? ? A . n A 1 3 THR 3 -19 ? ? ? A . n A 1 4 ARG 4 -18 ? ? ? A . n A 1 5 ARG 5 -17 ? ? ? A . n A 1 6 GLY 6 -16 ? ? ? A . n A 1 7 ASP 7 -15 ? ? ? A . n A 1 8 GLN 8 -14 ? ? ? A . n A 1 9 GLY 9 -13 ? ? ? A . n A 1 10 GLU 10 -12 ? ? ? A . n A 1 11 THR 11 -11 ? ? ? A . n A 1 12 ASP 12 -10 ? ? ? A . n A 1 13 LEU 13 -9 ? ? ? A . n A 1 14 ALA 14 -8 ? ? ? A . n A 1 15 ASN 15 -7 ? ? ? A . n A 1 16 ARG 16 -6 ? ? ? A . n A 1 17 ALA 17 -5 ? ? ? A . n A 1 18 ARG 18 -4 ? ? ? A . n A 1 19 VAL 19 -3 ? ? ? A . n A 1 20 GLY 20 -2 ? ? ? A . n A 1 21 LYS 21 -1 ? ? ? A . n A 1 22 ASP 22 0 ? ? ? A . n A 1 23 SER 23 1 1 SER SER A . n A 1 24 PRO 24 2 2 PRO PRO A . n A 1 25 VAL 25 3 3 VAL VAL A . n A 1 26 VAL 26 4 4 VAL VAL A . n A 1 27 GLU 27 5 5 GLU GLU A . n A 1 28 VAL 28 6 6 VAL VAL A . n A 1 29 GLN 29 7 7 GLN GLN A . n A 1 30 GLY 30 8 8 GLY GLY A . n A 1 31 THR 31 9 9 THR THR A . n A 1 32 ILE 32 10 10 ILE ILE A . n A 1 33 ASP 33 11 11 ASP ASP A . n A 1 34 GLU 34 12 12 GLU GLU A . n A 1 35 LEU 35 13 13 LEU LEU A . n A 1 36 ASN 36 14 14 ASN ASN A . n A 1 37 SER 37 15 15 SER SER A . n A 1 38 PHE 38 16 16 PHE PHE A . n A 1 39 ILE 39 17 17 ILE ILE A . n A 1 40 GLY 40 18 18 GLY GLY A . n A 1 41 TYR 41 19 19 TYR TYR A . n A 1 42 ALA 42 20 20 ALA ALA A . n A 1 43 LEU 43 21 21 LEU LEU A . n A 1 44 VAL 44 22 22 VAL VAL A . n A 1 45 LEU 45 23 23 LEU LEU A . n A 1 46 SER 46 24 24 SER SER A . n A 1 47 ARG 47 25 25 ARG ARG A . n A 1 48 TRP 48 26 26 TRP TRP A . n A 1 49 ASP 49 27 27 ASP ASP A . n A 1 50 ASP 50 28 28 ASP ASP A . n A 1 51 ILE 51 29 29 ILE ILE A . n A 1 52 ARG 52 30 30 ARG ARG A . n A 1 53 ASN 53 31 31 ASN ASN A . n A 1 54 ASP 54 32 32 ASP ASP A . n A 1 55 LEU 55 33 33 LEU LEU A . n A 1 56 PHE 56 34 34 PHE PHE A . n A 1 57 ARG 57 35 35 ARG ARG A . n A 1 58 ILE 58 36 36 ILE ILE A . n A 1 59 GLN 59 37 37 GLN GLN A . n A 1 60 ASN 60 38 38 ASN ASN A . n A 1 61 ASP 61 39 39 ASP ASP A . n A 1 62 LEU 62 40 40 LEU LEU A . n A 1 63 PHE 63 41 41 PHE PHE A . n A 1 64 VAL 64 42 42 VAL VAL A . n A 1 65 LEU 65 43 43 LEU LEU A . n A 1 66 GLY 66 44 44 GLY GLY A . n A 1 67 GLU 67 45 45 GLU GLU A . n A 1 68 ASP 68 46 46 ASP ASP A . n A 1 69 VAL 69 47 47 VAL VAL A . n A 1 70 SER 70 48 48 SER SER A . n A 1 71 THR 71 49 49 THR THR A . n A 1 72 GLY 72 50 50 GLY GLY A . n A 1 73 GLY 73 51 51 GLY GLY A . n A 1 74 LYS 74 52 52 LYS LYS A . n A 1 75 GLY 75 53 53 GLY GLY A . n A 1 76 ARG 76 54 54 ARG ARG A . n A 1 77 THR 77 55 55 THR THR A . n A 1 78 VAL 78 56 56 VAL VAL A . n A 1 79 THR 79 57 57 THR THR A . n A 1 80 LEU 80 58 58 LEU LEU A . n A 1 81 GLU 81 59 59 GLU GLU A . n A 1 82 MET 82 60 60 MET MET A . n A 1 83 ILE 83 61 61 ILE ILE A . n A 1 84 LEU 84 62 62 LEU LEU A . n A 1 85 TYR 85 63 63 TYR TYR A . n A 1 86 LEU 86 64 64 LEU LEU A . n A 1 87 VAL 87 65 65 VAL VAL A . n A 1 88 GLU 88 66 66 GLU GLU A . n A 1 89 ARG 89 67 67 ARG ARG A . n A 1 90 VAL 90 68 68 VAL VAL A . n A 1 91 THR 91 69 69 THR THR A . n A 1 92 GLU 92 70 70 GLU GLU A . n A 1 93 MET 93 71 71 MET MET A . n A 1 94 LYS 94 72 72 LYS LYS A . n A 1 95 ALA 95 73 73 ALA ALA A . n A 1 96 GLU 96 74 74 GLU GLU A . n A 1 97 ILE 97 75 75 ILE ILE A . n A 1 98 GLY 98 76 76 GLY GLY A . n A 1 99 LYS 99 77 77 LYS LYS A . n A 1 100 ILE 100 78 78 ILE ILE A . n A 1 101 GLU 101 79 79 GLU GLU A . n A 1 102 LEU 102 80 80 LEU LEU A . n A 1 103 PHE 103 81 81 PHE PHE A . n A 1 104 VAL 104 82 82 VAL VAL A . n A 1 105 VAL 105 83 83 VAL VAL A . n A 1 106 PRO 106 84 84 PRO PRO A . n A 1 107 GLY 107 85 85 GLY GLY A . n A 1 108 GLY 108 86 86 GLY GLY A . n A 1 109 SER 109 87 87 SER SER A . n A 1 110 VAL 110 88 88 VAL VAL A . n A 1 111 GLU 111 89 89 GLU GLU A . n A 1 112 SER 112 90 90 SER SER A . n A 1 113 ALA 113 91 91 ALA ALA A . n A 1 114 SER 114 92 92 SER SER A . n A 1 115 LEU 115 93 93 LEU LEU A . n A 1 116 HIS 116 94 94 HIS HIS A . n A 1 117 MET 117 95 95 MET MET A . n A 1 118 ALA 118 96 96 ALA ALA A . n A 1 119 ARG 119 97 97 ARG ARG A . n A 1 120 ALA 120 98 98 ALA ALA A . n A 1 121 VAL 121 99 99 VAL VAL A . n A 1 122 SER 122 100 100 SER SER A . n A 1 123 ARG 123 101 101 ARG ARG A . n A 1 124 ARG 124 102 102 ARG ARG A . n A 1 125 LEU 125 103 103 LEU LEU A . n A 1 126 GLU 126 104 104 GLU GLU A . n A 1 127 ARG 127 105 105 ARG ARG A . n A 1 128 ARG 128 106 106 ARG ARG A . n A 1 129 ILE 129 107 107 ILE ILE A . n A 1 130 LYS 130 108 108 LYS LYS A . n A 1 131 ALA 131 109 109 ALA ALA A . n A 1 132 ALA 132 110 110 ALA ALA A . n A 1 133 SER 133 111 111 SER SER A . n A 1 134 ARG 134 112 112 ARG ARG A . n A 1 135 LEU 135 113 113 LEU LEU A . n A 1 136 THR 136 114 114 THR THR A . n A 1 137 GLU 137 115 115 GLU GLU A . n A 1 138 ILE 138 116 116 ILE ILE A . n A 1 139 ASN 139 117 117 ASN ASN A . n A 1 140 ASP 140 118 118 ASP ASP A . n A 1 141 ASN 141 119 119 ASN ASN A . n A 1 142 VAL 142 120 120 VAL VAL A . n A 1 143 LEU 143 121 121 LEU LEU A . n A 1 144 LEU 144 122 122 LEU LEU A . n A 1 145 TYR 145 123 123 TYR TYR A . n A 1 146 ALA 146 124 124 ALA ALA A . n A 1 147 ALA 147 125 125 ALA ALA A . n A 1 148 MET 148 126 126 MET MET A . n A 1 149 LEU 149 127 127 LEU LEU A . n A 1 150 SER 150 128 128 SER SER A . n A 1 151 SER 151 129 129 SER SER A . n A 1 152 ILE 152 130 130 ILE ILE A . n A 1 153 LEU 153 131 131 LEU LEU A . n A 1 154 PHE 154 132 132 PHE PHE A . n A 1 155 MET 155 133 133 MET MET A . n A 1 156 HIS 156 134 134 HIS HIS A . n A 1 157 ALA 157 135 135 ALA ALA A . n A 1 158 LEU 158 136 136 LEU LEU A . n A 1 159 ILE 159 137 137 ILE ILE A . n A 1 160 SER 160 138 138 SER SER A . n A 1 161 ASN 161 139 139 ASN ASN A . n A 1 162 LYS 162 140 140 LYS LYS A . n A 1 163 ARG 163 141 141 ARG ARG A . n A 1 164 LEU 164 142 142 LEU LEU A . n A 1 165 ASN 165 143 143 ASN ASN A . n A 1 166 ILE 166 144 144 ILE ILE A . n A 1 167 PRO 167 145 145 PRO PRO A . n A 1 168 GLU 168 146 146 GLU GLU A . n A 1 169 LYS 169 147 147 LYS LYS A . n A 1 170 ILE 170 148 148 ILE ILE A . n A 1 171 TRP 171 149 149 TRP TRP A . n A 1 172 SER 172 150 ? ? ? A . n A 1 173 ILE 173 151 ? ? ? A . n A 1 174 HIS 174 152 ? ? ? A . n A 1 175 ARG 175 153 ? ? ? A . n A 1 176 VAL 176 154 ? ? ? A . n A 1 177 SER 177 155 ? ? ? A . n A 1 178 LEU 178 156 ? ? ? A . n A 1 179 GLU 179 157 ? ? ? A . n A 1 180 HIS 180 158 ? ? ? A . n A 1 181 HIS 181 159 ? ? ? A . n A 1 182 HIS 182 160 ? ? ? A . n A 1 183 HIS 183 161 ? ? ? A . n A 1 184 HIS 184 162 ? ? ? A . n A 1 185 HIS 185 163 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_455 -x-1/2,-y,z+1/2 -1.0000000000 0.0000000000 0.0000000000 -69.1900000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 69.1900000000 3 'crystal symmetry operation' 3_554 -x,y+1/2,-z-1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 69.1900000000 0.0000000000 0.0000000000 -1.0000000000 -69.1900000000 4 'crystal symmetry operation' 4_545 x+1/2,-y-1/2,-z 1.0000000000 0.0000000000 0.0000000000 69.1900000000 0.0000000000 -1.0000000000 0.0000000000 -69.1900000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_545 z+1/2,-x-1/2,-y 0.0000000000 0.0000000000 1.0000000000 69.1900000000 -1.0000000000 0.0000000000 0.0000000000 -69.1900000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_455 -z-1/2,-x,y+1/2 0.0000000000 0.0000000000 -1.0000000000 -69.1900000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 69.1900000000 8 'crystal symmetry operation' 8_554 -z,x+1/2,-y-1/2 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 69.1900000000 0.0000000000 -1.0000000000 0.0000000000 -69.1900000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_554 -y,z+1/2,-x-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 69.1900000000 -1.0000000000 0.0000000000 0.0000000000 -69.1900000000 11 'crystal symmetry operation' 11_545 y+1/2,-z-1/2,-x 0.0000000000 1.0000000000 0.0000000000 69.1900000000 0.0000000000 0.0000000000 -1.0000000000 -69.1900000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_455 -y-1/2,-z,x+1/2 0.0000000000 -1.0000000000 0.0000000000 -69.1900000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 69.1900000000 13 'crystal symmetry operation' 13_455 x-1/2,y+1/2,z+1/2 1.0000000000 0.0000000000 0.0000000000 -69.1900000000 0.0000000000 1.0000000000 0.0000000000 69.1900000000 0.0000000000 0.0000000000 1.0000000000 69.1900000000 14 'crystal symmetry operation' 14_545 -x,-y-1/2,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -69.1900000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_455 -x-1/2,y,-z -1.0000000000 0.0000000000 0.0000000000 -69.1900000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_554 x,-y,-z-1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -69.1900000000 17 'crystal symmetry operation' 17_455 z-1/2,x+1/2,y+1/2 0.0000000000 0.0000000000 1.0000000000 -69.1900000000 1.0000000000 0.0000000000 0.0000000000 69.1900000000 0.0000000000 1.0000000000 0.0000000000 69.1900000000 18 'crystal symmetry operation' 18_554 z,-x,-y-1/2 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -69.1900000000 19 'crystal symmetry operation' 19_545 -z,-x-1/2,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -69.1900000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_455 -z-1/2,x,-y 0.0000000000 0.0000000000 -1.0000000000 -69.1900000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_455 y-1/2,z+1/2,x+1/2 0.0000000000 1.0000000000 0.0000000000 -69.1900000000 0.0000000000 0.0000000000 1.0000000000 69.1900000000 1.0000000000 0.0000000000 0.0000000000 69.1900000000 22 'crystal symmetry operation' 22_455 -y-1/2,z,-x 0.0000000000 -1.0000000000 0.0000000000 -69.1900000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_554 y,-z,-x-1/2 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -69.1900000000 24 'crystal symmetry operation' 24_545 -y,-z-1/2,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -69.1900000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-23 2 'Structure model' 1 1 2020-09-02 3 'Structure model' 1 2 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -32.2601 _pdbx_refine_tls.origin_y -18.1027 _pdbx_refine_tls.origin_z -12.0729 _pdbx_refine_tls.T[1][1] -0.1781 _pdbx_refine_tls.T[2][2] 0.0840 _pdbx_refine_tls.T[3][3] 0.2918 _pdbx_refine_tls.T[1][2] -0.0459 _pdbx_refine_tls.T[1][3] 0.0892 _pdbx_refine_tls.T[2][3] 0.1678 _pdbx_refine_tls.L[1][1] 1.7280 _pdbx_refine_tls.L[2][2] 3.9771 _pdbx_refine_tls.L[3][3] 4.2493 _pdbx_refine_tls.L[1][2] 1.3039 _pdbx_refine_tls.L[1][3] -3.8645 _pdbx_refine_tls.L[2][3] -1.0559 _pdbx_refine_tls.S[1][1] 0.0033 _pdbx_refine_tls.S[2][2] 0.0580 _pdbx_refine_tls.S[3][3] -0.0613 _pdbx_refine_tls.S[1][2] 0.0099 _pdbx_refine_tls.S[1][3] 0.0201 _pdbx_refine_tls.S[2][3] 0.1010 _pdbx_refine_tls.S[2][1] -0.0143 _pdbx_refine_tls.S[3][1] -0.1104 _pdbx_refine_tls.S[3][2] 0.0272 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 149 _pdbx_refine_tls_group.selection_details '{ A|* }' _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.3 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 54 ? ? -56.56 89.15 2 1 LYS A 77 ? ? -64.04 99.80 3 1 LEU A 113 ? ? -78.85 -71.39 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -21 ? A MET 1 2 1 Y 1 A PHE -20 ? A PHE 2 3 1 Y 1 A THR -19 ? A THR 3 4 1 Y 1 A ARG -18 ? A ARG 4 5 1 Y 1 A ARG -17 ? A ARG 5 6 1 Y 1 A GLY -16 ? A GLY 6 7 1 Y 1 A ASP -15 ? A ASP 7 8 1 Y 1 A GLN -14 ? A GLN 8 9 1 Y 1 A GLY -13 ? A GLY 9 10 1 Y 1 A GLU -12 ? A GLU 10 11 1 Y 1 A THR -11 ? A THR 11 12 1 Y 1 A ASP -10 ? A ASP 12 13 1 Y 1 A LEU -9 ? A LEU 13 14 1 Y 1 A ALA -8 ? A ALA 14 15 1 Y 1 A ASN -7 ? A ASN 15 16 1 Y 1 A ARG -6 ? A ARG 16 17 1 Y 1 A ALA -5 ? A ALA 17 18 1 Y 1 A ARG -4 ? A ARG 18 19 1 Y 1 A VAL -3 ? A VAL 19 20 1 Y 1 A GLY -2 ? A GLY 20 21 1 Y 1 A LYS -1 ? A LYS 21 22 1 Y 1 A ASP 0 ? A ASP 22 23 1 Y 1 A SER 150 ? A SER 172 24 1 Y 1 A ILE 151 ? A ILE 173 25 1 Y 1 A HIS 152 ? A HIS 174 26 1 Y 1 A ARG 153 ? A ARG 175 27 1 Y 1 A VAL 154 ? A VAL 176 28 1 Y 1 A SER 155 ? A SER 177 29 1 Y 1 A LEU 156 ? A LEU 178 30 1 Y 1 A GLU 157 ? A GLU 179 31 1 Y 1 A HIS 158 ? A HIS 180 32 1 Y 1 A HIS 159 ? A HIS 181 33 1 Y 1 A HIS 160 ? A HIS 182 34 1 Y 1 A HIS 161 ? A HIS 183 35 1 Y 1 A HIS 162 ? A HIS 184 36 1 Y 1 A HIS 163 ? A HIS 185 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1NOG _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #