data_5ZX8 # _entry.id 5ZX8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZX8 pdb_00005zx8 10.2210/pdb5zx8/pdb WWPDB D_1300007812 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZX8 _pdbx_database_status.recvd_initial_deposition_date 2018-05-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Matsumoto, A.' 1 ? 'Uehara, U.' 2 ? 'Shimizu, Y.' 3 ? 'Ueda, T.' 4 ? 'Uchiumi, T.' 5 ? 'Ito, K.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 87 _citation.language ? _citation.page_first 226 _citation.page_last 235 _citation.title 'High-resolution crystal structure of peptidyl-tRNA hydrolase from Thermus thermophilus.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.25643 _citation.pdbx_database_id_PubMed 30520515 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Matsumoto, A.' 1 ? primary 'Uehara, Y.' 2 ? primary 'Shimizu, Y.' 3 ? primary 'Ueda, T.' 4 ? primary 'Uchiumi, T.' 5 ? primary 'Ito, K.' 6 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5ZX8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.453 _cell.length_a_esd ? _cell.length_b 53.918 _cell.length_b_esd ? _cell.length_c 58.670 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZX8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidyl-tRNA hydrolase' 20620.867 1 3.1.1.29 ? ? ? 2 non-polymer syn 'CITRATE ANION' 189.100 2 ? ? ? ? 3 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 2 ? ? ? ? 4 water nat water 18.015 120 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PTH # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMMFLVVGQGNPGERYARTRHNLGFMVLDRLGLSFRPRGEALVAEAEGGLFLKPLTYYNLTGRAVAPLARFYKIPPER ILVVHDEMDLPLGRIRFKAGGSAAGNRGVLSIEEALGTRAFHRLRLGIGKPPDPSRGAEYVLSPFREEELPVVERVLEAA KEAVWCWVREGLPPCAGRFNGLDLSLG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMMFLVVGQGNPGERYARTRHNLGFMVLDRLGLSFRPRGEALVAEAEGGLFLKPLTYYNLTGRAVAPLARFYKIPPER ILVVHDEMDLPLGRIRFKAGGSAAGNRGVLSIEEALGTRAFHRLRLGIGKPPDPSRGAEYVLSPFREEELPVVERVLEAA KEAVWCWVREGLPPCAGRFNGLDLSLG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 MET n 1 6 PHE n 1 7 LEU n 1 8 VAL n 1 9 VAL n 1 10 GLY n 1 11 GLN n 1 12 GLY n 1 13 ASN n 1 14 PRO n 1 15 GLY n 1 16 GLU n 1 17 ARG n 1 18 TYR n 1 19 ALA n 1 20 ARG n 1 21 THR n 1 22 ARG n 1 23 HIS n 1 24 ASN n 1 25 LEU n 1 26 GLY n 1 27 PHE n 1 28 MET n 1 29 VAL n 1 30 LEU n 1 31 ASP n 1 32 ARG n 1 33 LEU n 1 34 GLY n 1 35 LEU n 1 36 SER n 1 37 PHE n 1 38 ARG n 1 39 PRO n 1 40 ARG n 1 41 GLY n 1 42 GLU n 1 43 ALA n 1 44 LEU n 1 45 VAL n 1 46 ALA n 1 47 GLU n 1 48 ALA n 1 49 GLU n 1 50 GLY n 1 51 GLY n 1 52 LEU n 1 53 PHE n 1 54 LEU n 1 55 LYS n 1 56 PRO n 1 57 LEU n 1 58 THR n 1 59 TYR n 1 60 TYR n 1 61 ASN n 1 62 LEU n 1 63 THR n 1 64 GLY n 1 65 ARG n 1 66 ALA n 1 67 VAL n 1 68 ALA n 1 69 PRO n 1 70 LEU n 1 71 ALA n 1 72 ARG n 1 73 PHE n 1 74 TYR n 1 75 LYS n 1 76 ILE n 1 77 PRO n 1 78 PRO n 1 79 GLU n 1 80 ARG n 1 81 ILE n 1 82 LEU n 1 83 VAL n 1 84 VAL n 1 85 HIS n 1 86 ASP n 1 87 GLU n 1 88 MET n 1 89 ASP n 1 90 LEU n 1 91 PRO n 1 92 LEU n 1 93 GLY n 1 94 ARG n 1 95 ILE n 1 96 ARG n 1 97 PHE n 1 98 LYS n 1 99 ALA n 1 100 GLY n 1 101 GLY n 1 102 SER n 1 103 ALA n 1 104 ALA n 1 105 GLY n 1 106 ASN n 1 107 ARG n 1 108 GLY n 1 109 VAL n 1 110 LEU n 1 111 SER n 1 112 ILE n 1 113 GLU n 1 114 GLU n 1 115 ALA n 1 116 LEU n 1 117 GLY n 1 118 THR n 1 119 ARG n 1 120 ALA n 1 121 PHE n 1 122 HIS n 1 123 ARG n 1 124 LEU n 1 125 ARG n 1 126 LEU n 1 127 GLY n 1 128 ILE n 1 129 GLY n 1 130 LYS n 1 131 PRO n 1 132 PRO n 1 133 ASP n 1 134 PRO n 1 135 SER n 1 136 ARG n 1 137 GLY n 1 138 ALA n 1 139 GLU n 1 140 TYR n 1 141 VAL n 1 142 LEU n 1 143 SER n 1 144 PRO n 1 145 PHE n 1 146 ARG n 1 147 GLU n 1 148 GLU n 1 149 GLU n 1 150 LEU n 1 151 PRO n 1 152 VAL n 1 153 VAL n 1 154 GLU n 1 155 ARG n 1 156 VAL n 1 157 LEU n 1 158 GLU n 1 159 ALA n 1 160 ALA n 1 161 LYS n 1 162 GLU n 1 163 ALA n 1 164 VAL n 1 165 TRP n 1 166 CYS n 1 167 TRP n 1 168 VAL n 1 169 ARG n 1 170 GLU n 1 171 GLY n 1 172 LEU n 1 173 PRO n 1 174 PRO n 1 175 CYS n 1 176 ALA n 1 177 GLY n 1 178 ARG n 1 179 PHE n 1 180 ASN n 1 181 GLY n 1 182 LEU n 1 183 ASP n 1 184 LEU n 1 185 SER n 1 186 LEU n 1 187 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 187 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pth, TTHA1588' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'HB8 / ATCC 27634 / DSM 579' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus HB8' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 300852 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTH_THET8 _struct_ref.pdbx_db_accession Q5SHZ2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MFLVVGQGNPGERYARTRHNLGFMVLDRLGLSFRPRGEALVAEAEGGLFLKPLTYYNLTGRAVAPLARFYKIPPERILVV HDEMDLPLGRIRFKAGGSAAGNRGVLSIEEALGTRAFHRLRLGIGKPPDPSRGAEYVLSPFREEELPVVERVLEAAKEAV WCWVREGLPPCAGRFNGLDLSLG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ZX8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 187 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5SHZ2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ZX8 GLY A 1 ? UNP Q5SHZ2 ? ? 'expression tag' -3 1 1 5ZX8 SER A 2 ? UNP Q5SHZ2 ? ? 'expression tag' -2 2 1 5ZX8 HIS A 3 ? UNP Q5SHZ2 ? ? 'expression tag' -1 3 1 5ZX8 MET A 4 ? UNP Q5SHZ2 ? ? 'expression tag' 0 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FLC non-polymer . 'CITRATE ANION' ? 'C6 H5 O7 -3' 189.100 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZX8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.82 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM phosphate-citrate buffer pH 4.2, 50%(v/v) 2-methyl-2,4-pentanediol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2010-12-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW12A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline AR-NW12A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5ZX8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.00 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 75984 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.9 _reflns.pdbx_Rmerge_I_obs 0.045 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 57.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.00 _reflns_shell.d_res_low 1.04 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.46 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.59 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.28 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 0.31 _refine.B_iso_max ? _refine.B_iso_mean 16.198 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.973 _refine.correlation_coeff_Fo_to_Fc_free 0.969 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ZX8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.00 _refine.ls_d_res_low 23.45 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 71946 _refine.ls_number_reflns_R_free 3777 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.25 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.12938 _refine.ls_R_factor_R_free 0.14272 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.12867 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1RYB _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.023 _refine.pdbx_overall_ESU_R_Free 0.022 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.543 _refine.overall_SU_ML 0.013 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1448 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.number_atoms_solvent 120 _refine_hist.number_atoms_total 1610 _refine_hist.d_res_high 1.00 _refine_hist.d_res_low 23.45 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 0.019 1554 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1536 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.874 2.017 2110 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.906 3.001 3517 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.297 5.000 195 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.514 20.882 68 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.311 15.000 256 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.386 15.000 21 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.429 0.200 224 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.021 1740 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 365 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.351 1.264 753 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.179 1.260 752 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.556 1.908 942 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.601 1.911 943 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.971 1.681 801 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.969 1.682 802 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.043 2.401 1164 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 4.079 11.786 1789 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 3.899 11.478 1753 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 4.074 3.000 3090 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 25.636 5.000 29 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 10.507 5.000 3144 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 0.999 _refine_ls_shell.d_res_low 1.025 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 263 _refine_ls_shell.number_reflns_R_work 5369 _refine_ls_shell.percent_reflns_obs 94.07 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.250 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.221 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5ZX8 _struct.title 'Crystal structure of peptidyl-tRNA hydrolase from Thermus thermophilus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZX8 _struct_keywords.text 'peptidyl-tRNA hydrolase, Thermus thermophilus, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 15 ? ALA A 19 ? GLY A 11 ALA A 15 5 ? 5 HELX_P HELX_P2 AA2 THR A 21 ? HIS A 23 ? THR A 17 HIS A 19 5 ? 3 HELX_P HELX_P3 AA3 ASN A 24 ? ASP A 31 ? ASN A 20 ASP A 27 1 ? 8 HELX_P HELX_P4 AA4 TYR A 59 ? LEU A 62 ? TYR A 55 LEU A 58 5 ? 4 HELX_P HELX_P5 AA5 THR A 63 ? LYS A 75 ? THR A 59 LYS A 71 1 ? 13 HELX_P HELX_P6 AA6 PRO A 77 ? GLU A 79 ? PRO A 73 GLU A 75 5 ? 3 HELX_P HELX_P7 AA7 ASN A 106 ? GLY A 117 ? ASN A 102 GLY A 113 1 ? 12 HELX_P HELX_P8 AA8 ASP A 133 ? SER A 135 ? ASP A 129 SER A 131 5 ? 3 HELX_P HELX_P9 AA9 ARG A 136 ? LEU A 142 ? ARG A 132 LEU A 138 1 ? 7 HELX_P HELX_P10 AB1 ARG A 146 ? GLU A 148 ? ARG A 142 GLU A 144 5 ? 3 HELX_P HELX_P11 AB2 GLU A 149 ? GLY A 171 ? GLU A 145 GLY A 167 1 ? 23 HELX_P HELX_P12 AB3 GLY A 171 ? ASN A 180 ? GLY A 167 ASN A 176 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 166 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 175 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 162 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 171 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.055 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 38 ? ARG A 40 ? ARG A 34 ARG A 36 AA1 2 ALA A 43 ? ALA A 48 ? ALA A 39 ALA A 44 AA1 3 GLY A 51 ? PRO A 56 ? GLY A 47 PRO A 52 AA1 4 LEU A 7 ? GLY A 10 ? LEU A 3 GLY A 6 AA1 5 ILE A 81 ? GLU A 87 ? ILE A 77 GLU A 83 AA1 6 HIS A 122 ? GLY A 127 ? HIS A 118 GLY A 123 AA1 7 ILE A 95 ? ALA A 99 ? ILE A 91 ALA A 95 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 38 ? N ARG A 34 O VAL A 45 ? O VAL A 41 AA1 2 3 N LEU A 44 ? N LEU A 40 O LYS A 55 ? O LYS A 51 AA1 3 4 O LEU A 54 ? O LEU A 50 N VAL A 8 ? N VAL A 4 AA1 4 5 N VAL A 9 ? N VAL A 5 O LEU A 82 ? O LEU A 78 AA1 5 6 N HIS A 85 ? N HIS A 81 O LEU A 126 ? O LEU A 122 AA1 6 7 O ARG A 125 ? O ARG A 121 N ARG A 96 ? N ARG A 92 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FLC 201 ? 10 'binding site for residue FLC A 201' AC2 Software A FLC 202 ? 12 'binding site for residue FLC A 202' AC3 Software A MPD 203 ? 8 'binding site for residue MPD A 203' AC4 Software A MPD 204 ? 5 'binding site for residue MPD A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 GLY A 15 ? GLY A 11 . ? 3_645 ? 2 AC1 10 GLU A 16 ? GLU A 12 . ? 3_645 ? 3 AC1 10 ARG A 17 ? ARG A 13 . ? 3_645 ? 4 AC1 10 ARG A 72 ? ARG A 68 . ? 2_665 ? 5 AC1 10 LYS A 161 ? LYS A 157 . ? 1_555 ? 6 AC1 10 ARG A 169 ? ARG A 165 . ? 1_555 ? 7 AC1 10 MPD E . ? MPD A 204 . ? 2_665 ? 8 AC1 10 HOH F . ? HOH A 324 . ? 1_555 ? 9 AC1 10 HOH F . ? HOH A 330 . ? 1_555 ? 10 AC1 10 HOH F . ? HOH A 353 . ? 1_555 ? 11 AC2 12 SER A 2 ? SER A -2 . ? 1_455 ? 12 AC2 12 ARG A 22 ? ARG A 18 . ? 1_555 ? 13 AC2 12 PRO A 131 ? PRO A 127 . ? 1_555 ? 14 AC2 12 PRO A 132 ? PRO A 128 . ? 1_555 ? 15 AC2 12 ARG A 136 ? ARG A 132 . ? 1_555 ? 16 AC2 12 GLU A 139 ? GLU A 135 . ? 1_555 ? 17 AC2 12 TYR A 140 ? TYR A 136 . ? 1_555 ? 18 AC2 12 SER A 143 ? SER A 139 . ? 1_555 ? 19 AC2 12 ARG A 146 ? ARG A 142 . ? 1_555 ? 20 AC2 12 HOH F . ? HOH A 310 . ? 4_465 ? 21 AC2 12 HOH F . ? HOH A 346 . ? 1_455 ? 22 AC2 12 HOH F . ? HOH A 352 . ? 1_555 ? 23 AC3 8 GLY A 34 ? GLY A 30 . ? 1_555 ? 24 AC3 8 SER A 36 ? SER A 32 . ? 1_555 ? 25 AC3 8 ALA A 71 ? ALA A 67 . ? 2_665 ? 26 AC3 8 ILE A 76 ? ILE A 72 . ? 2_665 ? 27 AC3 8 PRO A 77 ? PRO A 73 . ? 2_665 ? 28 AC3 8 PRO A 78 ? PRO A 74 . ? 2_665 ? 29 AC3 8 THR A 118 ? THR A 114 . ? 2_665 ? 30 AC3 8 HOH F . ? HOH A 363 . ? 1_555 ? 31 AC4 5 PRO A 14 ? PRO A 10 . ? 4_565 ? 32 AC4 5 TYR A 18 ? TYR A 14 . ? 4_565 ? 33 AC4 5 TYR A 59 ? TYR A 55 . ? 4_565 ? 34 AC4 5 PHE A 73 ? PHE A 69 . ? 1_555 ? 35 AC4 5 FLC B . ? FLC A 201 . ? 2_664 ? # _atom_sites.entry_id 5ZX8 _atom_sites.fract_transf_matrix[1][1] 0.021073 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018547 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017044 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 -3 GLY GLY A . n A 1 2 SER 2 -2 -2 SER SER A . n A 1 3 HIS 3 -1 -1 HIS HIS A . n A 1 4 MET 4 0 0 MET MET A . n A 1 5 MET 5 1 1 MET MET A . n A 1 6 PHE 6 2 2 PHE PHE A . n A 1 7 LEU 7 3 3 LEU LEU A . n A 1 8 VAL 8 4 4 VAL VAL A . n A 1 9 VAL 9 5 5 VAL VAL A . n A 1 10 GLY 10 6 6 GLY GLY A . n A 1 11 GLN 11 7 7 GLN GLN A . n A 1 12 GLY 12 8 8 GLY GLY A . n A 1 13 ASN 13 9 9 ASN ASN A . n A 1 14 PRO 14 10 10 PRO PRO A . n A 1 15 GLY 15 11 11 GLY GLY A . n A 1 16 GLU 16 12 12 GLU GLU A . n A 1 17 ARG 17 13 13 ARG ARG A . n A 1 18 TYR 18 14 14 TYR TYR A . n A 1 19 ALA 19 15 15 ALA ALA A . n A 1 20 ARG 20 16 16 ARG ARG A . n A 1 21 THR 21 17 17 THR THR A . n A 1 22 ARG 22 18 18 ARG ARG A . n A 1 23 HIS 23 19 19 HIS HIS A . n A 1 24 ASN 24 20 20 ASN ASN A . n A 1 25 LEU 25 21 21 LEU LEU A . n A 1 26 GLY 26 22 22 GLY GLY A . n A 1 27 PHE 27 23 23 PHE PHE A . n A 1 28 MET 28 24 24 MET MET A . n A 1 29 VAL 29 25 25 VAL VAL A . n A 1 30 LEU 30 26 26 LEU LEU A . n A 1 31 ASP 31 27 27 ASP ASP A . n A 1 32 ARG 32 28 28 ARG ARG A . n A 1 33 LEU 33 29 29 LEU LEU A . n A 1 34 GLY 34 30 30 GLY GLY A . n A 1 35 LEU 35 31 31 LEU LEU A . n A 1 36 SER 36 32 32 SER SER A . n A 1 37 PHE 37 33 33 PHE PHE A . n A 1 38 ARG 38 34 34 ARG ARG A . n A 1 39 PRO 39 35 35 PRO PRO A . n A 1 40 ARG 40 36 36 ARG ARG A . n A 1 41 GLY 41 37 37 GLY GLY A . n A 1 42 GLU 42 38 38 GLU GLU A . n A 1 43 ALA 43 39 39 ALA ALA A . n A 1 44 LEU 44 40 40 LEU LEU A . n A 1 45 VAL 45 41 41 VAL VAL A . n A 1 46 ALA 46 42 42 ALA ALA A . n A 1 47 GLU 47 43 43 GLU GLU A . n A 1 48 ALA 48 44 44 ALA ALA A . n A 1 49 GLU 49 45 45 GLU GLU A . n A 1 50 GLY 50 46 46 GLY GLY A . n A 1 51 GLY 51 47 47 GLY GLY A . n A 1 52 LEU 52 48 48 LEU LEU A . n A 1 53 PHE 53 49 49 PHE PHE A . n A 1 54 LEU 54 50 50 LEU LEU A . n A 1 55 LYS 55 51 51 LYS LYS A . n A 1 56 PRO 56 52 52 PRO PRO A . n A 1 57 LEU 57 53 53 LEU LEU A . n A 1 58 THR 58 54 54 THR THR A . n A 1 59 TYR 59 55 55 TYR TYR A . n A 1 60 TYR 60 56 56 TYR TYR A . n A 1 61 ASN 61 57 57 ASN ASN A . n A 1 62 LEU 62 58 58 LEU LEU A . n A 1 63 THR 63 59 59 THR THR A . n A 1 64 GLY 64 60 60 GLY GLY A . n A 1 65 ARG 65 61 61 ARG ARG A . n A 1 66 ALA 66 62 62 ALA ALA A . n A 1 67 VAL 67 63 63 VAL VAL A . n A 1 68 ALA 68 64 64 ALA ALA A . n A 1 69 PRO 69 65 65 PRO PRO A . n A 1 70 LEU 70 66 66 LEU LEU A . n A 1 71 ALA 71 67 67 ALA ALA A . n A 1 72 ARG 72 68 68 ARG ARG A . n A 1 73 PHE 73 69 69 PHE PHE A . n A 1 74 TYR 74 70 70 TYR TYR A . n A 1 75 LYS 75 71 71 LYS LYS A . n A 1 76 ILE 76 72 72 ILE ILE A . n A 1 77 PRO 77 73 73 PRO PRO A . n A 1 78 PRO 78 74 74 PRO PRO A . n A 1 79 GLU 79 75 75 GLU GLU A . n A 1 80 ARG 80 76 76 ARG ARG A . n A 1 81 ILE 81 77 77 ILE ILE A . n A 1 82 LEU 82 78 78 LEU LEU A . n A 1 83 VAL 83 79 79 VAL VAL A . n A 1 84 VAL 84 80 80 VAL VAL A . n A 1 85 HIS 85 81 81 HIS HIS A . n A 1 86 ASP 86 82 82 ASP ASP A . n A 1 87 GLU 87 83 83 GLU GLU A . n A 1 88 MET 88 84 84 MET MET A . n A 1 89 ASP 89 85 85 ASP ASP A . n A 1 90 LEU 90 86 86 LEU LEU A . n A 1 91 PRO 91 87 87 PRO PRO A . n A 1 92 LEU 92 88 88 LEU LEU A . n A 1 93 GLY 93 89 89 GLY GLY A . n A 1 94 ARG 94 90 90 ARG ARG A . n A 1 95 ILE 95 91 91 ILE ILE A . n A 1 96 ARG 96 92 92 ARG ARG A . n A 1 97 PHE 97 93 93 PHE PHE A . n A 1 98 LYS 98 94 94 LYS LYS A . n A 1 99 ALA 99 95 95 ALA ALA A . n A 1 100 GLY 100 96 96 GLY GLY A . n A 1 101 GLY 101 97 97 GLY GLY A . n A 1 102 SER 102 98 98 SER SER A . n A 1 103 ALA 103 99 99 ALA ALA A . n A 1 104 ALA 104 100 100 ALA ALA A . n A 1 105 GLY 105 101 101 GLY GLY A . n A 1 106 ASN 106 102 102 ASN ASN A . n A 1 107 ARG 107 103 103 ARG ARG A . n A 1 108 GLY 108 104 104 GLY GLY A . n A 1 109 VAL 109 105 105 VAL VAL A . n A 1 110 LEU 110 106 106 LEU LEU A . n A 1 111 SER 111 107 107 SER SER A . n A 1 112 ILE 112 108 108 ILE ILE A . n A 1 113 GLU 113 109 109 GLU GLU A . n A 1 114 GLU 114 110 110 GLU GLU A . n A 1 115 ALA 115 111 111 ALA ALA A . n A 1 116 LEU 116 112 112 LEU LEU A . n A 1 117 GLY 117 113 113 GLY GLY A . n A 1 118 THR 118 114 114 THR THR A . n A 1 119 ARG 119 115 115 ARG ARG A . n A 1 120 ALA 120 116 116 ALA ALA A . n A 1 121 PHE 121 117 117 PHE PHE A . n A 1 122 HIS 122 118 118 HIS HIS A . n A 1 123 ARG 123 119 119 ARG ARG A . n A 1 124 LEU 124 120 120 LEU LEU A . n A 1 125 ARG 125 121 121 ARG ARG A . n A 1 126 LEU 126 122 122 LEU LEU A . n A 1 127 GLY 127 123 123 GLY GLY A . n A 1 128 ILE 128 124 124 ILE ILE A . n A 1 129 GLY 129 125 125 GLY GLY A . n A 1 130 LYS 130 126 126 LYS LYS A . n A 1 131 PRO 131 127 127 PRO PRO A . n A 1 132 PRO 132 128 128 PRO PRO A . n A 1 133 ASP 133 129 129 ASP ASP A . n A 1 134 PRO 134 130 130 PRO PRO A . n A 1 135 SER 135 131 131 SER SER A . n A 1 136 ARG 136 132 132 ARG ARG A . n A 1 137 GLY 137 133 133 GLY GLY A . n A 1 138 ALA 138 134 134 ALA ALA A . n A 1 139 GLU 139 135 135 GLU GLU A . n A 1 140 TYR 140 136 136 TYR TYR A . n A 1 141 VAL 141 137 137 VAL VAL A . n A 1 142 LEU 142 138 138 LEU LEU A . n A 1 143 SER 143 139 139 SER SER A . n A 1 144 PRO 144 140 140 PRO PRO A . n A 1 145 PHE 145 141 141 PHE PHE A . n A 1 146 ARG 146 142 142 ARG ARG A . n A 1 147 GLU 147 143 143 GLU GLU A . n A 1 148 GLU 148 144 144 GLU GLU A . n A 1 149 GLU 149 145 145 GLU GLU A . n A 1 150 LEU 150 146 146 LEU LEU A . n A 1 151 PRO 151 147 147 PRO PRO A . n A 1 152 VAL 152 148 148 VAL VAL A . n A 1 153 VAL 153 149 149 VAL VAL A . n A 1 154 GLU 154 150 150 GLU GLU A . n A 1 155 ARG 155 151 151 ARG ARG A . n A 1 156 VAL 156 152 152 VAL VAL A . n A 1 157 LEU 157 153 153 LEU LEU A . n A 1 158 GLU 158 154 154 GLU GLU A . n A 1 159 ALA 159 155 155 ALA ALA A . n A 1 160 ALA 160 156 156 ALA ALA A . n A 1 161 LYS 161 157 157 LYS LYS A . n A 1 162 GLU 162 158 158 GLU GLU A . n A 1 163 ALA 163 159 159 ALA ALA A . n A 1 164 VAL 164 160 160 VAL VAL A . n A 1 165 TRP 165 161 161 TRP TRP A . n A 1 166 CYS 166 162 162 CYS CYS A . n A 1 167 TRP 167 163 163 TRP TRP A . n A 1 168 VAL 168 164 164 VAL VAL A . n A 1 169 ARG 169 165 165 ARG ARG A . n A 1 170 GLU 170 166 166 GLU GLU A . n A 1 171 GLY 171 167 167 GLY GLY A . n A 1 172 LEU 172 168 168 LEU LEU A . n A 1 173 PRO 173 169 169 PRO PRO A . n A 1 174 PRO 174 170 170 PRO PRO A . n A 1 175 CYS 175 171 171 CYS CYS A . n A 1 176 ALA 176 172 172 ALA ALA A . n A 1 177 GLY 177 173 173 GLY GLY A . n A 1 178 ARG 178 174 174 ARG ARG A . n A 1 179 PHE 179 175 175 PHE PHE A . n A 1 180 ASN 180 176 176 ASN ASN A . n A 1 181 GLY 181 177 177 GLY GLY A . n A 1 182 LEU 182 178 178 LEU LEU A . n A 1 183 ASP 183 179 179 ASP ASP A . n A 1 184 LEU 184 180 180 LEU LEU A . n A 1 185 SER 185 181 181 SER SER A . n A 1 186 LEU 186 182 182 LEU LEU A . n A 1 187 GLY 187 183 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FLC 1 201 183 FLC FLC A . C 2 FLC 1 202 184 FLC FLC A . D 3 MPD 1 203 185 MPD MPD A . E 3 MPD 1 204 186 MPD MPD A . F 4 HOH 1 301 51 HOH HOH A . F 4 HOH 2 302 36 HOH HOH A . F 4 HOH 3 303 57 HOH HOH A . F 4 HOH 4 304 69 HOH HOH A . F 4 HOH 5 305 76 HOH HOH A . F 4 HOH 6 306 41 HOH HOH A . F 4 HOH 7 307 85 HOH HOH A . F 4 HOH 8 308 19 HOH HOH A . F 4 HOH 9 309 105 HOH HOH A . F 4 HOH 10 310 23 HOH HOH A . F 4 HOH 11 311 70 HOH HOH A . F 4 HOH 12 312 98 HOH HOH A . F 4 HOH 13 313 63 HOH HOH A . F 4 HOH 14 314 8 HOH HOH A . F 4 HOH 15 315 111 HOH HOH A . F 4 HOH 16 316 50 HOH HOH A . F 4 HOH 17 317 21 HOH HOH A . F 4 HOH 18 318 93 HOH HOH A . F 4 HOH 19 319 7 HOH HOH A . F 4 HOH 20 320 42 HOH HOH A . F 4 HOH 21 321 74 HOH HOH A . F 4 HOH 22 322 25 HOH HOH A . F 4 HOH 23 323 80 HOH HOH A . F 4 HOH 24 324 45 HOH HOH A . F 4 HOH 25 325 120 HOH HOH A . F 4 HOH 26 326 26 HOH HOH A . F 4 HOH 27 327 37 HOH HOH A . F 4 HOH 28 328 15 HOH HOH A . F 4 HOH 29 329 13 HOH HOH A . F 4 HOH 30 330 47 HOH HOH A . F 4 HOH 31 331 4 HOH HOH A . F 4 HOH 32 332 16 HOH HOH A . F 4 HOH 33 333 114 HOH HOH A . F 4 HOH 34 334 60 HOH HOH A . F 4 HOH 35 335 90 HOH HOH A . F 4 HOH 36 336 46 HOH HOH A . F 4 HOH 37 337 107 HOH HOH A . F 4 HOH 38 338 34 HOH HOH A . F 4 HOH 39 339 44 HOH HOH A . F 4 HOH 40 340 101 HOH HOH A . F 4 HOH 41 341 3 HOH HOH A . F 4 HOH 42 342 68 HOH HOH A . F 4 HOH 43 343 12 HOH HOH A . F 4 HOH 44 344 33 HOH HOH A . F 4 HOH 45 345 84 HOH HOH A . F 4 HOH 46 346 72 HOH HOH A . F 4 HOH 47 347 94 HOH HOH A . F 4 HOH 48 348 53 HOH HOH A . F 4 HOH 49 349 1 HOH HOH A . F 4 HOH 50 350 6 HOH HOH A . F 4 HOH 51 351 62 HOH HOH A . F 4 HOH 52 352 61 HOH HOH A . F 4 HOH 53 353 39 HOH HOH A . F 4 HOH 54 354 64 HOH HOH A . F 4 HOH 55 355 49 HOH HOH A . F 4 HOH 56 356 14 HOH HOH A . F 4 HOH 57 357 9 HOH HOH A . F 4 HOH 58 358 28 HOH HOH A . F 4 HOH 59 359 17 HOH HOH A . F 4 HOH 60 360 5 HOH HOH A . F 4 HOH 61 361 59 HOH HOH A . F 4 HOH 62 362 67 HOH HOH A . F 4 HOH 63 363 55 HOH HOH A . F 4 HOH 64 364 27 HOH HOH A . F 4 HOH 65 365 32 HOH HOH A . F 4 HOH 66 366 109 HOH HOH A . F 4 HOH 67 367 48 HOH HOH A . F 4 HOH 68 368 103 HOH HOH A . F 4 HOH 69 369 87 HOH HOH A . F 4 HOH 70 370 119 HOH HOH A . F 4 HOH 71 371 115 HOH HOH A . F 4 HOH 72 372 10 HOH HOH A . F 4 HOH 73 373 77 HOH HOH A . F 4 HOH 74 374 52 HOH HOH A . F 4 HOH 75 375 38 HOH HOH A . F 4 HOH 76 376 82 HOH HOH A . F 4 HOH 77 377 65 HOH HOH A . F 4 HOH 78 378 20 HOH HOH A . F 4 HOH 79 379 78 HOH HOH A . F 4 HOH 80 380 22 HOH HOH A . F 4 HOH 81 381 81 HOH HOH A . F 4 HOH 82 382 56 HOH HOH A . F 4 HOH 83 383 24 HOH HOH A . F 4 HOH 84 384 71 HOH HOH A . F 4 HOH 85 385 40 HOH HOH A . F 4 HOH 86 386 73 HOH HOH A . F 4 HOH 87 387 110 HOH HOH A . F 4 HOH 88 388 58 HOH HOH A . F 4 HOH 89 389 2 HOH HOH A . F 4 HOH 90 390 96 HOH HOH A . F 4 HOH 91 391 104 HOH HOH A . F 4 HOH 92 392 66 HOH HOH A . F 4 HOH 93 393 89 HOH HOH A . F 4 HOH 94 394 108 HOH HOH A . F 4 HOH 95 395 99 HOH HOH A . F 4 HOH 96 396 31 HOH HOH A . F 4 HOH 97 397 112 HOH HOH A . F 4 HOH 98 398 18 HOH HOH A . F 4 HOH 99 399 97 HOH HOH A . F 4 HOH 100 400 118 HOH HOH A . F 4 HOH 101 401 117 HOH HOH A . F 4 HOH 102 402 79 HOH HOH A . F 4 HOH 103 403 92 HOH HOH A . F 4 HOH 104 404 11 HOH HOH A . F 4 HOH 105 405 54 HOH HOH A . F 4 HOH 106 406 75 HOH HOH A . F 4 HOH 107 407 95 HOH HOH A . F 4 HOH 108 408 29 HOH HOH A . F 4 HOH 109 409 113 HOH HOH A . F 4 HOH 110 410 88 HOH HOH A . F 4 HOH 111 411 102 HOH HOH A . F 4 HOH 112 412 30 HOH HOH A . F 4 HOH 113 413 35 HOH HOH A . F 4 HOH 114 414 91 HOH HOH A . F 4 HOH 115 415 116 HOH HOH A . F 4 HOH 116 416 43 HOH HOH A . F 4 HOH 117 417 83 HOH HOH A . F 4 HOH 118 418 100 HOH HOH A . F 4 HOH 119 419 86 HOH HOH A . F 4 HOH 120 420 106 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 840 ? 1 MORE -7 ? 1 'SSA (A^2)' 9040 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-26 2 'Structure model' 1 1 2019-01-23 3 'Structure model' 1 2 2019-03-06 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 2 'Structure model' '_citation_author.name' 12 3 'Structure model' '_citation.journal_volume' 13 3 'Structure model' '_citation.page_first' 14 3 'Structure model' '_citation.page_last' 15 3 'Structure model' '_citation.year' 16 3 'Structure model' '_citation_author.identifier_ORCID' 17 4 'Structure model' '_database_2.pdbx_DOI' 18 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0032 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 12 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NH2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 174 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 A _pdbx_validate_symm_contact.site_symmetry_2 3_655 _pdbx_validate_symm_contact.dist 1.86 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH1 A ARG 34 ? ? 124.23 120.30 3.93 0.50 N 2 1 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH2 A ARG 34 ? ? 117.17 120.30 -3.13 0.50 N 3 1 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.58 120.30 3.28 0.50 N 4 1 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH2 A ARG 76 ? ? 116.85 120.30 -3.45 0.50 N 5 1 CG A MET 84 ? B SD A MET 84 ? B CE A MET 84 ? B 86.63 100.20 -13.57 1.60 N 6 1 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH1 A ARG 121 ? ? 126.55 120.30 6.25 0.50 N 7 1 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH2 A ARG 121 ? ? 116.35 120.30 -3.95 0.50 N 8 1 NE A ARG 142 ? ? CZ A ARG 142 ? ? NH2 A ARG 142 ? ? 117.23 120.30 -3.07 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 38 ? ? -96.35 38.29 2 1 TYR A 55 ? ? 83.45 150.95 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id 183 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 187 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FLC CAC C N N 88 FLC CA C N N 89 FLC CB C N N 90 FLC CBC C N N 91 FLC CG C N N 92 FLC CGC C N N 93 FLC OA1 O N N 94 FLC OA2 O N N 95 FLC OB1 O N N 96 FLC OB2 O N N 97 FLC OG1 O N N 98 FLC OG2 O N N 99 FLC OHB O N N 100 FLC HA1 H N N 101 FLC HA2 H N N 102 FLC HG1 H N N 103 FLC HG2 H N N 104 FLC HOB H N N 105 GLN N N N N 106 GLN CA C N S 107 GLN C C N N 108 GLN O O N N 109 GLN CB C N N 110 GLN CG C N N 111 GLN CD C N N 112 GLN OE1 O N N 113 GLN NE2 N N N 114 GLN OXT O N N 115 GLN H H N N 116 GLN H2 H N N 117 GLN HA H N N 118 GLN HB2 H N N 119 GLN HB3 H N N 120 GLN HG2 H N N 121 GLN HG3 H N N 122 GLN HE21 H N N 123 GLN HE22 H N N 124 GLN HXT H N N 125 GLU N N N N 126 GLU CA C N S 127 GLU C C N N 128 GLU O O N N 129 GLU CB C N N 130 GLU CG C N N 131 GLU CD C N N 132 GLU OE1 O N N 133 GLU OE2 O N N 134 GLU OXT O N N 135 GLU H H N N 136 GLU H2 H N N 137 GLU HA H N N 138 GLU HB2 H N N 139 GLU HB3 H N N 140 GLU HG2 H N N 141 GLU HG3 H N N 142 GLU HE2 H N N 143 GLU HXT H N N 144 GLY N N N N 145 GLY CA C N N 146 GLY C C N N 147 GLY O O N N 148 GLY OXT O N N 149 GLY H H N N 150 GLY H2 H N N 151 GLY HA2 H N N 152 GLY HA3 H N N 153 GLY HXT H N N 154 HIS N N N N 155 HIS CA C N S 156 HIS C C N N 157 HIS O O N N 158 HIS CB C N N 159 HIS CG C Y N 160 HIS ND1 N Y N 161 HIS CD2 C Y N 162 HIS CE1 C Y N 163 HIS NE2 N Y N 164 HIS OXT O N N 165 HIS H H N N 166 HIS H2 H N N 167 HIS HA H N N 168 HIS HB2 H N N 169 HIS HB3 H N N 170 HIS HD1 H N N 171 HIS HD2 H N N 172 HIS HE1 H N N 173 HIS HE2 H N N 174 HIS HXT H N N 175 HOH O O N N 176 HOH H1 H N N 177 HOH H2 H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 MET N N N N 248 MET CA C N S 249 MET C C N N 250 MET O O N N 251 MET CB C N N 252 MET CG C N N 253 MET SD S N N 254 MET CE C N N 255 MET OXT O N N 256 MET H H N N 257 MET H2 H N N 258 MET HA H N N 259 MET HB2 H N N 260 MET HB3 H N N 261 MET HG2 H N N 262 MET HG3 H N N 263 MET HE1 H N N 264 MET HE2 H N N 265 MET HE3 H N N 266 MET HXT H N N 267 MPD C1 C N N 268 MPD C2 C N N 269 MPD O2 O N N 270 MPD CM C N N 271 MPD C3 C N N 272 MPD C4 C N S 273 MPD O4 O N N 274 MPD C5 C N N 275 MPD H11 H N N 276 MPD H12 H N N 277 MPD H13 H N N 278 MPD HO2 H N N 279 MPD HM1 H N N 280 MPD HM2 H N N 281 MPD HM3 H N N 282 MPD H31 H N N 283 MPD H32 H N N 284 MPD H4 H N N 285 MPD HO4 H N N 286 MPD H51 H N N 287 MPD H52 H N N 288 MPD H53 H N N 289 PHE N N N N 290 PHE CA C N S 291 PHE C C N N 292 PHE O O N N 293 PHE CB C N N 294 PHE CG C Y N 295 PHE CD1 C Y N 296 PHE CD2 C Y N 297 PHE CE1 C Y N 298 PHE CE2 C Y N 299 PHE CZ C Y N 300 PHE OXT O N N 301 PHE H H N N 302 PHE H2 H N N 303 PHE HA H N N 304 PHE HB2 H N N 305 PHE HB3 H N N 306 PHE HD1 H N N 307 PHE HD2 H N N 308 PHE HE1 H N N 309 PHE HE2 H N N 310 PHE HZ H N N 311 PHE HXT H N N 312 PRO N N N N 313 PRO CA C N S 314 PRO C C N N 315 PRO O O N N 316 PRO CB C N N 317 PRO CG C N N 318 PRO CD C N N 319 PRO OXT O N N 320 PRO H H N N 321 PRO HA H N N 322 PRO HB2 H N N 323 PRO HB3 H N N 324 PRO HG2 H N N 325 PRO HG3 H N N 326 PRO HD2 H N N 327 PRO HD3 H N N 328 PRO HXT H N N 329 SER N N N N 330 SER CA C N S 331 SER C C N N 332 SER O O N N 333 SER CB C N N 334 SER OG O N N 335 SER OXT O N N 336 SER H H N N 337 SER H2 H N N 338 SER HA H N N 339 SER HB2 H N N 340 SER HB3 H N N 341 SER HG H N N 342 SER HXT H N N 343 THR N N N N 344 THR CA C N S 345 THR C C N N 346 THR O O N N 347 THR CB C N R 348 THR OG1 O N N 349 THR CG2 C N N 350 THR OXT O N N 351 THR H H N N 352 THR H2 H N N 353 THR HA H N N 354 THR HB H N N 355 THR HG1 H N N 356 THR HG21 H N N 357 THR HG22 H N N 358 THR HG23 H N N 359 THR HXT H N N 360 TRP N N N N 361 TRP CA C N S 362 TRP C C N N 363 TRP O O N N 364 TRP CB C N N 365 TRP CG C Y N 366 TRP CD1 C Y N 367 TRP CD2 C Y N 368 TRP NE1 N Y N 369 TRP CE2 C Y N 370 TRP CE3 C Y N 371 TRP CZ2 C Y N 372 TRP CZ3 C Y N 373 TRP CH2 C Y N 374 TRP OXT O N N 375 TRP H H N N 376 TRP H2 H N N 377 TRP HA H N N 378 TRP HB2 H N N 379 TRP HB3 H N N 380 TRP HD1 H N N 381 TRP HE1 H N N 382 TRP HE3 H N N 383 TRP HZ2 H N N 384 TRP HZ3 H N N 385 TRP HH2 H N N 386 TRP HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FLC CAC CA sing N N 83 FLC CAC OA1 doub N N 84 FLC CAC OA2 sing N N 85 FLC CA CB sing N N 86 FLC CA HA1 sing N N 87 FLC CA HA2 sing N N 88 FLC CB CBC sing N N 89 FLC CB CG sing N N 90 FLC CB OHB sing N N 91 FLC CBC OB1 doub N N 92 FLC CBC OB2 sing N N 93 FLC CG CGC sing N N 94 FLC CG HG1 sing N N 95 FLC CG HG2 sing N N 96 FLC CGC OG1 doub N N 97 FLC CGC OG2 sing N N 98 FLC OHB HOB sing N N 99 GLN N CA sing N N 100 GLN N H sing N N 101 GLN N H2 sing N N 102 GLN CA C sing N N 103 GLN CA CB sing N N 104 GLN CA HA sing N N 105 GLN C O doub N N 106 GLN C OXT sing N N 107 GLN CB CG sing N N 108 GLN CB HB2 sing N N 109 GLN CB HB3 sing N N 110 GLN CG CD sing N N 111 GLN CG HG2 sing N N 112 GLN CG HG3 sing N N 113 GLN CD OE1 doub N N 114 GLN CD NE2 sing N N 115 GLN NE2 HE21 sing N N 116 GLN NE2 HE22 sing N N 117 GLN OXT HXT sing N N 118 GLU N CA sing N N 119 GLU N H sing N N 120 GLU N H2 sing N N 121 GLU CA C sing N N 122 GLU CA CB sing N N 123 GLU CA HA sing N N 124 GLU C O doub N N 125 GLU C OXT sing N N 126 GLU CB CG sing N N 127 GLU CB HB2 sing N N 128 GLU CB HB3 sing N N 129 GLU CG CD sing N N 130 GLU CG HG2 sing N N 131 GLU CG HG3 sing N N 132 GLU CD OE1 doub N N 133 GLU CD OE2 sing N N 134 GLU OE2 HE2 sing N N 135 GLU OXT HXT sing N N 136 GLY N CA sing N N 137 GLY N H sing N N 138 GLY N H2 sing N N 139 GLY CA C sing N N 140 GLY CA HA2 sing N N 141 GLY CA HA3 sing N N 142 GLY C O doub N N 143 GLY C OXT sing N N 144 GLY OXT HXT sing N N 145 HIS N CA sing N N 146 HIS N H sing N N 147 HIS N H2 sing N N 148 HIS CA C sing N N 149 HIS CA CB sing N N 150 HIS CA HA sing N N 151 HIS C O doub N N 152 HIS C OXT sing N N 153 HIS CB CG sing N N 154 HIS CB HB2 sing N N 155 HIS CB HB3 sing N N 156 HIS CG ND1 sing Y N 157 HIS CG CD2 doub Y N 158 HIS ND1 CE1 doub Y N 159 HIS ND1 HD1 sing N N 160 HIS CD2 NE2 sing Y N 161 HIS CD2 HD2 sing N N 162 HIS CE1 NE2 sing Y N 163 HIS CE1 HE1 sing N N 164 HIS NE2 HE2 sing N N 165 HIS OXT HXT sing N N 166 HOH O H1 sing N N 167 HOH O H2 sing N N 168 ILE N CA sing N N 169 ILE N H sing N N 170 ILE N H2 sing N N 171 ILE CA C sing N N 172 ILE CA CB sing N N 173 ILE CA HA sing N N 174 ILE C O doub N N 175 ILE C OXT sing N N 176 ILE CB CG1 sing N N 177 ILE CB CG2 sing N N 178 ILE CB HB sing N N 179 ILE CG1 CD1 sing N N 180 ILE CG1 HG12 sing N N 181 ILE CG1 HG13 sing N N 182 ILE CG2 HG21 sing N N 183 ILE CG2 HG22 sing N N 184 ILE CG2 HG23 sing N N 185 ILE CD1 HD11 sing N N 186 ILE CD1 HD12 sing N N 187 ILE CD1 HD13 sing N N 188 ILE OXT HXT sing N N 189 LEU N CA sing N N 190 LEU N H sing N N 191 LEU N H2 sing N N 192 LEU CA C sing N N 193 LEU CA CB sing N N 194 LEU CA HA sing N N 195 LEU C O doub N N 196 LEU C OXT sing N N 197 LEU CB CG sing N N 198 LEU CB HB2 sing N N 199 LEU CB HB3 sing N N 200 LEU CG CD1 sing N N 201 LEU CG CD2 sing N N 202 LEU CG HG sing N N 203 LEU CD1 HD11 sing N N 204 LEU CD1 HD12 sing N N 205 LEU CD1 HD13 sing N N 206 LEU CD2 HD21 sing N N 207 LEU CD2 HD22 sing N N 208 LEU CD2 HD23 sing N N 209 LEU OXT HXT sing N N 210 LYS N CA sing N N 211 LYS N H sing N N 212 LYS N H2 sing N N 213 LYS CA C sing N N 214 LYS CA CB sing N N 215 LYS CA HA sing N N 216 LYS C O doub N N 217 LYS C OXT sing N N 218 LYS CB CG sing N N 219 LYS CB HB2 sing N N 220 LYS CB HB3 sing N N 221 LYS CG CD sing N N 222 LYS CG HG2 sing N N 223 LYS CG HG3 sing N N 224 LYS CD CE sing N N 225 LYS CD HD2 sing N N 226 LYS CD HD3 sing N N 227 LYS CE NZ sing N N 228 LYS CE HE2 sing N N 229 LYS CE HE3 sing N N 230 LYS NZ HZ1 sing N N 231 LYS NZ HZ2 sing N N 232 LYS NZ HZ3 sing N N 233 LYS OXT HXT sing N N 234 MET N CA sing N N 235 MET N H sing N N 236 MET N H2 sing N N 237 MET CA C sing N N 238 MET CA CB sing N N 239 MET CA HA sing N N 240 MET C O doub N N 241 MET C OXT sing N N 242 MET CB CG sing N N 243 MET CB HB2 sing N N 244 MET CB HB3 sing N N 245 MET CG SD sing N N 246 MET CG HG2 sing N N 247 MET CG HG3 sing N N 248 MET SD CE sing N N 249 MET CE HE1 sing N N 250 MET CE HE2 sing N N 251 MET CE HE3 sing N N 252 MET OXT HXT sing N N 253 MPD C1 C2 sing N N 254 MPD C1 H11 sing N N 255 MPD C1 H12 sing N N 256 MPD C1 H13 sing N N 257 MPD C2 O2 sing N N 258 MPD C2 CM sing N N 259 MPD C2 C3 sing N N 260 MPD O2 HO2 sing N N 261 MPD CM HM1 sing N N 262 MPD CM HM2 sing N N 263 MPD CM HM3 sing N N 264 MPD C3 C4 sing N N 265 MPD C3 H31 sing N N 266 MPD C3 H32 sing N N 267 MPD C4 O4 sing N N 268 MPD C4 C5 sing N N 269 MPD C4 H4 sing N N 270 MPD O4 HO4 sing N N 271 MPD C5 H51 sing N N 272 MPD C5 H52 sing N N 273 MPD C5 H53 sing N N 274 PHE N CA sing N N 275 PHE N H sing N N 276 PHE N H2 sing N N 277 PHE CA C sing N N 278 PHE CA CB sing N N 279 PHE CA HA sing N N 280 PHE C O doub N N 281 PHE C OXT sing N N 282 PHE CB CG sing N N 283 PHE CB HB2 sing N N 284 PHE CB HB3 sing N N 285 PHE CG CD1 doub Y N 286 PHE CG CD2 sing Y N 287 PHE CD1 CE1 sing Y N 288 PHE CD1 HD1 sing N N 289 PHE CD2 CE2 doub Y N 290 PHE CD2 HD2 sing N N 291 PHE CE1 CZ doub Y N 292 PHE CE1 HE1 sing N N 293 PHE CE2 CZ sing Y N 294 PHE CE2 HE2 sing N N 295 PHE CZ HZ sing N N 296 PHE OXT HXT sing N N 297 PRO N CA sing N N 298 PRO N CD sing N N 299 PRO N H sing N N 300 PRO CA C sing N N 301 PRO CA CB sing N N 302 PRO CA HA sing N N 303 PRO C O doub N N 304 PRO C OXT sing N N 305 PRO CB CG sing N N 306 PRO CB HB2 sing N N 307 PRO CB HB3 sing N N 308 PRO CG CD sing N N 309 PRO CG HG2 sing N N 310 PRO CG HG3 sing N N 311 PRO CD HD2 sing N N 312 PRO CD HD3 sing N N 313 PRO OXT HXT sing N N 314 SER N CA sing N N 315 SER N H sing N N 316 SER N H2 sing N N 317 SER CA C sing N N 318 SER CA CB sing N N 319 SER CA HA sing N N 320 SER C O doub N N 321 SER C OXT sing N N 322 SER CB OG sing N N 323 SER CB HB2 sing N N 324 SER CB HB3 sing N N 325 SER OG HG sing N N 326 SER OXT HXT sing N N 327 THR N CA sing N N 328 THR N H sing N N 329 THR N H2 sing N N 330 THR CA C sing N N 331 THR CA CB sing N N 332 THR CA HA sing N N 333 THR C O doub N N 334 THR C OXT sing N N 335 THR CB OG1 sing N N 336 THR CB CG2 sing N N 337 THR CB HB sing N N 338 THR OG1 HG1 sing N N 339 THR CG2 HG21 sing N N 340 THR CG2 HG22 sing N N 341 THR CG2 HG23 sing N N 342 THR OXT HXT sing N N 343 TRP N CA sing N N 344 TRP N H sing N N 345 TRP N H2 sing N N 346 TRP CA C sing N N 347 TRP CA CB sing N N 348 TRP CA HA sing N N 349 TRP C O doub N N 350 TRP C OXT sing N N 351 TRP CB CG sing N N 352 TRP CB HB2 sing N N 353 TRP CB HB3 sing N N 354 TRP CG CD1 doub Y N 355 TRP CG CD2 sing Y N 356 TRP CD1 NE1 sing Y N 357 TRP CD1 HD1 sing N N 358 TRP CD2 CE2 doub Y N 359 TRP CD2 CE3 sing Y N 360 TRP NE1 CE2 sing Y N 361 TRP NE1 HE1 sing N N 362 TRP CE2 CZ2 sing Y N 363 TRP CE3 CZ3 doub Y N 364 TRP CE3 HE3 sing N N 365 TRP CZ2 CH2 doub Y N 366 TRP CZ2 HZ2 sing N N 367 TRP CZ3 CH2 sing Y N 368 TRP CZ3 HZ3 sing N N 369 TRP CH2 HH2 sing N N 370 TRP OXT HXT sing N N 371 TYR N CA sing N N 372 TYR N H sing N N 373 TYR N H2 sing N N 374 TYR CA C sing N N 375 TYR CA CB sing N N 376 TYR CA HA sing N N 377 TYR C O doub N N 378 TYR C OXT sing N N 379 TYR CB CG sing N N 380 TYR CB HB2 sing N N 381 TYR CB HB3 sing N N 382 TYR CG CD1 doub Y N 383 TYR CG CD2 sing Y N 384 TYR CD1 CE1 sing Y N 385 TYR CD1 HD1 sing N N 386 TYR CD2 CE2 doub Y N 387 TYR CD2 HD2 sing N N 388 TYR CE1 CZ doub Y N 389 TYR CE1 HE1 sing N N 390 TYR CE2 CZ sing Y N 391 TYR CE2 HE2 sing N N 392 TYR CZ OH sing N N 393 TYR OH HH sing N N 394 TYR OXT HXT sing N N 395 VAL N CA sing N N 396 VAL N H sing N N 397 VAL N H2 sing N N 398 VAL CA C sing N N 399 VAL CA CB sing N N 400 VAL CA HA sing N N 401 VAL C O doub N N 402 VAL C OXT sing N N 403 VAL CB CG1 sing N N 404 VAL CB CG2 sing N N 405 VAL CB HB sing N N 406 VAL CG1 HG11 sing N N 407 VAL CG1 HG12 sing N N 408 VAL CG1 HG13 sing N N 409 VAL CG2 HG21 sing N N 410 VAL CG2 HG22 sing N N 411 VAL CG2 HG23 sing N N 412 VAL OXT HXT sing N N 413 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CITRATE ANION' FLC 3 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1RYB _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #