data_5WAQ # _entry.id 5WAQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5WAQ pdb_00005waq 10.2210/pdb5waq/pdb WWPDB D_1000228686 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5WAM _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5WAQ _pdbx_database_status.recvd_initial_deposition_date 2017-06-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Korotkov, K.V.' 1 ? 'Buchanan, S.K.' 2 ? 'Noinaj, N.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 293 _citation.language ? _citation.page_first 1106 _citation.page_last 1119 _citation.title ;Structural and functional insights into the role of BamD and BamE within the beta-barrel assembly machinery in Neisseria gonorrhoeae. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA117.000437 _citation.pdbx_database_id_PubMed 29229778 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sikora, A.E.' 1 ? primary 'Wierzbicki, I.H.' 2 ? primary 'Zielke, R.A.' 3 ? primary 'Ryner, R.F.' 4 ? primary 'Korotkov, K.V.' 5 ? primary 'Buchanan, S.K.' 6 ? primary 'Noinaj, N.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5WAQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 64.415 _cell.length_a_esd ? _cell.length_b 64.415 _cell.length_b_esd ? _cell.length_c 166.392 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5WAQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Outer membrane protein assembly factor BamD' 29193.723 1 ? ? ? ? 2 water nat water 18.015 13 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GATQGTADKDAQITQDWSVEKLYAEAQDELNSSNYTRAVKLYEILESRFPTSRHARQSQLDTAYAYYKDDEKDKALAAIE RFRRLHPQHPNMDYALYLRGLVLFNEDQSFLNKLASQDWSDRDPKANREAYQAFAELVQRFPNSKYAADATARMVKLVDA LGGNEMSVARYYMKRGAYIAAANRAKKIIGSYQNTRYVEESLAILELAYKKLDKPQLAADTRRVLETNFPKSPFLTHAWQ PDDMPWWRYWH ; _entity_poly.pdbx_seq_one_letter_code_can ;GATQGTADKDAQITQDWSVEKLYAEAQDELNSSNYTRAVKLYEILESRFPTSRHARQSQLDTAYAYYKDDEKDKALAAIE RFRRLHPQHPNMDYALYLRGLVLFNEDQSFLNKLASQDWSDRDPKANREAYQAFAELVQRFPNSKYAADATARMVKLVDA LGGNEMSVARYYMKRGAYIAAANRAKKIIGSYQNTRYVEESLAILELAYKKLDKPQLAADTRRVLETNFPKSPFLTHAWQ PDDMPWWRYWH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 THR n 1 4 GLN n 1 5 GLY n 1 6 THR n 1 7 ALA n 1 8 ASP n 1 9 LYS n 1 10 ASP n 1 11 ALA n 1 12 GLN n 1 13 ILE n 1 14 THR n 1 15 GLN n 1 16 ASP n 1 17 TRP n 1 18 SER n 1 19 VAL n 1 20 GLU n 1 21 LYS n 1 22 LEU n 1 23 TYR n 1 24 ALA n 1 25 GLU n 1 26 ALA n 1 27 GLN n 1 28 ASP n 1 29 GLU n 1 30 LEU n 1 31 ASN n 1 32 SER n 1 33 SER n 1 34 ASN n 1 35 TYR n 1 36 THR n 1 37 ARG n 1 38 ALA n 1 39 VAL n 1 40 LYS n 1 41 LEU n 1 42 TYR n 1 43 GLU n 1 44 ILE n 1 45 LEU n 1 46 GLU n 1 47 SER n 1 48 ARG n 1 49 PHE n 1 50 PRO n 1 51 THR n 1 52 SER n 1 53 ARG n 1 54 HIS n 1 55 ALA n 1 56 ARG n 1 57 GLN n 1 58 SER n 1 59 GLN n 1 60 LEU n 1 61 ASP n 1 62 THR n 1 63 ALA n 1 64 TYR n 1 65 ALA n 1 66 TYR n 1 67 TYR n 1 68 LYS n 1 69 ASP n 1 70 ASP n 1 71 GLU n 1 72 LYS n 1 73 ASP n 1 74 LYS n 1 75 ALA n 1 76 LEU n 1 77 ALA n 1 78 ALA n 1 79 ILE n 1 80 GLU n 1 81 ARG n 1 82 PHE n 1 83 ARG n 1 84 ARG n 1 85 LEU n 1 86 HIS n 1 87 PRO n 1 88 GLN n 1 89 HIS n 1 90 PRO n 1 91 ASN n 1 92 MET n 1 93 ASP n 1 94 TYR n 1 95 ALA n 1 96 LEU n 1 97 TYR n 1 98 LEU n 1 99 ARG n 1 100 GLY n 1 101 LEU n 1 102 VAL n 1 103 LEU n 1 104 PHE n 1 105 ASN n 1 106 GLU n 1 107 ASP n 1 108 GLN n 1 109 SER n 1 110 PHE n 1 111 LEU n 1 112 ASN n 1 113 LYS n 1 114 LEU n 1 115 ALA n 1 116 SER n 1 117 GLN n 1 118 ASP n 1 119 TRP n 1 120 SER n 1 121 ASP n 1 122 ARG n 1 123 ASP n 1 124 PRO n 1 125 LYS n 1 126 ALA n 1 127 ASN n 1 128 ARG n 1 129 GLU n 1 130 ALA n 1 131 TYR n 1 132 GLN n 1 133 ALA n 1 134 PHE n 1 135 ALA n 1 136 GLU n 1 137 LEU n 1 138 VAL n 1 139 GLN n 1 140 ARG n 1 141 PHE n 1 142 PRO n 1 143 ASN n 1 144 SER n 1 145 LYS n 1 146 TYR n 1 147 ALA n 1 148 ALA n 1 149 ASP n 1 150 ALA n 1 151 THR n 1 152 ALA n 1 153 ARG n 1 154 MET n 1 155 VAL n 1 156 LYS n 1 157 LEU n 1 158 VAL n 1 159 ASP n 1 160 ALA n 1 161 LEU n 1 162 GLY n 1 163 GLY n 1 164 ASN n 1 165 GLU n 1 166 MET n 1 167 SER n 1 168 VAL n 1 169 ALA n 1 170 ARG n 1 171 TYR n 1 172 TYR n 1 173 MET n 1 174 LYS n 1 175 ARG n 1 176 GLY n 1 177 ALA n 1 178 TYR n 1 179 ILE n 1 180 ALA n 1 181 ALA n 1 182 ALA n 1 183 ASN n 1 184 ARG n 1 185 ALA n 1 186 LYS n 1 187 LYS n 1 188 ILE n 1 189 ILE n 1 190 GLY n 1 191 SER n 1 192 TYR n 1 193 GLN n 1 194 ASN n 1 195 THR n 1 196 ARG n 1 197 TYR n 1 198 VAL n 1 199 GLU n 1 200 GLU n 1 201 SER n 1 202 LEU n 1 203 ALA n 1 204 ILE n 1 205 LEU n 1 206 GLU n 1 207 LEU n 1 208 ALA n 1 209 TYR n 1 210 LYS n 1 211 LYS n 1 212 LEU n 1 213 ASP n 1 214 LYS n 1 215 PRO n 1 216 GLN n 1 217 LEU n 1 218 ALA n 1 219 ALA n 1 220 ASP n 1 221 THR n 1 222 ARG n 1 223 ARG n 1 224 VAL n 1 225 LEU n 1 226 GLU n 1 227 THR n 1 228 ASN n 1 229 PHE n 1 230 PRO n 1 231 LYS n 1 232 SER n 1 233 PRO n 1 234 PHE n 1 235 LEU n 1 236 THR n 1 237 HIS n 1 238 ALA n 1 239 TRP n 1 240 GLN n 1 241 PRO n 1 242 ASP n 1 243 ASP n 1 244 MET n 1 245 PRO n 1 246 TRP n 1 247 TRP n 1 248 ARG n 1 249 TYR n 1 250 TRP n 1 251 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 251 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'bamD, NGO_0277' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700825 / FA 1090' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 242231 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET20bHT _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5F9W0_NEIG1 _struct_ref.pdbx_db_accession Q5F9W0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATQGTADKDAQITQDWSVEKLYAEAQDELNSSNYTRAVKLYEILESRFPTSRHARQSQLDTAYAYYKDDEKDKALAAIER FRRLHPQHPNMDYALYLRGLVLFNEDQSFLNKLASQDWSDRDPKANREAYQAFAELVQRFPNSKYAADATARMVKLVDAL GGNEMSVARYYMKRGAYIAAANRAKKIIGSYQNTRYVEESLAILELAYKKLDKPQLAADTRRVLETNFPKSPFLTHAWQP DDMPWWRYWH ; _struct_ref.pdbx_align_begin 18 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5WAQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 251 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5F9W0 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 267 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 18 _struct_ref_seq.pdbx_auth_seq_align_end 267 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5WAQ _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q5F9W0 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 17 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5WAQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.96 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.0M LITHIUM CHLORIDE, 0.1M HEPES PH 7.0, 10% PEG6000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-06-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double crystal cryo-cooled' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 74.450 _reflns.entry_id 5WAQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.500 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12840 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.100 _reflns.pdbx_Rmerge_I_obs 0.104 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.036 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.112 _reflns.pdbx_Rpim_I_all 0.040 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.500 2.590 ? ? ? ? ? 1239 ? 100.000 ? ? ? ? 2.300 ? ? ? ? ? ? ? ? 8.800 ? 1.017 ? ? 2.443 0.813 ? 1 1 0.500 ? 2.590 2.690 ? ? ? ? ? ? ? 100.000 ? ? ? ? 1.520 ? ? ? ? ? ? ? ? 8.600 ? 1.028 ? ? 1.616 0.542 ? 2 1 0.727 ? 2.690 2.820 ? ? ? ? ? ? ? 100.000 ? ? ? ? 1.116 ? ? ? ? ? ? ? ? 8.500 ? 1.085 ? ? 1.187 0.402 ? 3 1 0.772 ? 2.820 2.960 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.655 ? ? ? ? ? ? ? ? 8.000 ? 1.099 ? ? 0.700 0.243 ? 4 1 0.915 ? 2.960 3.150 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.424 ? ? ? ? ? ? ? ? 8.400 ? 1.069 ? ? 0.452 0.154 ? 5 1 0.954 ? 3.150 3.390 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.263 ? ? ? ? ? ? ? ? 8.500 ? 1.071 ? ? 0.281 0.095 ? 6 1 0.980 ? 3.390 3.730 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.150 ? ? ? ? ? ? ? ? 8.000 ? 1.004 ? ? 0.161 0.056 ? 7 1 0.989 ? 3.730 4.270 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.105 ? ? ? ? ? ? ? ? 7.700 ? 0.989 ? ? 0.113 0.040 ? 8 1 0.991 ? 4.270 5.380 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 7.700 ? 1.049 ? ? 0.088 0.031 ? 9 1 0.994 ? 5.380 50.000 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 7.000 ? 0.943 ? ? 0.059 0.022 ? 10 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 202.230 _refine.B_iso_mean 91.47 _refine.B_iso_min 46.030 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5WAQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5010 _refine.ls_d_res_low 45.5480 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12773 _refine.ls_number_reflns_R_free 1277 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8400 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2404 _refine.ls_R_factor_R_free 0.2862 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2355 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2YHC _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'RANDOM SELECTION' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.0100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.5010 _refine_hist.d_res_low 45.5480 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1746 _refine_hist.pdbx_number_residues_total 212 _refine_hist.pdbx_B_iso_mean_solvent 69.33 _refine_hist.pdbx_number_atoms_protein 1733 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1771 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.392 ? 2393 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.032 ? 252 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 312 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 19.755 ? 1084 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5014 2.6015 1385 . 139 1246 100.0000 . . . 0.3567 0.0000 0.3605 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.6015 2.7199 1359 . 135 1224 100.0000 . . . 0.4027 0.0000 0.3400 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.7199 2.8633 1389 . 139 1250 100.0000 . . . 0.3339 0.0000 0.3400 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.8633 3.0427 1403 . 141 1262 100.0000 . . . 0.3270 0.0000 0.3171 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 3.0427 3.2775 1392 . 139 1253 100.0000 . . . 0.3675 0.0000 0.3034 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 3.2775 3.6072 1417 . 142 1275 100.0000 . . . 0.3458 0.0000 0.2769 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 3.6072 4.1289 1417 . 141 1276 100.0000 . . . 0.3056 0.0000 0.2443 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 4.1289 5.2008 1445 . 144 1301 100.0000 . . . 0.2217 0.0000 0.2180 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 5.2008 45.5558 1566 . 157 1409 100.0000 . . . 0.2625 0.0000 0.1842 . . . . . . 9 . . . # _struct.entry_id 5WAQ _struct.title 'Structure of BamD from Neisseria gonorrhoeae' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5WAQ _struct_keywords.text 'beta-barrel assembly machinery, BAM complex, lipoprotein, tetratrico peptide repeat, TPR domain, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 18 ? SER A 32 ? SER A 34 SER A 48 1 ? 15 HELX_P HELX_P2 AA2 ASN A 34 ? PHE A 49 ? ASN A 50 PHE A 65 1 ? 16 HELX_P HELX_P3 AA3 SER A 52 ? ASP A 69 ? SER A 68 ASP A 85 1 ? 18 HELX_P HELX_P4 AA4 GLU A 71 ? HIS A 86 ? GLU A 87 HIS A 102 1 ? 16 HELX_P HELX_P5 AA5 ASN A 91 ? PHE A 104 ? ASN A 107 PHE A 120 1 ? 14 HELX_P HELX_P6 AA6 PRO A 124 ? PHE A 141 ? PRO A 140 PHE A 157 1 ? 18 HELX_P HELX_P7 AA7 TYR A 146 ? ARG A 175 ? TYR A 162 ARG A 191 1 ? 30 HELX_P HELX_P8 AA8 ALA A 177 ? TYR A 192 ? ALA A 193 TYR A 208 1 ? 16 HELX_P HELX_P9 AA9 TYR A 197 ? LEU A 212 ? TYR A 213 LEU A 228 1 ? 16 HELX_P HELX_P10 AB1 LYS A 214 ? PHE A 229 ? LYS A 230 PHE A 245 1 ? 16 HELX_P HELX_P11 AB2 SER A 232 ? HIS A 237 ? SER A 248 HIS A 253 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 5WAQ _atom_sites.fract_transf_matrix[1][1] 0.015524 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015524 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006010 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 17 ? ? ? A . n A 1 2 ALA 2 18 ? ? ? A . n A 1 3 THR 3 19 ? ? ? A . n A 1 4 GLN 4 20 ? ? ? A . n A 1 5 GLY 5 21 ? ? ? A . n A 1 6 THR 6 22 ? ? ? A . n A 1 7 ALA 7 23 ? ? ? A . n A 1 8 ASP 8 24 ? ? ? A . n A 1 9 LYS 9 25 ? ? ? A . n A 1 10 ASP 10 26 ? ? ? A . n A 1 11 ALA 11 27 ? ? ? A . n A 1 12 GLN 12 28 ? ? ? A . n A 1 13 ILE 13 29 ? ? ? A . n A 1 14 THR 14 30 30 THR THR A . n A 1 15 GLN 15 31 31 GLN GLN A . n A 1 16 ASP 16 32 32 ASP ASP A . n A 1 17 TRP 17 33 33 TRP TRP A . n A 1 18 SER 18 34 34 SER SER A . n A 1 19 VAL 19 35 35 VAL VAL A . n A 1 20 GLU 20 36 36 GLU GLU A . n A 1 21 LYS 21 37 37 LYS LYS A . n A 1 22 LEU 22 38 38 LEU LEU A . n A 1 23 TYR 23 39 39 TYR TYR A . n A 1 24 ALA 24 40 40 ALA ALA A . n A 1 25 GLU 25 41 41 GLU GLU A . n A 1 26 ALA 26 42 42 ALA ALA A . n A 1 27 GLN 27 43 43 GLN GLN A . n A 1 28 ASP 28 44 44 ASP ASP A . n A 1 29 GLU 29 45 45 GLU GLU A . n A 1 30 LEU 30 46 46 LEU LEU A . n A 1 31 ASN 31 47 47 ASN ASN A . n A 1 32 SER 32 48 48 SER SER A . n A 1 33 SER 33 49 49 SER SER A . n A 1 34 ASN 34 50 50 ASN ASN A . n A 1 35 TYR 35 51 51 TYR TYR A . n A 1 36 THR 36 52 52 THR THR A . n A 1 37 ARG 37 53 53 ARG ARG A . n A 1 38 ALA 38 54 54 ALA ALA A . n A 1 39 VAL 39 55 55 VAL VAL A . n A 1 40 LYS 40 56 56 LYS LYS A . n A 1 41 LEU 41 57 57 LEU LEU A . n A 1 42 TYR 42 58 58 TYR TYR A . n A 1 43 GLU 43 59 59 GLU GLU A . n A 1 44 ILE 44 60 60 ILE ILE A . n A 1 45 LEU 45 61 61 LEU LEU A . n A 1 46 GLU 46 62 62 GLU GLU A . n A 1 47 SER 47 63 63 SER SER A . n A 1 48 ARG 48 64 64 ARG ARG A . n A 1 49 PHE 49 65 65 PHE PHE A . n A 1 50 PRO 50 66 66 PRO PRO A . n A 1 51 THR 51 67 67 THR THR A . n A 1 52 SER 52 68 68 SER SER A . n A 1 53 ARG 53 69 69 ARG ARG A . n A 1 54 HIS 54 70 70 HIS HIS A . n A 1 55 ALA 55 71 71 ALA ALA A . n A 1 56 ARG 56 72 72 ARG ARG A . n A 1 57 GLN 57 73 73 GLN GLN A . n A 1 58 SER 58 74 74 SER SER A . n A 1 59 GLN 59 75 75 GLN GLN A . n A 1 60 LEU 60 76 76 LEU LEU A . n A 1 61 ASP 61 77 77 ASP ASP A . n A 1 62 THR 62 78 78 THR THR A . n A 1 63 ALA 63 79 79 ALA ALA A . n A 1 64 TYR 64 80 80 TYR TYR A . n A 1 65 ALA 65 81 81 ALA ALA A . n A 1 66 TYR 66 82 82 TYR TYR A . n A 1 67 TYR 67 83 83 TYR TYR A . n A 1 68 LYS 68 84 84 LYS LYS A . n A 1 69 ASP 69 85 85 ASP ASP A . n A 1 70 ASP 70 86 86 ASP ASP A . n A 1 71 GLU 71 87 87 GLU GLU A . n A 1 72 LYS 72 88 88 LYS LYS A . n A 1 73 ASP 73 89 89 ASP ASP A . n A 1 74 LYS 74 90 90 LYS LYS A . n A 1 75 ALA 75 91 91 ALA ALA A . n A 1 76 LEU 76 92 92 LEU LEU A . n A 1 77 ALA 77 93 93 ALA ALA A . n A 1 78 ALA 78 94 94 ALA ALA A . n A 1 79 ILE 79 95 95 ILE ILE A . n A 1 80 GLU 80 96 96 GLU GLU A . n A 1 81 ARG 81 97 97 ARG ARG A . n A 1 82 PHE 82 98 98 PHE PHE A . n A 1 83 ARG 83 99 99 ARG ARG A . n A 1 84 ARG 84 100 100 ARG ARG A . n A 1 85 LEU 85 101 101 LEU LEU A . n A 1 86 HIS 86 102 102 HIS HIS A . n A 1 87 PRO 87 103 103 PRO PRO A . n A 1 88 GLN 88 104 104 GLN GLN A . n A 1 89 HIS 89 105 105 HIS HIS A . n A 1 90 PRO 90 106 106 PRO PRO A . n A 1 91 ASN 91 107 107 ASN ASN A . n A 1 92 MET 92 108 108 MET MET A . n A 1 93 ASP 93 109 109 ASP ASP A . n A 1 94 TYR 94 110 110 TYR TYR A . n A 1 95 ALA 95 111 111 ALA ALA A . n A 1 96 LEU 96 112 112 LEU LEU A . n A 1 97 TYR 97 113 113 TYR TYR A . n A 1 98 LEU 98 114 114 LEU LEU A . n A 1 99 ARG 99 115 115 ARG ARG A . n A 1 100 GLY 100 116 116 GLY GLY A . n A 1 101 LEU 101 117 117 LEU LEU A . n A 1 102 VAL 102 118 118 VAL VAL A . n A 1 103 LEU 103 119 119 LEU LEU A . n A 1 104 PHE 104 120 120 PHE PHE A . n A 1 105 ASN 105 121 121 ASN ASN A . n A 1 106 GLU 106 122 122 GLU GLU A . n A 1 107 ASP 107 123 ? ? ? A . n A 1 108 GLN 108 124 ? ? ? A . n A 1 109 SER 109 125 ? ? ? A . n A 1 110 PHE 110 126 ? ? ? A . n A 1 111 LEU 111 127 ? ? ? A . n A 1 112 ASN 112 128 ? ? ? A . n A 1 113 LYS 113 129 ? ? ? A . n A 1 114 LEU 114 130 ? ? ? A . n A 1 115 ALA 115 131 ? ? ? A . n A 1 116 SER 116 132 ? ? ? A . n A 1 117 GLN 117 133 ? ? ? A . n A 1 118 ASP 118 134 ? ? ? A . n A 1 119 TRP 119 135 ? ? ? A . n A 1 120 SER 120 136 ? ? ? A . n A 1 121 ASP 121 137 ? ? ? A . n A 1 122 ARG 122 138 ? ? ? A . n A 1 123 ASP 123 139 139 ASP ASP A . n A 1 124 PRO 124 140 140 PRO PRO A . n A 1 125 LYS 125 141 141 LYS LYS A . n A 1 126 ALA 126 142 142 ALA ALA A . n A 1 127 ASN 127 143 143 ASN ASN A . n A 1 128 ARG 128 144 144 ARG ARG A . n A 1 129 GLU 129 145 145 GLU GLU A . n A 1 130 ALA 130 146 146 ALA ALA A . n A 1 131 TYR 131 147 147 TYR TYR A . n A 1 132 GLN 132 148 148 GLN GLN A . n A 1 133 ALA 133 149 149 ALA ALA A . n A 1 134 PHE 134 150 150 PHE PHE A . n A 1 135 ALA 135 151 151 ALA ALA A . n A 1 136 GLU 136 152 152 GLU GLU A . n A 1 137 LEU 137 153 153 LEU LEU A . n A 1 138 VAL 138 154 154 VAL VAL A . n A 1 139 GLN 139 155 155 GLN GLN A . n A 1 140 ARG 140 156 156 ARG ARG A . n A 1 141 PHE 141 157 157 PHE PHE A . n A 1 142 PRO 142 158 158 PRO PRO A . n A 1 143 ASN 143 159 159 ASN ASN A . n A 1 144 SER 144 160 160 SER SER A . n A 1 145 LYS 145 161 161 LYS LYS A . n A 1 146 TYR 146 162 162 TYR TYR A . n A 1 147 ALA 147 163 163 ALA ALA A . n A 1 148 ALA 148 164 164 ALA ALA A . n A 1 149 ASP 149 165 165 ASP ASP A . n A 1 150 ALA 150 166 166 ALA ALA A . n A 1 151 THR 151 167 167 THR THR A . n A 1 152 ALA 152 168 168 ALA ALA A . n A 1 153 ARG 153 169 169 ARG ARG A . n A 1 154 MET 154 170 170 MET MET A . n A 1 155 VAL 155 171 171 VAL VAL A . n A 1 156 LYS 156 172 172 LYS LYS A . n A 1 157 LEU 157 173 173 LEU LEU A . n A 1 158 VAL 158 174 174 VAL VAL A . n A 1 159 ASP 159 175 175 ASP ASP A . n A 1 160 ALA 160 176 176 ALA ALA A . n A 1 161 LEU 161 177 177 LEU LEU A . n A 1 162 GLY 162 178 178 GLY GLY A . n A 1 163 GLY 163 179 179 GLY GLY A . n A 1 164 ASN 164 180 180 ASN ASN A . n A 1 165 GLU 165 181 181 GLU GLU A . n A 1 166 MET 166 182 182 MET MET A . n A 1 167 SER 167 183 183 SER SER A . n A 1 168 VAL 168 184 184 VAL VAL A . n A 1 169 ALA 169 185 185 ALA ALA A . n A 1 170 ARG 170 186 186 ARG ARG A . n A 1 171 TYR 171 187 187 TYR TYR A . n A 1 172 TYR 172 188 188 TYR TYR A . n A 1 173 MET 173 189 189 MET MET A . n A 1 174 LYS 174 190 190 LYS LYS A . n A 1 175 ARG 175 191 191 ARG ARG A . n A 1 176 GLY 176 192 192 GLY GLY A . n A 1 177 ALA 177 193 193 ALA ALA A . n A 1 178 TYR 178 194 194 TYR TYR A . n A 1 179 ILE 179 195 195 ILE ILE A . n A 1 180 ALA 180 196 196 ALA ALA A . n A 1 181 ALA 181 197 197 ALA ALA A . n A 1 182 ALA 182 198 198 ALA ALA A . n A 1 183 ASN 183 199 199 ASN ASN A . n A 1 184 ARG 184 200 200 ARG ARG A . n A 1 185 ALA 185 201 201 ALA ALA A . n A 1 186 LYS 186 202 202 LYS LYS A . n A 1 187 LYS 187 203 203 LYS LYS A . n A 1 188 ILE 188 204 204 ILE ILE A . n A 1 189 ILE 189 205 205 ILE ILE A . n A 1 190 GLY 190 206 206 GLY GLY A . n A 1 191 SER 191 207 207 SER SER A . n A 1 192 TYR 192 208 208 TYR TYR A . n A 1 193 GLN 193 209 209 GLN GLN A . n A 1 194 ASN 194 210 210 ASN ASN A . n A 1 195 THR 195 211 211 THR THR A . n A 1 196 ARG 196 212 212 ARG ARG A . n A 1 197 TYR 197 213 213 TYR TYR A . n A 1 198 VAL 198 214 214 VAL VAL A . n A 1 199 GLU 199 215 215 GLU GLU A . n A 1 200 GLU 200 216 216 GLU GLU A . n A 1 201 SER 201 217 217 SER SER A . n A 1 202 LEU 202 218 218 LEU LEU A . n A 1 203 ALA 203 219 219 ALA ALA A . n A 1 204 ILE 204 220 220 ILE ILE A . n A 1 205 LEU 205 221 221 LEU LEU A . n A 1 206 GLU 206 222 222 GLU GLU A . n A 1 207 LEU 207 223 223 LEU LEU A . n A 1 208 ALA 208 224 224 ALA ALA A . n A 1 209 TYR 209 225 225 TYR TYR A . n A 1 210 LYS 210 226 226 LYS LYS A . n A 1 211 LYS 211 227 227 LYS LYS A . n A 1 212 LEU 212 228 228 LEU LEU A . n A 1 213 ASP 213 229 229 ASP ASP A . n A 1 214 LYS 214 230 230 LYS LYS A . n A 1 215 PRO 215 231 231 PRO PRO A . n A 1 216 GLN 216 232 232 GLN GLN A . n A 1 217 LEU 217 233 233 LEU LEU A . n A 1 218 ALA 218 234 234 ALA ALA A . n A 1 219 ALA 219 235 235 ALA ALA A . n A 1 220 ASP 220 236 236 ASP ASP A . n A 1 221 THR 221 237 237 THR THR A . n A 1 222 ARG 222 238 238 ARG ARG A . n A 1 223 ARG 223 239 239 ARG ARG A . n A 1 224 VAL 224 240 240 VAL VAL A . n A 1 225 LEU 225 241 241 LEU LEU A . n A 1 226 GLU 226 242 242 GLU GLU A . n A 1 227 THR 227 243 243 THR THR A . n A 1 228 ASN 228 244 244 ASN ASN A . n A 1 229 PHE 229 245 245 PHE PHE A . n A 1 230 PRO 230 246 246 PRO PRO A . n A 1 231 LYS 231 247 247 LYS LYS A . n A 1 232 SER 232 248 248 SER SER A . n A 1 233 PRO 233 249 249 PRO PRO A . n A 1 234 PHE 234 250 250 PHE PHE A . n A 1 235 LEU 235 251 251 LEU LEU A . n A 1 236 THR 236 252 252 THR THR A . n A 1 237 HIS 237 253 253 HIS HIS A . n A 1 238 ALA 238 254 254 ALA ALA A . n A 1 239 TRP 239 255 255 TRP TRP A . n A 1 240 GLN 240 256 256 GLN GLN A . n A 1 241 PRO 241 257 257 PRO PRO A . n A 1 242 ASP 242 258 ? ? ? A . n A 1 243 ASP 243 259 ? ? ? A . n A 1 244 MET 244 260 ? ? ? A . n A 1 245 PRO 245 261 ? ? ? A . n A 1 246 TRP 246 262 ? ? ? A . n A 1 247 TRP 247 263 ? ? ? A . n A 1 248 ARG 248 264 ? ? ? A . n A 1 249 TYR 249 265 ? ? ? A . n A 1 250 TRP 250 266 ? ? ? A . n A 1 251 HIS 251 267 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 2 HOH HOH A . B 2 HOH 2 302 15 HOH HOH A . B 2 HOH 3 303 11 HOH HOH A . B 2 HOH 4 304 13 HOH HOH A . B 2 HOH 5 305 4 HOH HOH A . B 2 HOH 6 306 19 HOH HOH A . B 2 HOH 7 307 10 HOH HOH A . B 2 HOH 8 308 9 HOH HOH A . B 2 HOH 9 309 31 HOH HOH A . B 2 HOH 10 310 33 HOH HOH A . B 2 HOH 11 311 17 HOH HOH A . B 2 HOH 12 312 12 HOH HOH A . B 2 HOH 13 313 1 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-06 2 'Structure model' 1 1 2017-12-20 3 'Structure model' 1 2 2018-02-07 4 'Structure model' 1 3 2019-12-11 5 'Structure model' 1 4 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' pdbx_audit_support 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 3 'Structure model' '_citation.year' 13 4 'Structure model' '_pdbx_audit_support.funding_organization' 14 5 'Structure model' '_database_2.pdbx_DOI' 15 5 'Structure model' '_database_2.pdbx_database_accession' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_2722 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 31 ? ? -162.83 67.28 2 1 TRP A 33 ? ? -119.57 -159.69 3 1 SER A 49 ? ? 72.92 30.89 4 1 GLU A 87 ? ? -100.29 75.47 5 1 TYR A 208 ? ? -116.23 53.18 6 1 ASP A 229 ? ? 60.80 61.24 7 1 LYS A 247 ? ? -107.85 71.95 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 17 ? A GLY 1 2 1 Y 1 A ALA 18 ? A ALA 2 3 1 Y 1 A THR 19 ? A THR 3 4 1 Y 1 A GLN 20 ? A GLN 4 5 1 Y 1 A GLY 21 ? A GLY 5 6 1 Y 1 A THR 22 ? A THR 6 7 1 Y 1 A ALA 23 ? A ALA 7 8 1 Y 1 A ASP 24 ? A ASP 8 9 1 Y 1 A LYS 25 ? A LYS 9 10 1 Y 1 A ASP 26 ? A ASP 10 11 1 Y 1 A ALA 27 ? A ALA 11 12 1 Y 1 A GLN 28 ? A GLN 12 13 1 Y 1 A ILE 29 ? A ILE 13 14 1 Y 1 A ASP 123 ? A ASP 107 15 1 Y 1 A GLN 124 ? A GLN 108 16 1 Y 1 A SER 125 ? A SER 109 17 1 Y 1 A PHE 126 ? A PHE 110 18 1 Y 1 A LEU 127 ? A LEU 111 19 1 Y 1 A ASN 128 ? A ASN 112 20 1 Y 1 A LYS 129 ? A LYS 113 21 1 Y 1 A LEU 130 ? A LEU 114 22 1 Y 1 A ALA 131 ? A ALA 115 23 1 Y 1 A SER 132 ? A SER 116 24 1 Y 1 A GLN 133 ? A GLN 117 25 1 Y 1 A ASP 134 ? A ASP 118 26 1 Y 1 A TRP 135 ? A TRP 119 27 1 Y 1 A SER 136 ? A SER 120 28 1 Y 1 A ASP 137 ? A ASP 121 29 1 Y 1 A ARG 138 ? A ARG 122 30 1 Y 1 A ASP 258 ? A ASP 242 31 1 Y 1 A ASP 259 ? A ASP 243 32 1 Y 1 A MET 260 ? A MET 244 33 1 Y 1 A PRO 261 ? A PRO 245 34 1 Y 1 A TRP 262 ? A TRP 246 35 1 Y 1 A TRP 263 ? A TRP 247 36 1 Y 1 A ARG 264 ? A ARG 248 37 1 Y 1 A TYR 265 ? A TYR 249 38 1 Y 1 A TRP 266 ? A TRP 250 39 1 Y 1 A HIS 267 ? A HIS 251 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number K22AI113078 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2YHC _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #