data_6BGM # _entry.id 6BGM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6BGM pdb_00006bgm 10.2210/pdb6bgm/pdb WWPDB D_1000230857 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6BGM _pdbx_database_status.recvd_initial_deposition_date 2017-10-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, A.' 1 0000-0002-4182-8176 'Li, J.' 2 ? 'Shin, I.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat. Chem. Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 853 _citation.page_last 860 _citation.title 'Cleavage of a carbon-fluorine bond by an engineered cysteine dioxygenase.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41589-018-0085-5 _citation.pdbx_database_id_PubMed 29942080 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, J.' 1 ? primary 'Griffith, W.P.' 2 ? primary 'Davis, I.' 3 ? primary 'Shin, I.' 4 ? primary 'Wang, J.' 5 ? primary 'Li, F.' 6 ? primary 'Wang, Y.' 7 ? primary 'Wherritt, D.J.' 8 0000-0002-8616-9864 primary 'Liu, A.' 9 0000-0002-4182-8176 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6BGM _cell.details ? _cell.formula_units_Z ? _cell.length_a 131.757 _cell.length_a_esd ? _cell.length_b 131.757 _cell.length_b_esd ? _cell.length_c 34.262 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6BGM _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cysteine dioxygenase type 1' 22945.756 1 1.13.11.20 ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 5 water nat water 18.015 72 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cysteine dioxygenase type I, CDO-I' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN ; _entity_poly.pdbx_seq_one_letter_code_can ;SEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 GLN n 1 4 THR n 1 5 GLU n 1 6 VAL n 1 7 LEU n 1 8 LYS n 1 9 PRO n 1 10 ARG n 1 11 THR n 1 12 LEU n 1 13 ALA n 1 14 ASP n 1 15 LEU n 1 16 ILE n 1 17 ARG n 1 18 ILE n 1 19 LEU n 1 20 HIS n 1 21 GLN n 1 22 LEU n 1 23 PHE n 1 24 ALA n 1 25 GLY n 1 26 ASP n 1 27 GLU n 1 28 VAL n 1 29 ASN n 1 30 VAL n 1 31 GLU n 1 32 GLU n 1 33 VAL n 1 34 GLN n 1 35 ALA n 1 36 ILE n 1 37 MET n 1 38 GLU n 1 39 ALA n 1 40 TYR n 1 41 GLU n 1 42 SER n 1 43 ASP n 1 44 PRO n 1 45 THR n 1 46 GLU n 1 47 TRP n 1 48 ALA n 1 49 MET n 1 50 TYR n 1 51 ALA n 1 52 LYS n 1 53 PHE n 1 54 ASP n 1 55 GLN n 1 56 TYR n 1 57 ARG n 1 58 TYR n 1 59 THR n 1 60 ARG n 1 61 ASN n 1 62 LEU n 1 63 VAL n 1 64 ASP n 1 65 GLN n 1 66 GLY n 1 67 ASN n 1 68 GLY n 1 69 LYS n 1 70 PHE n 1 71 ASN n 1 72 LEU n 1 73 MET n 1 74 ILE n 1 75 LEU n 1 76 CYS n 1 77 TRP n 1 78 GLY n 1 79 GLU n 1 80 GLY n 1 81 HIS n 1 82 GLY n 1 83 SER n 1 84 SER n 1 85 ILE n 1 86 HIS n 1 87 ASP n 1 88 HIS n 1 89 THR n 1 90 ASN n 1 91 SER n 1 92 HIS n 1 93 CYS n 1 94 PHE n 1 95 LEU n 1 96 LYS n 1 97 MET n 1 98 LEU n 1 99 GLN n 1 100 GLY n 1 101 ASN n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 THR n 1 106 LEU n 1 107 PHE n 1 108 ALA n 1 109 TRP n 1 110 PRO n 1 111 ASP n 1 112 LYS n 1 113 LYS n 1 114 SER n 1 115 ASN n 1 116 GLU n 1 117 MET n 1 118 VAL n 1 119 LYS n 1 120 LYS n 1 121 SER n 1 122 GLU n 1 123 ARG n 1 124 VAL n 1 125 LEU n 1 126 ARG n 1 127 GLU n 1 128 ASN n 1 129 GLN n 1 130 CYS n 1 131 ALA n 1 132 TYR n 1 133 ILE n 1 134 ASN n 1 135 ASP n 1 136 SER n 1 137 VAL n 1 138 GLY n 1 139 LEU n 1 140 HIS n 1 141 ARG n 1 142 VAL n 1 143 GLU n 1 144 ASN n 1 145 ILE n 1 146 SER n 1 147 HIS n 1 148 THR n 1 149 GLU n 1 150 PRO n 1 151 ALA n 1 152 VAL n 1 153 SER n 1 154 LEU n 1 155 HIS n 1 156 LEU n 1 157 TYR n 1 158 SER n 1 159 PRO n 1 160 PRO n 1 161 PHE n 1 162 ASP n 1 163 THR n 1 164 CYS n 1 165 HIS n 1 166 ALA n 1 167 PHE n 1 168 ASP n 1 169 GLN n 1 170 ARG n 1 171 THR n 1 172 GLY n 1 173 HIS n 1 174 LYS n 1 175 ASN n 1 176 LYS n 1 177 VAL n 1 178 THR n 1 179 MET n 1 180 THR n 1 181 PHE n 1 182 HIS n 1 183 SER n 1 184 LYS n 1 185 PHE n 1 186 GLY n 1 187 ILE n 1 188 ARG n 1 189 THR n 1 190 PRO n 1 191 ASN n 1 192 ALA n 1 193 THR n 1 194 SER n 1 195 GLY n 1 196 SER n 1 197 LEU n 1 198 GLU n 1 199 ASN n 1 200 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 200 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CDO1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDO1_HUMAN _struct_ref.pdbx_db_accession Q16878 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGH GSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPF DTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6BGM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 200 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16878 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 200 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6BGM SER A 1 ? UNP Q16878 ? ? 'expression tag' 1 1 1 6BGM VAL A 137 ? UNP Q16878 ILE 137 conflict 137 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6BGM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.74 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 67.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MES, 2 M ammonium sulfate, 2% PEG400' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-01-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 40.710 _reflns.entry_id 6BGM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17488 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.100 _reflns.pdbx_Rmerge_I_obs 0.185 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.071 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.198 _reflns.pdbx_Rpim_I_all 0.069 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.200 2.260 ? ? ? ? ? ? 1345 100.000 ? ? ? ? 0.839 ? ? ? ? ? ? ? ? 6.600 ? 0.820 ? ? 0.912 0.349 ? 1 1 0.823 ? 2.260 2.330 ? ? ? ? ? ? 1309 99.800 ? ? ? ? 1.044 ? ? ? ? ? ? ? ? 7.200 ? 0.673 ? ? 1.126 0.413 ? 2 1 0.823 ? 2.330 2.400 ? ? ? ? ? ? 1328 100.000 ? ? ? ? 0.781 ? ? ? ? ? ? ? ? 6.700 ? 0.706 ? ? 0.848 0.323 ? 3 1 0.850 ? 2.400 2.490 ? ? ? ? ? ? 1332 99.900 ? ? ? ? 0.727 ? ? ? ? ? ? ? ? 8.500 ? 0.700 ? ? 0.776 0.265 ? 4 1 0.872 ? 2.490 2.590 ? ? ? ? ? ? 1331 100.000 ? ? ? ? 0.555 ? ? ? ? ? ? ? ? 8.800 ? 0.723 ? ? 0.590 0.199 ? 5 1 0.942 ? 2.590 2.700 ? ? ? ? ? ? 1344 100.000 ? ? ? ? 0.436 ? ? ? ? ? ? ? ? 8.800 ? 0.835 ? ? 0.463 0.156 ? 6 1 0.953 ? 2.700 2.850 ? ? ? ? ? ? 1347 100.000 ? ? ? ? 0.348 ? ? ? ? ? ? ? ? 8.700 ? 0.854 ? ? 0.371 0.126 ? 7 1 0.971 ? 2.850 3.030 ? ? ? ? ? ? 1313 100.000 ? ? ? ? 0.289 ? ? ? ? ? ? ? ? 8.800 ? 1.006 ? ? 0.308 0.104 ? 8 1 0.971 ? 3.030 3.260 ? ? ? ? ? ? 1344 100.000 ? ? ? ? 0.225 ? ? ? ? ? ? ? ? 8.500 ? 1.305 ? ? 0.240 0.082 ? 9 1 0.979 ? 3.260 3.590 ? ? ? ? ? ? 1353 99.900 ? ? ? ? 0.189 ? ? ? ? ? ? ? ? 7.500 ? 1.641 ? ? 0.203 0.073 ? 10 1 0.979 ? 3.590 4.110 ? ? ? ? ? ? 1358 100.000 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 8.800 ? 1.694 ? ? 0.177 0.061 ? 11 1 0.986 ? 4.110 5.170 ? ? ? ? ? ? 1362 100.000 ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 8.300 ? 1.499 ? ? 0.141 0.050 ? 12 1 0.990 ? 5.170 50.000 ? ? ? ? ? ? 1422 98.900 ? ? ? ? 0.114 ? ? ? ? ? ? ? ? 8.100 ? 1.307 ? ? 0.122 0.043 ? 13 1 0.992 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 105.340 _refine.B_iso_mean 46.7922 _refine.B_iso_min 26.210 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6BGM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2060 _refine.ls_d_res_low 32.9390 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17462 _refine.ls_number_reflns_R_free 1753 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3600 _refine.ls_percent_reflns_R_free 10.0400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1830 _refine.ls_R_factor_R_free 0.2160 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1793 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 2IC1' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.9600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.2060 _refine_hist.d_res_low 32.9390 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 72 _refine_hist.number_atoms_total 1614 _refine_hist.pdbx_number_residues_total 187 _refine_hist.pdbx_B_iso_mean_ligand 67.71 _refine_hist.pdbx_B_iso_mean_solvent 51.63 _refine_hist.pdbx_number_atoms_protein 1514 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2055 2.2652 1268 . 131 1137 94.0000 . . . 0.4417 0.0000 0.3842 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.2652 2.3318 1305 . 130 1175 100.0000 . . . 0.3296 0.0000 0.3010 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.3318 2.4070 1345 . 134 1211 100.0000 . . . 0.3156 0.0000 0.2599 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.4070 2.4930 1331 . 131 1200 100.0000 . . . 0.2847 0.0000 0.2314 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.4930 2.5928 1329 . 132 1197 100.0000 . . . 0.2506 0.0000 0.2117 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.5928 2.7108 1339 . 135 1204 100.0000 . . . 0.2520 0.0000 0.1933 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.7108 2.8536 1360 . 137 1223 100.0000 . . . 0.2839 0.0000 0.1930 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.8536 3.0323 1330 . 137 1193 100.0000 . . . 0.2447 0.0000 0.2037 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 3.0323 3.2662 1334 . 136 1198 100.0000 . . . 0.2097 0.0000 0.1780 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 3.2662 3.5946 1362 . 134 1228 100.0000 . . . 0.1928 0.0000 0.1528 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 3.5946 4.1139 1359 . 139 1220 100.0000 . . . 0.1651 0.0000 0.1410 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 4.1139 5.1798 1375 . 135 1240 100.0000 . . . 0.1534 0.0000 0.1378 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 5.1798 32.9429 1425 . 142 1283 99.0000 . . . 0.2072 0.0000 0.1759 . . . . . . 13 . . . # _struct.entry_id 6BGM _struct.title 'Crystal structure of ferrous form of the crosslinked human cysteine dioxygenase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6BGM _struct_keywords.text 'Cysteine, Cys-Tyr cofactor, iron, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 4 ? H N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 11 ? PHE A 23 ? THR A 11 PHE A 23 1 ? 13 HELX_P HELX_P2 AA2 ASN A 29 ? TYR A 40 ? ASN A 29 TYR A 40 1 ? 12 HELX_P HELX_P3 AA3 ASP A 43 ? ALA A 48 ? ASP A 43 ALA A 48 1 ? 6 HELX_P HELX_P4 AA4 MET A 49 ? ALA A 51 ? MET A 49 ALA A 51 5 ? 3 HELX_P HELX_P5 AA5 GLN A 65 ? LYS A 69 ? GLN A 65 LYS A 69 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 86 A FE2 301 1_555 ? ? ? ? ? ? ? 2.243 ? ? metalc2 metalc ? ? A HIS 88 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 88 A FE2 301 1_555 ? ? ? ? ? ? ? 2.259 ? ? metalc3 metalc ? ? A HIS 140 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 140 A FE2 301 1_555 ? ? ? ? ? ? ? 2.368 ? ? metalc4 metalc ? ? B FE2 . FE ? ? ? 1_555 H HOH . O ? ? A FE2 301 A HOH 408 1_555 ? ? ? ? ? ? ? 2.503 ? ? metalc5 metalc ? ? B FE2 . FE ? ? ? 1_555 H HOH . O ? ? A FE2 301 A HOH 415 1_555 ? ? ? ? ? ? ? 2.581 ? ? metalc6 metalc ? ? B FE2 . FE ? ? ? 1_555 H HOH . O ? ? A FE2 301 A HOH 464 1_555 ? ? ? ? ? ? ? 2.612 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 158 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 158 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 159 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 159 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.77 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 130 ? ILE A 133 ? CYS A 130 ILE A 133 AA1 2 HIS A 92 ? GLN A 99 ? HIS A 92 GLN A 99 AA1 3 ALA A 151 ? SER A 158 ? ALA A 151 SER A 158 AA1 4 ASN A 71 ? TRP A 77 ? ASN A 71 TRP A 77 AA1 5 THR A 59 ? ASP A 64 ? THR A 59 ASP A 64 AA1 6 SER A 183 ? LYS A 184 ? SER A 183 LYS A 184 AA1 7 ILE A 187 ? ARG A 188 ? ILE A 187 ARG A 188 AA2 1 ILE A 85 ? HIS A 86 ? ILE A 85 HIS A 86 AA2 2 THR A 163 ? PHE A 167 ? THR A 163 PHE A 167 AA2 3 LYS A 174 ? THR A 178 ? LYS A 174 THR A 178 AA3 1 LYS A 119 ? VAL A 124 ? LYS A 119 VAL A 124 AA3 2 LEU A 102 ? PHE A 107 ? LEU A 102 PHE A 107 AA3 3 LEU A 139 ? ASN A 144 ? LEU A 139 ASN A 144 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 131 ? O ALA A 131 N LEU A 95 ? N LEU A 95 AA1 2 3 N HIS A 92 ? N HIS A 92 O SER A 158 ? O SER A 158 AA1 3 4 O ALA A 151 ? O ALA A 151 N TRP A 77 ? N TRP A 77 AA1 4 5 O LEU A 72 ? O LEU A 72 N VAL A 63 ? N VAL A 63 AA1 5 6 N LEU A 62 ? N LEU A 62 O SER A 183 ? O SER A 183 AA1 6 7 N LYS A 184 ? N LYS A 184 O ILE A 187 ? O ILE A 187 AA2 1 2 N ILE A 85 ? N ILE A 85 O PHE A 167 ? O PHE A 167 AA2 2 3 N CYS A 164 ? N CYS A 164 O VAL A 177 ? O VAL A 177 AA3 1 2 O LYS A 120 ? O LYS A 120 N LEU A 106 ? N LEU A 106 AA3 2 3 N PHE A 107 ? N PHE A 107 O LEU A 139 ? O LEU A 139 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FE2 301 ? 6 'binding site for residue FE2 A 301' AC2 Software A SO4 302 ? 7 'binding site for residue SO4 A 302' AC3 Software A SO4 303 ? 3 'binding site for residue SO4 A 303' AC4 Software A SO4 304 ? 6 'binding site for residue SO4 A 304' AC5 Software A GOL 305 ? 3 'binding site for residue GOL A 305' AC6 Software A GOL 306 ? 5 'binding site for residue GOL A 306' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 86 ? HIS A 86 . ? 1_555 ? 2 AC1 6 HIS A 88 ? HIS A 88 . ? 1_555 ? 3 AC1 6 HIS A 140 ? HIS A 140 . ? 1_555 ? 4 AC1 6 HOH H . ? HOH A 408 . ? 1_555 ? 5 AC1 6 HOH H . ? HOH A 415 . ? 1_555 ? 6 AC1 6 HOH H . ? HOH A 464 . ? 1_555 ? 7 AC2 7 GLN A 34 ? GLN A 34 . ? 1_555 ? 8 AC2 7 ARG A 123 ? ARG A 123 . ? 1_555 ? 9 AC2 7 ALA A 131 ? ALA A 131 . ? 1_555 ? 10 AC2 7 TYR A 132 ? TYR A 132 . ? 1_555 ? 11 AC2 7 HOH H . ? HOH A 401 . ? 1_555 ? 12 AC2 7 HOH H . ? HOH A 429 . ? 1_555 ? 13 AC2 7 HOH H . ? HOH A 431 . ? 1_555 ? 14 AC3 3 LYS A 119 ? LYS A 119 . ? 1_555 ? 15 AC3 3 ARG A 141 ? ARG A 141 . ? 1_555 ? 16 AC3 3 GLN A 169 ? GLN A 169 . ? 1_555 ? 17 AC4 6 TYR A 56 ? TYR A 56 . ? 1_556 ? 18 AC4 6 HIS A 173 ? HIS A 173 . ? 1_555 ? 19 AC4 6 LYS A 174 ? LYS A 174 . ? 1_555 ? 20 AC4 6 HOH H . ? HOH A 419 . ? 1_555 ? 21 AC4 6 HOH H . ? HOH A 420 . ? 1_555 ? 22 AC4 6 HOH H . ? HOH A 454 . ? 1_555 ? 23 AC5 3 ALA A 166 ? ALA A 166 . ? 1_555 ? 24 AC5 3 ASP A 168 ? ASP A 168 . ? 1_555 ? 25 AC5 3 ASN A 175 ? ASN A 175 . ? 1_555 ? 26 AC6 5 ARG A 10 ? ARG A 10 . ? 1_555 ? 27 AC6 5 ASP A 14 ? ASP A 14 . ? 1_555 ? 28 AC6 5 LYS A 52 ? LYS A 52 . ? 3_655 ? 29 AC6 5 GLY A 186 ? GLY A 186 . ? 3_655 ? 30 AC6 5 ARG A 188 ? ARG A 188 . ? 3_655 ? # _atom_sites.entry_id 6BGM _atom_sites.fract_transf_matrix[1][1] 0.007590 _atom_sites.fract_transf_matrix[1][2] 0.004382 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008764 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029187 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 CYS 93 93 93 CYS CYS A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 MET 179 179 179 MET MET A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 PHE 181 181 181 PHE PHE A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 THR 193 193 ? ? ? A . n A 1 194 SER 194 194 ? ? ? A . n A 1 195 GLY 195 195 ? ? ? A . n A 1 196 SER 196 196 ? ? ? A . n A 1 197 LEU 197 197 ? ? ? A . n A 1 198 GLU 198 198 ? ? ? A . n A 1 199 ASN 199 199 ? ? ? A . n A 1 200 ASN 200 200 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 301 301 FE2 FE2 A . C 3 SO4 1 302 101 SO4 SO4 A . D 3 SO4 1 303 102 SO4 SO4 A . E 3 SO4 1 304 103 SO4 SO4 A . F 4 GOL 1 305 201 GOL GOL A . G 4 GOL 1 306 202 GOL GOL A . H 5 HOH 1 401 34 HOH HOH A . H 5 HOH 2 402 64 HOH HOH A . H 5 HOH 3 403 65 HOH HOH A . H 5 HOH 4 404 22 HOH HOH A . H 5 HOH 5 405 20 HOH HOH A . H 5 HOH 6 406 21 HOH HOH A . H 5 HOH 7 407 13 HOH HOH A . H 5 HOH 8 408 4 HOH HOH A . H 5 HOH 9 409 10 HOH HOH A . H 5 HOH 10 410 38 HOH HOH A . H 5 HOH 11 411 58 HOH HOH A . H 5 HOH 12 412 23 HOH HOH A . H 5 HOH 13 413 51 HOH HOH A . H 5 HOH 14 414 15 HOH HOH A . H 5 HOH 15 415 3 HOH HOH A . H 5 HOH 16 416 25 HOH HOH A . H 5 HOH 17 417 12 HOH HOH A . H 5 HOH 18 418 17 HOH HOH A . H 5 HOH 19 419 9 HOH HOH A . H 5 HOH 20 420 40 HOH HOH A . H 5 HOH 21 421 33 HOH HOH A . H 5 HOH 22 422 49 HOH HOH A . H 5 HOH 23 423 26 HOH HOH A . H 5 HOH 24 424 45 HOH HOH A . H 5 HOH 25 425 11 HOH HOH A . H 5 HOH 26 426 36 HOH HOH A . H 5 HOH 27 427 8 HOH HOH A . H 5 HOH 28 428 19 HOH HOH A . H 5 HOH 29 429 2 HOH HOH A . H 5 HOH 30 430 32 HOH HOH A . H 5 HOH 31 431 37 HOH HOH A . H 5 HOH 32 432 29 HOH HOH A . H 5 HOH 33 433 14 HOH HOH A . H 5 HOH 34 434 24 HOH HOH A . H 5 HOH 35 435 66 HOH HOH A . H 5 HOH 36 436 27 HOH HOH A . H 5 HOH 37 437 53 HOH HOH A . H 5 HOH 38 438 6 HOH HOH A . H 5 HOH 39 439 41 HOH HOH A . H 5 HOH 40 440 28 HOH HOH A . H 5 HOH 41 441 39 HOH HOH A . H 5 HOH 42 442 30 HOH HOH A . H 5 HOH 43 443 56 HOH HOH A . H 5 HOH 44 444 68 HOH HOH A . H 5 HOH 45 445 52 HOH HOH A . H 5 HOH 46 446 55 HOH HOH A . H 5 HOH 47 447 31 HOH HOH A . H 5 HOH 48 448 59 HOH HOH A . H 5 HOH 49 449 54 HOH HOH A . H 5 HOH 50 450 72 HOH HOH A . H 5 HOH 51 451 35 HOH HOH A . H 5 HOH 52 452 69 HOH HOH A . H 5 HOH 53 453 47 HOH HOH A . H 5 HOH 54 454 62 HOH HOH A . H 5 HOH 55 455 71 HOH HOH A . H 5 HOH 56 456 74 HOH HOH A . H 5 HOH 57 457 44 HOH HOH A . H 5 HOH 58 458 16 HOH HOH A . H 5 HOH 59 459 18 HOH HOH A . H 5 HOH 60 460 48 HOH HOH A . H 5 HOH 61 461 57 HOH HOH A . H 5 HOH 62 462 50 HOH HOH A . H 5 HOH 63 463 42 HOH HOH A . H 5 HOH 64 464 1 HOH HOH A . H 5 HOH 65 465 5 HOH HOH A . H 5 HOH 66 466 67 HOH HOH A . H 5 HOH 67 467 73 HOH HOH A . H 5 HOH 68 468 75 HOH HOH A . H 5 HOH 69 469 7 HOH HOH A . H 5 HOH 70 470 60 HOH HOH A . H 5 HOH 71 471 46 HOH HOH A . H 5 HOH 72 472 61 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 970 ? 1 MORE -46 ? 1 'SSA (A^2)' 10090 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 103.6 ? 2 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 93.5 ? 3 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 91.2 ? 4 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? H HOH . ? A HOH 408 ? 1_555 142.5 ? 5 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? H HOH . ? A HOH 408 ? 1_555 111.2 ? 6 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? H HOH . ? A HOH 408 ? 1_555 99.1 ? 7 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? H HOH . ? A HOH 415 ? 1_555 89.3 ? 8 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? H HOH . ? A HOH 415 ? 1_555 96.9 ? 9 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? H HOH . ? A HOH 415 ? 1_555 170.5 ? 10 O ? H HOH . ? A HOH 408 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? H HOH . ? A HOH 415 ? 1_555 73.5 ? 11 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? H HOH . ? A HOH 464 ? 1_555 85.5 ? 12 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? H HOH . ? A HOH 464 ? 1_555 165.4 ? 13 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? H HOH . ? A HOH 464 ? 1_555 99.6 ? 14 O ? H HOH . ? A HOH 408 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? H HOH . ? A HOH 464 ? 1_555 57.7 ? 15 O ? H HOH . ? A HOH 415 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? H HOH . ? A HOH 464 ? 1_555 71.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-22 2 'Structure model' 1 1 2017-12-06 3 'Structure model' 1 2 2017-12-13 4 'Structure model' 1 3 2018-07-04 5 'Structure model' 1 4 2018-07-11 6 'Structure model' 1 5 2018-08-29 7 'Structure model' 1 6 2019-11-27 8 'Structure model' 1 7 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' 9 7 'Structure model' 'Author supporting evidence' 10 8 'Structure model' 'Data collection' 11 8 'Structure model' 'Database references' 12 8 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' struct 3 4 'Structure model' citation 4 4 'Structure model' citation_author 5 5 'Structure model' citation 6 6 'Structure model' citation 7 6 'Structure model' citation_author 8 7 'Structure model' pdbx_audit_support 9 8 'Structure model' chem_comp_atom 10 8 'Structure model' chem_comp_bond 11 8 'Structure model' database_2 12 8 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_struct.title' 3 4 'Structure model' '_citation.country' 4 4 'Structure model' '_citation.journal_abbrev' 5 4 'Structure model' '_citation.journal_id_CSD' 6 4 'Structure model' '_citation.journal_id_ISSN' 7 4 'Structure model' '_citation.pdbx_database_id_DOI' 8 4 'Structure model' '_citation.title' 9 4 'Structure model' '_citation.year' 10 5 'Structure model' '_citation.journal_abbrev' 11 5 'Structure model' '_citation.pdbx_database_id_PubMed' 12 5 'Structure model' '_citation.title' 13 6 'Structure model' '_citation.journal_volume' 14 6 'Structure model' '_citation.page_first' 15 6 'Structure model' '_citation.page_last' 16 6 'Structure model' '_citation_author.identifier_ORCID' 17 7 'Structure model' '_pdbx_audit_support.funding_organization' 18 8 'Structure model' '_database_2.pdbx_DOI' 19 8 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 93 ? ? CE1 A TYR 157 ? ? 1.94 2 1 O A HOH 402 ? ? O A HOH 415 ? ? 2.13 3 1 O A HOH 438 ? ? O A HOH 469 ? ? 2.18 4 1 O A HOH 461 ? ? O A HOH 472 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 404 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 450 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_655 _pdbx_validate_symm_contact.dist 2.10 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 191 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 77.31 _pdbx_validate_torsion.psi 49.59 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A THR 193 ? A THR 193 7 1 Y 1 A SER 194 ? A SER 194 8 1 Y 1 A GLY 195 ? A GLY 195 9 1 Y 1 A SER 196 ? A SER 196 10 1 Y 1 A LEU 197 ? A LEU 197 11 1 Y 1 A GLU 198 ? A GLU 198 12 1 Y 1 A ASN 199 ? A ASN 199 13 1 Y 1 A ASN 200 ? A ASN 200 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE2 FE FE N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 GOL C1 C N N 138 GOL O1 O N N 139 GOL C2 C N N 140 GOL O2 O N N 141 GOL C3 C N N 142 GOL O3 O N N 143 GOL H11 H N N 144 GOL H12 H N N 145 GOL HO1 H N N 146 GOL H2 H N N 147 GOL HO2 H N N 148 GOL H31 H N N 149 GOL H32 H N N 150 GOL HO3 H N N 151 HIS N N N N 152 HIS CA C N S 153 HIS C C N N 154 HIS O O N N 155 HIS CB C N N 156 HIS CG C Y N 157 HIS ND1 N Y N 158 HIS CD2 C Y N 159 HIS CE1 C Y N 160 HIS NE2 N Y N 161 HIS OXT O N N 162 HIS H H N N 163 HIS H2 H N N 164 HIS HA H N N 165 HIS HB2 H N N 166 HIS HB3 H N N 167 HIS HD1 H N N 168 HIS HD2 H N N 169 HIS HE1 H N N 170 HIS HE2 H N N 171 HIS HXT H N N 172 HOH O O N N 173 HOH H1 H N N 174 HOH H2 H N N 175 ILE N N N N 176 ILE CA C N S 177 ILE C C N N 178 ILE O O N N 179 ILE CB C N S 180 ILE CG1 C N N 181 ILE CG2 C N N 182 ILE CD1 C N N 183 ILE OXT O N N 184 ILE H H N N 185 ILE H2 H N N 186 ILE HA H N N 187 ILE HB H N N 188 ILE HG12 H N N 189 ILE HG13 H N N 190 ILE HG21 H N N 191 ILE HG22 H N N 192 ILE HG23 H N N 193 ILE HD11 H N N 194 ILE HD12 H N N 195 ILE HD13 H N N 196 ILE HXT H N N 197 LEU N N N N 198 LEU CA C N S 199 LEU C C N N 200 LEU O O N N 201 LEU CB C N N 202 LEU CG C N N 203 LEU CD1 C N N 204 LEU CD2 C N N 205 LEU OXT O N N 206 LEU H H N N 207 LEU H2 H N N 208 LEU HA H N N 209 LEU HB2 H N N 210 LEU HB3 H N N 211 LEU HG H N N 212 LEU HD11 H N N 213 LEU HD12 H N N 214 LEU HD13 H N N 215 LEU HD21 H N N 216 LEU HD22 H N N 217 LEU HD23 H N N 218 LEU HXT H N N 219 LYS N N N N 220 LYS CA C N S 221 LYS C C N N 222 LYS O O N N 223 LYS CB C N N 224 LYS CG C N N 225 LYS CD C N N 226 LYS CE C N N 227 LYS NZ N N N 228 LYS OXT O N N 229 LYS H H N N 230 LYS H2 H N N 231 LYS HA H N N 232 LYS HB2 H N N 233 LYS HB3 H N N 234 LYS HG2 H N N 235 LYS HG3 H N N 236 LYS HD2 H N N 237 LYS HD3 H N N 238 LYS HE2 H N N 239 LYS HE3 H N N 240 LYS HZ1 H N N 241 LYS HZ2 H N N 242 LYS HZ3 H N N 243 LYS HXT H N N 244 MET N N N N 245 MET CA C N S 246 MET C C N N 247 MET O O N N 248 MET CB C N N 249 MET CG C N N 250 MET SD S N N 251 MET CE C N N 252 MET OXT O N N 253 MET H H N N 254 MET H2 H N N 255 MET HA H N N 256 MET HB2 H N N 257 MET HB3 H N N 258 MET HG2 H N N 259 MET HG3 H N N 260 MET HE1 H N N 261 MET HE2 H N N 262 MET HE3 H N N 263 MET HXT H N N 264 PHE N N N N 265 PHE CA C N S 266 PHE C C N N 267 PHE O O N N 268 PHE CB C N N 269 PHE CG C Y N 270 PHE CD1 C Y N 271 PHE CD2 C Y N 272 PHE CE1 C Y N 273 PHE CE2 C Y N 274 PHE CZ C Y N 275 PHE OXT O N N 276 PHE H H N N 277 PHE H2 H N N 278 PHE HA H N N 279 PHE HB2 H N N 280 PHE HB3 H N N 281 PHE HD1 H N N 282 PHE HD2 H N N 283 PHE HE1 H N N 284 PHE HE2 H N N 285 PHE HZ H N N 286 PHE HXT H N N 287 PRO N N N N 288 PRO CA C N S 289 PRO C C N N 290 PRO O O N N 291 PRO CB C N N 292 PRO CG C N N 293 PRO CD C N N 294 PRO OXT O N N 295 PRO H H N N 296 PRO HA H N N 297 PRO HB2 H N N 298 PRO HB3 H N N 299 PRO HG2 H N N 300 PRO HG3 H N N 301 PRO HD2 H N N 302 PRO HD3 H N N 303 PRO HXT H N N 304 SER N N N N 305 SER CA C N S 306 SER C C N N 307 SER O O N N 308 SER CB C N N 309 SER OG O N N 310 SER OXT O N N 311 SER H H N N 312 SER H2 H N N 313 SER HA H N N 314 SER HB2 H N N 315 SER HB3 H N N 316 SER HG H N N 317 SER HXT H N N 318 SO4 S S N N 319 SO4 O1 O N N 320 SO4 O2 O N N 321 SO4 O3 O N N 322 SO4 O4 O N N 323 THR N N N N 324 THR CA C N S 325 THR C C N N 326 THR O O N N 327 THR CB C N R 328 THR OG1 O N N 329 THR CG2 C N N 330 THR OXT O N N 331 THR H H N N 332 THR H2 H N N 333 THR HA H N N 334 THR HB H N N 335 THR HG1 H N N 336 THR HG21 H N N 337 THR HG22 H N N 338 THR HG23 H N N 339 THR HXT H N N 340 TRP N N N N 341 TRP CA C N S 342 TRP C C N N 343 TRP O O N N 344 TRP CB C N N 345 TRP CG C Y N 346 TRP CD1 C Y N 347 TRP CD2 C Y N 348 TRP NE1 N Y N 349 TRP CE2 C Y N 350 TRP CE3 C Y N 351 TRP CZ2 C Y N 352 TRP CZ3 C Y N 353 TRP CH2 C Y N 354 TRP OXT O N N 355 TRP H H N N 356 TRP H2 H N N 357 TRP HA H N N 358 TRP HB2 H N N 359 TRP HB3 H N N 360 TRP HD1 H N N 361 TRP HE1 H N N 362 TRP HE3 H N N 363 TRP HZ2 H N N 364 TRP HZ3 H N N 365 TRP HH2 H N N 366 TRP HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 SO4 S O1 doub N N 303 SO4 S O2 doub N N 304 SO4 S O3 sing N N 305 SO4 S O4 sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' CHE-1623856 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM107529 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM108988 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FE2 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FE2 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 'SULFATE ION' SO4 4 GLYCEROL GOL 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2IC1 _pdbx_initial_refinement_model.details 'PDB entry 2IC1' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details MONOMER #