data_6B25 # _entry.id 6B25 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6B25 pdb_00006b25 10.2210/pdb6b25/pdb WWPDB D_1000230114 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-10-25 2 'Structure model' 1 1 2017-11-08 3 'Structure model' 1 2 2017-11-22 4 'Structure model' 1 3 2017-12-06 5 'Structure model' 1 4 2020-01-08 6 'Structure model' 1 5 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Author supporting evidence' 5 6 'Structure model' 'Data collection' 6 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' pdbx_audit_support 4 5 'Structure model' pdbx_audit_support 5 6 'Structure model' chem_comp_atom 6 6 'Structure model' chem_comp_bond 7 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 4 'Structure model' '_pdbx_audit_support.funding_organization' 14 5 'Structure model' '_pdbx_audit_support.funding_organization' 15 6 'Structure model' '_database_2.pdbx_DOI' 16 6 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6B25 _pdbx_database_status.recvd_initial_deposition_date 2017-09-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wong King Yuen, S.M.' 1 ? 'Van Petegem, F.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 114 _citation.language ? _citation.page_first E9520 _citation.page_last E9528 _citation.title 'Structural insights into binding of STAC proteins to voltage-gated calcium channels.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1708852114 _citation.pdbx_database_id_PubMed 29078335 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wong King Yuen, S.M.' 1 ? primary 'Campiglio, M.' 2 ? primary 'Tung, C.C.' 3 ? primary 'Flucher, B.E.' 4 ? primary 'Van Petegem, F.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SH3 and cysteine-rich domain-containing protein' 13682.508 1 ? ? 'residues 296-411' ? 2 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305 1 ? ? ? ? 3 water nat water 18.015 32 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Src homology 3 and cysteine-rich domain-containing protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNANTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLQQNEKIFRCVRTFIGCKEQGQI TLKENQICVSSEEEQDGFIRVLSGKKKGLIPLDVLENI ; _entity_poly.pdbx_seq_one_letter_code_can ;SNANTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLQQNEKIFRCVRTFIGCKEQGQI TLKENQICVSSEEEQDGFIRVLSGKKKGLIPLDVLENI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 ASN n 1 5 THR n 1 6 TYR n 1 7 VAL n 1 8 ALA n 1 9 LEU n 1 10 TYR n 1 11 LYS n 1 12 PHE n 1 13 VAL n 1 14 PRO n 1 15 GLN n 1 16 GLU n 1 17 ASN n 1 18 GLU n 1 19 ASP n 1 20 LEU n 1 21 GLU n 1 22 MET n 1 23 ARG n 1 24 PRO n 1 25 GLY n 1 26 ASP n 1 27 ILE n 1 28 ILE n 1 29 THR n 1 30 LEU n 1 31 LEU n 1 32 GLU n 1 33 ASP n 1 34 SER n 1 35 ASN n 1 36 GLU n 1 37 ASP n 1 38 TRP n 1 39 TRP n 1 40 LYS n 1 41 GLY n 1 42 LYS n 1 43 ILE n 1 44 GLN n 1 45 ASP n 1 46 ARG n 1 47 ILE n 1 48 GLY n 1 49 PHE n 1 50 PHE n 1 51 PRO n 1 52 ALA n 1 53 ASN n 1 54 PHE n 1 55 VAL n 1 56 GLN n 1 57 ARG n 1 58 LEU n 1 59 GLN n 1 60 GLN n 1 61 ASN n 1 62 GLU n 1 63 LYS n 1 64 ILE n 1 65 PHE n 1 66 ARG n 1 67 CYS n 1 68 VAL n 1 69 ARG n 1 70 THR n 1 71 PHE n 1 72 ILE n 1 73 GLY n 1 74 CYS n 1 75 LYS n 1 76 GLU n 1 77 GLN n 1 78 GLY n 1 79 GLN n 1 80 ILE n 1 81 THR n 1 82 LEU n 1 83 LYS n 1 84 GLU n 1 85 ASN n 1 86 GLN n 1 87 ILE n 1 88 CYS n 1 89 VAL n 1 90 SER n 1 91 SER n 1 92 GLU n 1 93 GLU n 1 94 GLU n 1 95 GLN n 1 96 ASP n 1 97 GLY n 1 98 PHE n 1 99 ILE n 1 100 ARG n 1 101 VAL n 1 102 LEU n 1 103 SER n 1 104 GLY n 1 105 LYS n 1 106 LYS n 1 107 LYS n 1 108 GLY n 1 109 LEU n 1 110 ILE n 1 111 PRO n 1 112 LEU n 1 113 ASP n 1 114 VAL n 1 115 LEU n 1 116 GLU n 1 117 ASN n 1 118 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 118 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene STAC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EPE non-polymer . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES 'C8 H18 N2 O4 S' 238.305 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 ILE 118 118 118 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EPE 1 201 1 EPE EPE A . C 3 HOH 1 301 30 HOH HOH A . C 3 HOH 2 302 27 HOH HOH A . C 3 HOH 3 303 11 HOH HOH A . C 3 HOH 4 304 1 HOH HOH A . C 3 HOH 5 305 3 HOH HOH A . C 3 HOH 6 306 38 HOH HOH A . C 3 HOH 7 307 2 HOH HOH A . C 3 HOH 8 308 14 HOH HOH A . C 3 HOH 9 309 9 HOH HOH A . C 3 HOH 10 310 16 HOH HOH A . C 3 HOH 11 311 17 HOH HOH A . C 3 HOH 12 312 31 HOH HOH A . C 3 HOH 13 313 4 HOH HOH A . C 3 HOH 14 314 7 HOH HOH A . C 3 HOH 15 315 39 HOH HOH A . C 3 HOH 16 316 6 HOH HOH A . C 3 HOH 17 317 12 HOH HOH A . C 3 HOH 18 318 10 HOH HOH A . C 3 HOH 19 319 33 HOH HOH A . C 3 HOH 20 320 25 HOH HOH A . C 3 HOH 21 321 22 HOH HOH A . C 3 HOH 22 322 13 HOH HOH A . C 3 HOH 23 323 18 HOH HOH A . C 3 HOH 24 324 29 HOH HOH A . C 3 HOH 25 325 15 HOH HOH A . C 3 HOH 26 326 5 HOH HOH A . C 3 HOH 27 327 28 HOH HOH A . C 3 HOH 28 328 32 HOH HOH A . C 3 HOH 29 329 23 HOH HOH A . C 3 HOH 30 330 20 HOH HOH A . C 3 HOH 31 331 36 HOH HOH A . C 3 HOH 32 332 24 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 23 ? CG ? A ARG 23 CG 2 1 Y 1 A ARG 23 ? CD ? A ARG 23 CD 3 1 Y 1 A ARG 23 ? NE ? A ARG 23 NE 4 1 Y 1 A ARG 23 ? CZ ? A ARG 23 CZ 5 1 Y 1 A ARG 23 ? NH1 ? A ARG 23 NH1 6 1 Y 1 A ARG 23 ? NH2 ? A ARG 23 NH2 7 1 Y 1 A GLN 60 ? CG ? A GLN 60 CG 8 1 Y 1 A GLN 60 ? CD ? A GLN 60 CD 9 1 Y 1 A GLN 60 ? OE1 ? A GLN 60 OE1 10 1 Y 1 A GLN 60 ? NE2 ? A GLN 60 NE2 11 1 Y 1 A ASN 61 ? CG ? A ASN 61 CG 12 1 Y 1 A ASN 61 ? OD1 ? A ASN 61 OD1 13 1 Y 1 A ASN 61 ? ND2 ? A ASN 61 ND2 14 1 Y 1 A LYS 63 ? CG ? A LYS 63 CG 15 1 Y 1 A LYS 63 ? CD ? A LYS 63 CD 16 1 Y 1 A LYS 63 ? CE ? A LYS 63 CE 17 1 Y 1 A LYS 63 ? NZ ? A LYS 63 NZ 18 1 Y 1 A LYS 75 ? CG ? A LYS 75 CG 19 1 Y 1 A LYS 75 ? CD ? A LYS 75 CD 20 1 Y 1 A LYS 75 ? CE ? A LYS 75 CE 21 1 Y 1 A LYS 75 ? NZ ? A LYS 75 NZ 22 1 Y 1 A GLU 76 ? CG ? A GLU 76 CG 23 1 Y 1 A GLU 76 ? CD ? A GLU 76 CD 24 1 Y 1 A GLU 76 ? OE1 ? A GLU 76 OE1 25 1 Y 1 A GLU 76 ? OE2 ? A GLU 76 OE2 26 1 Y 1 A GLN 77 ? CG ? A GLN 77 CG 27 1 Y 1 A GLN 77 ? CD ? A GLN 77 CD 28 1 Y 1 A GLN 77 ? OE1 ? A GLN 77 OE1 29 1 Y 1 A GLN 77 ? NE2 ? A GLN 77 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6B25 _cell.details ? _cell.formula_units_Z ? _cell.length_a 28.958 _cell.length_a_esd ? _cell.length_b 36.727 _cell.length_b_esd ? _cell.length_c 113.001 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6B25 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6B25 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.99 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M sodium-HEPES, 25% PEG1000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-05-06 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6B25 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.390 _reflns.d_resolution_low 56.5000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5120 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.000 _reflns.pdbx_Rmerge_I_obs 0.124 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.044 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.143 _reflns.pdbx_Rpim_I_all 0.069 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.390 2.460 ? ? ? ? ? ? 406 93.800 ? ? ? ? 0.520 ? ? ? ? ? ? ? ? 3.200 ? 1.029 ? ? 0.619 0.327 ? 1 1 0.793 ? 2.460 2.540 ? ? ? ? ? ? 408 98.800 ? ? ? ? 0.475 ? ? ? ? ? ? ? ? 3.700 ? 1.112 ? ? 0.557 0.283 ? 2 1 0.713 ? 2.540 2.630 ? ? ? ? ? ? 429 97.900 ? ? ? ? 0.445 ? ? ? ? ? ? ? ? 4.100 ? 0.944 ? ? 0.511 0.246 ? 3 1 0.833 ? 2.630 2.740 ? ? ? ? ? ? 389 97.700 ? ? ? ? 0.359 ? ? ? ? ? ? ? ? 4.000 ? 1.151 ? ? 0.415 0.202 ? 4 1 0.854 ? 2.740 2.860 ? ? ? ? ? ? 424 97.700 ? ? ? ? 0.291 ? ? ? ? ? ? ? ? 3.800 ? 1.169 ? ? 0.337 0.165 ? 5 1 0.904 ? 2.860 3.010 ? ? ? ? ? ? 409 98.600 ? ? ? ? 0.217 ? ? ? ? ? ? ? ? 4.400 ? 1.077 ? ? 0.247 0.116 ? 6 1 0.925 ? 3.010 3.200 ? ? ? ? ? ? 428 99.100 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 4.300 ? 1.024 ? ? 0.201 0.095 ? 7 1 0.961 ? 3.200 3.450 ? ? ? ? ? ? 419 97.900 ? ? ? ? 0.141 ? ? ? ? ? ? ? ? 4.100 ? 1.045 ? ? 0.163 0.079 ? 8 1 0.976 ? 3.450 3.790 ? ? ? ? ? ? 432 98.900 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 4.100 ? 1.037 ? ? 0.120 0.058 ? 9 1 0.986 ? 3.790 4.340 ? ? ? ? ? ? 441 98.900 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 4.200 ? 0.994 ? ? 0.100 0.048 ? 10 1 0.987 ? 4.340 5.470 ? ? ? ? ? ? 439 98.400 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 4.100 ? 1.024 ? ? 0.094 0.044 ? 11 1 0.992 ? 5.470 35.000 ? ? ? ? ? ? 496 97.800 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 3.800 ? 0.958 ? ? 0.095 0.046 ? 12 1 0.986 ? # _refine.aniso_B[1][1] 1.4000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -0.1100 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -1.3000 _refine.B_iso_max 73.070 _refine.B_iso_mean 34.5830 _refine.B_iso_min 19.690 _refine.correlation_coeff_Fo_to_Fc 0.9410 _refine.correlation_coeff_Fo_to_Fc_free 0.9010 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6B25 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3900 _refine.ls_d_res_low 56.5000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4819 _refine.ls_number_reflns_R_free 273 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.6600 _refine.ls_percent_reflns_R_free 5.4000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2054 _refine.ls_R_factor_R_free 0.2588 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2026 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.4910 _refine.pdbx_overall_ESU_R_Free 0.2830 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.3370 _refine.overall_SU_ML 0.1910 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.3900 _refine_hist.d_res_low 56.5000 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 960 _refine_hist.pdbx_number_residues_total 115 _refine_hist.pdbx_B_iso_mean_ligand 50.33 _refine_hist.pdbx_B_iso_mean_solvent 35.74 _refine_hist.pdbx_number_atoms_protein 913 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.020 944 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 871 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.528 1.978 1275 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.907 3.000 2025 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.956 5.000 114 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 40.298 25.532 47 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.186 15.000 166 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 13.538 15.000 5 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.074 0.200 142 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 1036 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 185 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.3850 _refine_ls_shell.d_res_low 2.4470 _refine_ls_shell.number_reflns_all 352 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 21 _refine_ls_shell.number_reflns_R_work 331 _refine_ls_shell.percent_reflns_obs 88.4400 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3600 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2800 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6B25 _struct.title 'Crystal structure of human STAC1 Tandem SH3 Domains (288-402)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6B25 _struct_keywords.text 'Excitation-contraction coupling, ion channel adaptor protein, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STAC_HUMAN _struct_ref.pdbx_db_accession Q99469 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLQQNEKIFRCVRTFIGCKEQGQITLK ENQICVSSEEEQDGFIRVLSGKKKGLIPLDVLENI ; _struct_ref.pdbx_align_begin 288 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6B25 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 118 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99469 _struct_ref_seq.db_align_beg 288 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 402 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 118 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6B25 SER A 1 ? UNP Q99469 ? ? 'expression tag' 1 1 1 6B25 ASN A 2 ? UNP Q99469 ? ? 'expression tag' 2 2 1 6B25 ALA A 3 ? UNP Q99469 ? ? 'expression tag' 3 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 74 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 78 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 74 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 78 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 46 ? PRO A 51 ? ARG A 46 PRO A 51 AA1 2 TRP A 38 ? ILE A 43 ? TRP A 38 ILE A 43 AA1 3 ILE A 27 ? GLU A 32 ? ILE A 27 GLU A 32 AA1 4 THR A 5 ? ALA A 8 ? THR A 5 ALA A 8 AA1 5 VAL A 55 ? ARG A 57 ? VAL A 55 ARG A 57 AA2 1 ILE A 87 ? SER A 90 ? ILE A 87 SER A 90 AA2 2 LYS A 63 ? CYS A 67 ? LYS A 63 CYS A 67 AA2 3 LEU A 115 ? GLU A 116 ? LEU A 115 GLU A 116 AA3 1 PHE A 98 ? SER A 103 ? PHE A 98 SER A 103 AA3 2 LYS A 106 ? PRO A 111 ? LYS A 106 PRO A 111 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 48 ? O GLY A 48 N GLY A 41 ? N GLY A 41 AA1 2 3 O LYS A 40 ? O LYS A 40 N GLU A 32 ? N GLU A 32 AA1 3 4 O ILE A 28 ? O ILE A 28 N TYR A 6 ? N TYR A 6 AA1 4 5 N VAL A 7 ? N VAL A 7 O GLN A 56 ? O GLN A 56 AA2 1 2 O SER A 90 ? O SER A 90 N LYS A 63 ? N LYS A 63 AA2 2 3 N ARG A 66 ? N ARG A 66 O GLU A 116 ? O GLU A 116 AA3 1 2 N ILE A 99 ? N ILE A 99 O ILE A 110 ? O ILE A 110 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id EPE _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue EPE A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLU A 18 ? GLU A 18 . ? 1_555 ? 2 AC1 5 ASP A 19 ? ASP A 19 . ? 1_555 ? 3 AC1 5 ASN A 35 ? ASN A 35 . ? 1_555 ? 4 AC1 5 TRP A 38 ? TRP A 38 . ? 1_555 ? 5 AC1 5 LYS A 83 ? LYS A 83 . ? 3_545 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 44 ? ? 44.78 -117.42 2 1 ASN A 85 ? ? 78.02 -4.40 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A ALA 3 ? A ALA 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EPE N1 N N N 88 EPE C2 C N N 89 EPE C3 C N N 90 EPE N4 N N N 91 EPE C5 C N N 92 EPE C6 C N N 93 EPE C7 C N N 94 EPE C8 C N N 95 EPE O8 O N N 96 EPE C9 C N N 97 EPE C10 C N N 98 EPE S S N N 99 EPE O1S O N N 100 EPE O2S O N N 101 EPE O3S O N N 102 EPE H21 H N N 103 EPE H22 H N N 104 EPE H31 H N N 105 EPE H32 H N N 106 EPE H51 H N N 107 EPE H52 H N N 108 EPE H61 H N N 109 EPE H62 H N N 110 EPE H71 H N N 111 EPE H72 H N N 112 EPE H81 H N N 113 EPE H82 H N N 114 EPE HO8 H N N 115 EPE H91 H N N 116 EPE H92 H N N 117 EPE H101 H N N 118 EPE H102 H N N 119 EPE HOS3 H N N 120 GLN N N N N 121 GLN CA C N S 122 GLN C C N N 123 GLN O O N N 124 GLN CB C N N 125 GLN CG C N N 126 GLN CD C N N 127 GLN OE1 O N N 128 GLN NE2 N N N 129 GLN OXT O N N 130 GLN H H N N 131 GLN H2 H N N 132 GLN HA H N N 133 GLN HB2 H N N 134 GLN HB3 H N N 135 GLN HG2 H N N 136 GLN HG3 H N N 137 GLN HE21 H N N 138 GLN HE22 H N N 139 GLN HXT H N N 140 GLU N N N N 141 GLU CA C N S 142 GLU C C N N 143 GLU O O N N 144 GLU CB C N N 145 GLU CG C N N 146 GLU CD C N N 147 GLU OE1 O N N 148 GLU OE2 O N N 149 GLU OXT O N N 150 GLU H H N N 151 GLU H2 H N N 152 GLU HA H N N 153 GLU HB2 H N N 154 GLU HB3 H N N 155 GLU HG2 H N N 156 GLU HG3 H N N 157 GLU HE2 H N N 158 GLU HXT H N N 159 GLY N N N N 160 GLY CA C N N 161 GLY C C N N 162 GLY O O N N 163 GLY OXT O N N 164 GLY H H N N 165 GLY H2 H N N 166 GLY HA2 H N N 167 GLY HA3 H N N 168 GLY HXT H N N 169 HOH O O N N 170 HOH H1 H N N 171 HOH H2 H N N 172 ILE N N N N 173 ILE CA C N S 174 ILE C C N N 175 ILE O O N N 176 ILE CB C N S 177 ILE CG1 C N N 178 ILE CG2 C N N 179 ILE CD1 C N N 180 ILE OXT O N N 181 ILE H H N N 182 ILE H2 H N N 183 ILE HA H N N 184 ILE HB H N N 185 ILE HG12 H N N 186 ILE HG13 H N N 187 ILE HG21 H N N 188 ILE HG22 H N N 189 ILE HG23 H N N 190 ILE HD11 H N N 191 ILE HD12 H N N 192 ILE HD13 H N N 193 ILE HXT H N N 194 LEU N N N N 195 LEU CA C N S 196 LEU C C N N 197 LEU O O N N 198 LEU CB C N N 199 LEU CG C N N 200 LEU CD1 C N N 201 LEU CD2 C N N 202 LEU OXT O N N 203 LEU H H N N 204 LEU H2 H N N 205 LEU HA H N N 206 LEU HB2 H N N 207 LEU HB3 H N N 208 LEU HG H N N 209 LEU HD11 H N N 210 LEU HD12 H N N 211 LEU HD13 H N N 212 LEU HD21 H N N 213 LEU HD22 H N N 214 LEU HD23 H N N 215 LEU HXT H N N 216 LYS N N N N 217 LYS CA C N S 218 LYS C C N N 219 LYS O O N N 220 LYS CB C N N 221 LYS CG C N N 222 LYS CD C N N 223 LYS CE C N N 224 LYS NZ N N N 225 LYS OXT O N N 226 LYS H H N N 227 LYS H2 H N N 228 LYS HA H N N 229 LYS HB2 H N N 230 LYS HB3 H N N 231 LYS HG2 H N N 232 LYS HG3 H N N 233 LYS HD2 H N N 234 LYS HD3 H N N 235 LYS HE2 H N N 236 LYS HE3 H N N 237 LYS HZ1 H N N 238 LYS HZ2 H N N 239 LYS HZ3 H N N 240 LYS HXT H N N 241 MET N N N N 242 MET CA C N S 243 MET C C N N 244 MET O O N N 245 MET CB C N N 246 MET CG C N N 247 MET SD S N N 248 MET CE C N N 249 MET OXT O N N 250 MET H H N N 251 MET H2 H N N 252 MET HA H N N 253 MET HB2 H N N 254 MET HB3 H N N 255 MET HG2 H N N 256 MET HG3 H N N 257 MET HE1 H N N 258 MET HE2 H N N 259 MET HE3 H N N 260 MET HXT H N N 261 PHE N N N N 262 PHE CA C N S 263 PHE C C N N 264 PHE O O N N 265 PHE CB C N N 266 PHE CG C Y N 267 PHE CD1 C Y N 268 PHE CD2 C Y N 269 PHE CE1 C Y N 270 PHE CE2 C Y N 271 PHE CZ C Y N 272 PHE OXT O N N 273 PHE H H N N 274 PHE H2 H N N 275 PHE HA H N N 276 PHE HB2 H N N 277 PHE HB3 H N N 278 PHE HD1 H N N 279 PHE HD2 H N N 280 PHE HE1 H N N 281 PHE HE2 H N N 282 PHE HZ H N N 283 PHE HXT H N N 284 PRO N N N N 285 PRO CA C N S 286 PRO C C N N 287 PRO O O N N 288 PRO CB C N N 289 PRO CG C N N 290 PRO CD C N N 291 PRO OXT O N N 292 PRO H H N N 293 PRO HA H N N 294 PRO HB2 H N N 295 PRO HB3 H N N 296 PRO HG2 H N N 297 PRO HG3 H N N 298 PRO HD2 H N N 299 PRO HD3 H N N 300 PRO HXT H N N 301 SER N N N N 302 SER CA C N S 303 SER C C N N 304 SER O O N N 305 SER CB C N N 306 SER OG O N N 307 SER OXT O N N 308 SER H H N N 309 SER H2 H N N 310 SER HA H N N 311 SER HB2 H N N 312 SER HB3 H N N 313 SER HG H N N 314 SER HXT H N N 315 THR N N N N 316 THR CA C N S 317 THR C C N N 318 THR O O N N 319 THR CB C N R 320 THR OG1 O N N 321 THR CG2 C N N 322 THR OXT O N N 323 THR H H N N 324 THR H2 H N N 325 THR HA H N N 326 THR HB H N N 327 THR HG1 H N N 328 THR HG21 H N N 329 THR HG22 H N N 330 THR HG23 H N N 331 THR HXT H N N 332 TRP N N N N 333 TRP CA C N S 334 TRP C C N N 335 TRP O O N N 336 TRP CB C N N 337 TRP CG C Y N 338 TRP CD1 C Y N 339 TRP CD2 C Y N 340 TRP NE1 N Y N 341 TRP CE2 C Y N 342 TRP CE3 C Y N 343 TRP CZ2 C Y N 344 TRP CZ3 C Y N 345 TRP CH2 C Y N 346 TRP OXT O N N 347 TRP H H N N 348 TRP H2 H N N 349 TRP HA H N N 350 TRP HB2 H N N 351 TRP HB3 H N N 352 TRP HD1 H N N 353 TRP HE1 H N N 354 TRP HE3 H N N 355 TRP HZ2 H N N 356 TRP HZ3 H N N 357 TRP HH2 H N N 358 TRP HXT H N N 359 TYR N N N N 360 TYR CA C N S 361 TYR C C N N 362 TYR O O N N 363 TYR CB C N N 364 TYR CG C Y N 365 TYR CD1 C Y N 366 TYR CD2 C Y N 367 TYR CE1 C Y N 368 TYR CE2 C Y N 369 TYR CZ C Y N 370 TYR OH O N N 371 TYR OXT O N N 372 TYR H H N N 373 TYR H2 H N N 374 TYR HA H N N 375 TYR HB2 H N N 376 TYR HB3 H N N 377 TYR HD1 H N N 378 TYR HD2 H N N 379 TYR HE1 H N N 380 TYR HE2 H N N 381 TYR HH H N N 382 TYR HXT H N N 383 VAL N N N N 384 VAL CA C N S 385 VAL C C N N 386 VAL O O N N 387 VAL CB C N N 388 VAL CG1 C N N 389 VAL CG2 C N N 390 VAL OXT O N N 391 VAL H H N N 392 VAL H2 H N N 393 VAL HA H N N 394 VAL HB H N N 395 VAL HG11 H N N 396 VAL HG12 H N N 397 VAL HG13 H N N 398 VAL HG21 H N N 399 VAL HG22 H N N 400 VAL HG23 H N N 401 VAL HXT H N N 402 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EPE N1 C2 sing N N 83 EPE N1 C6 sing N N 84 EPE N1 C9 sing N N 85 EPE C2 C3 sing N N 86 EPE C2 H21 sing N N 87 EPE C2 H22 sing N N 88 EPE C3 N4 sing N N 89 EPE C3 H31 sing N N 90 EPE C3 H32 sing N N 91 EPE N4 C5 sing N N 92 EPE N4 C7 sing N N 93 EPE C5 C6 sing N N 94 EPE C5 H51 sing N N 95 EPE C5 H52 sing N N 96 EPE C6 H61 sing N N 97 EPE C6 H62 sing N N 98 EPE C7 C8 sing N N 99 EPE C7 H71 sing N N 100 EPE C7 H72 sing N N 101 EPE C8 O8 sing N N 102 EPE C8 H81 sing N N 103 EPE C8 H82 sing N N 104 EPE O8 HO8 sing N N 105 EPE C9 C10 sing N N 106 EPE C9 H91 sing N N 107 EPE C9 H92 sing N N 108 EPE C10 S sing N N 109 EPE C10 H101 sing N N 110 EPE C10 H102 sing N N 111 EPE S O1S doub N N 112 EPE S O2S doub N N 113 EPE S O3S sing N N 114 EPE O3S HOS3 sing N N 115 GLN N CA sing N N 116 GLN N H sing N N 117 GLN N H2 sing N N 118 GLN CA C sing N N 119 GLN CA CB sing N N 120 GLN CA HA sing N N 121 GLN C O doub N N 122 GLN C OXT sing N N 123 GLN CB CG sing N N 124 GLN CB HB2 sing N N 125 GLN CB HB3 sing N N 126 GLN CG CD sing N N 127 GLN CG HG2 sing N N 128 GLN CG HG3 sing N N 129 GLN CD OE1 doub N N 130 GLN CD NE2 sing N N 131 GLN NE2 HE21 sing N N 132 GLN NE2 HE22 sing N N 133 GLN OXT HXT sing N N 134 GLU N CA sing N N 135 GLU N H sing N N 136 GLU N H2 sing N N 137 GLU CA C sing N N 138 GLU CA CB sing N N 139 GLU CA HA sing N N 140 GLU C O doub N N 141 GLU C OXT sing N N 142 GLU CB CG sing N N 143 GLU CB HB2 sing N N 144 GLU CB HB3 sing N N 145 GLU CG CD sing N N 146 GLU CG HG2 sing N N 147 GLU CG HG3 sing N N 148 GLU CD OE1 doub N N 149 GLU CD OE2 sing N N 150 GLU OE2 HE2 sing N N 151 GLU OXT HXT sing N N 152 GLY N CA sing N N 153 GLY N H sing N N 154 GLY N H2 sing N N 155 GLY CA C sing N N 156 GLY CA HA2 sing N N 157 GLY CA HA3 sing N N 158 GLY C O doub N N 159 GLY C OXT sing N N 160 GLY OXT HXT sing N N 161 HOH O H1 sing N N 162 HOH O H2 sing N N 163 ILE N CA sing N N 164 ILE N H sing N N 165 ILE N H2 sing N N 166 ILE CA C sing N N 167 ILE CA CB sing N N 168 ILE CA HA sing N N 169 ILE C O doub N N 170 ILE C OXT sing N N 171 ILE CB CG1 sing N N 172 ILE CB CG2 sing N N 173 ILE CB HB sing N N 174 ILE CG1 CD1 sing N N 175 ILE CG1 HG12 sing N N 176 ILE CG1 HG13 sing N N 177 ILE CG2 HG21 sing N N 178 ILE CG2 HG22 sing N N 179 ILE CG2 HG23 sing N N 180 ILE CD1 HD11 sing N N 181 ILE CD1 HD12 sing N N 182 ILE CD1 HD13 sing N N 183 ILE OXT HXT sing N N 184 LEU N CA sing N N 185 LEU N H sing N N 186 LEU N H2 sing N N 187 LEU CA C sing N N 188 LEU CA CB sing N N 189 LEU CA HA sing N N 190 LEU C O doub N N 191 LEU C OXT sing N N 192 LEU CB CG sing N N 193 LEU CB HB2 sing N N 194 LEU CB HB3 sing N N 195 LEU CG CD1 sing N N 196 LEU CG CD2 sing N N 197 LEU CG HG sing N N 198 LEU CD1 HD11 sing N N 199 LEU CD1 HD12 sing N N 200 LEU CD1 HD13 sing N N 201 LEU CD2 HD21 sing N N 202 LEU CD2 HD22 sing N N 203 LEU CD2 HD23 sing N N 204 LEU OXT HXT sing N N 205 LYS N CA sing N N 206 LYS N H sing N N 207 LYS N H2 sing N N 208 LYS CA C sing N N 209 LYS CA CB sing N N 210 LYS CA HA sing N N 211 LYS C O doub N N 212 LYS C OXT sing N N 213 LYS CB CG sing N N 214 LYS CB HB2 sing N N 215 LYS CB HB3 sing N N 216 LYS CG CD sing N N 217 LYS CG HG2 sing N N 218 LYS CG HG3 sing N N 219 LYS CD CE sing N N 220 LYS CD HD2 sing N N 221 LYS CD HD3 sing N N 222 LYS CE NZ sing N N 223 LYS CE HE2 sing N N 224 LYS CE HE3 sing N N 225 LYS NZ HZ1 sing N N 226 LYS NZ HZ2 sing N N 227 LYS NZ HZ3 sing N N 228 LYS OXT HXT sing N N 229 MET N CA sing N N 230 MET N H sing N N 231 MET N H2 sing N N 232 MET CA C sing N N 233 MET CA CB sing N N 234 MET CA HA sing N N 235 MET C O doub N N 236 MET C OXT sing N N 237 MET CB CG sing N N 238 MET CB HB2 sing N N 239 MET CB HB3 sing N N 240 MET CG SD sing N N 241 MET CG HG2 sing N N 242 MET CG HG3 sing N N 243 MET SD CE sing N N 244 MET CE HE1 sing N N 245 MET CE HE2 sing N N 246 MET CE HE3 sing N N 247 MET OXT HXT sing N N 248 PHE N CA sing N N 249 PHE N H sing N N 250 PHE N H2 sing N N 251 PHE CA C sing N N 252 PHE CA CB sing N N 253 PHE CA HA sing N N 254 PHE C O doub N N 255 PHE C OXT sing N N 256 PHE CB CG sing N N 257 PHE CB HB2 sing N N 258 PHE CB HB3 sing N N 259 PHE CG CD1 doub Y N 260 PHE CG CD2 sing Y N 261 PHE CD1 CE1 sing Y N 262 PHE CD1 HD1 sing N N 263 PHE CD2 CE2 doub Y N 264 PHE CD2 HD2 sing N N 265 PHE CE1 CZ doub Y N 266 PHE CE1 HE1 sing N N 267 PHE CE2 CZ sing Y N 268 PHE CE2 HE2 sing N N 269 PHE CZ HZ sing N N 270 PHE OXT HXT sing N N 271 PRO N CA sing N N 272 PRO N CD sing N N 273 PRO N H sing N N 274 PRO CA C sing N N 275 PRO CA CB sing N N 276 PRO CA HA sing N N 277 PRO C O doub N N 278 PRO C OXT sing N N 279 PRO CB CG sing N N 280 PRO CB HB2 sing N N 281 PRO CB HB3 sing N N 282 PRO CG CD sing N N 283 PRO CG HG2 sing N N 284 PRO CG HG3 sing N N 285 PRO CD HD2 sing N N 286 PRO CD HD3 sing N N 287 PRO OXT HXT sing N N 288 SER N CA sing N N 289 SER N H sing N N 290 SER N H2 sing N N 291 SER CA C sing N N 292 SER CA CB sing N N 293 SER CA HA sing N N 294 SER C O doub N N 295 SER C OXT sing N N 296 SER CB OG sing N N 297 SER CB HB2 sing N N 298 SER CB HB3 sing N N 299 SER OG HG sing N N 300 SER OXT HXT sing N N 301 THR N CA sing N N 302 THR N H sing N N 303 THR N H2 sing N N 304 THR CA C sing N N 305 THR CA CB sing N N 306 THR CA HA sing N N 307 THR C O doub N N 308 THR C OXT sing N N 309 THR CB OG1 sing N N 310 THR CB CG2 sing N N 311 THR CB HB sing N N 312 THR OG1 HG1 sing N N 313 THR CG2 HG21 sing N N 314 THR CG2 HG22 sing N N 315 THR CG2 HG23 sing N N 316 THR OXT HXT sing N N 317 TRP N CA sing N N 318 TRP N H sing N N 319 TRP N H2 sing N N 320 TRP CA C sing N N 321 TRP CA CB sing N N 322 TRP CA HA sing N N 323 TRP C O doub N N 324 TRP C OXT sing N N 325 TRP CB CG sing N N 326 TRP CB HB2 sing N N 327 TRP CB HB3 sing N N 328 TRP CG CD1 doub Y N 329 TRP CG CD2 sing Y N 330 TRP CD1 NE1 sing Y N 331 TRP CD1 HD1 sing N N 332 TRP CD2 CE2 doub Y N 333 TRP CD2 CE3 sing Y N 334 TRP NE1 CE2 sing Y N 335 TRP NE1 HE1 sing N N 336 TRP CE2 CZ2 sing Y N 337 TRP CE3 CZ3 doub Y N 338 TRP CE3 HE3 sing N N 339 TRP CZ2 CH2 doub Y N 340 TRP CZ2 HZ2 sing N N 341 TRP CZ3 CH2 sing Y N 342 TRP CZ3 HZ3 sing N N 343 TRP CH2 HH2 sing N N 344 TRP OXT HXT sing N N 345 TYR N CA sing N N 346 TYR N H sing N N 347 TYR N H2 sing N N 348 TYR CA C sing N N 349 TYR CA CB sing N N 350 TYR CA HA sing N N 351 TYR C O doub N N 352 TYR C OXT sing N N 353 TYR CB CG sing N N 354 TYR CB HB2 sing N N 355 TYR CB HB3 sing N N 356 TYR CG CD1 doub Y N 357 TYR CG CD2 sing Y N 358 TYR CD1 CE1 sing Y N 359 TYR CD1 HD1 sing N N 360 TYR CD2 CE2 doub Y N 361 TYR CD2 HD2 sing N N 362 TYR CE1 CZ doub Y N 363 TYR CE1 HE1 sing N N 364 TYR CE2 CZ sing Y N 365 TYR CE2 HE2 sing N N 366 TYR CZ OH sing N N 367 TYR OH HH sing N N 368 TYR OXT HXT sing N N 369 VAL N CA sing N N 370 VAL N H sing N N 371 VAL N H2 sing N N 372 VAL CA C sing N N 373 VAL CA CB sing N N 374 VAL CA HA sing N N 375 VAL C O doub N N 376 VAL C OXT sing N N 377 VAL CB CG1 sing N N 378 VAL CB CG2 sing N N 379 VAL CB HB sing N N 380 VAL CG1 HG11 sing N N 381 VAL CG1 HG12 sing N N 382 VAL CG1 HG13 sing N N 383 VAL CG2 HG21 sing N N 384 VAL CG2 HG22 sing N N 385 VAL CG2 HG23 sing N N 386 VAL OXT HXT sing N N 387 # _pdbx_audit_support.funding_organization 'Canadian Institutes of Health Research (CIHR)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number MOP-119608 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 6B25 _atom_sites.fract_transf_matrix[1][1] 0.034533 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027228 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008849 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_