data_6BHR # _entry.id 6BHR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6BHR pdb_00006bhr 10.2210/pdb6bhr/pdb WWPDB D_1000230520 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6BHR _pdbx_database_status.recvd_initial_deposition_date 2017-10-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zadrozny, K.' 1 ? 'Wagner, J.M.' 2 ? 'Ganser-Pornillos, B.K.' 3 ? 'Pornillos, O.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 560 _citation.language ? _citation.page_first 509 _citation.page_last 512 _citation.title 'Inositol phosphates are assembly co-factors for HIV-1.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-018-0396-4 _citation.pdbx_database_id_PubMed 30069050 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dick, R.A.' 1 ? primary 'Zadrozny, K.K.' 2 ? primary 'Xu, C.' 3 ? primary 'Schur, F.K.M.' 4 ? primary 'Lyddon, T.D.' 5 ? primary 'Ricana, C.L.' 6 ? primary 'Wagner, J.M.' 7 ? primary 'Perilla, J.R.' 8 ? primary 'Ganser-Pornillos, B.K.' 9 ? primary 'Johnson, M.C.' 10 ? primary 'Pornillos, O.' 11 ? primary 'Vogt, V.M.' 12 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6BHR _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.939 _cell.length_a_esd ? _cell.length_b 70.939 _cell.length_b_esd ? _cell.length_c 42.041 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6BHR _symmetry.cell_setting ? _symmetry.Int_Tables_number 168 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 6' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Capsid protein p24,Spacer peptide 1' 10476.955 1 ? ? ? ? 2 non-polymer syn 'INOSITOL HEXAKISPHOSPHATE' 660.035 1 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPG HKARVLAEAMSQVTN ; _entity_poly.pdbx_seq_one_letter_code_can ;SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPG HKARVLAEAMSQVTN ; _entity_poly.pdbx_strand_id G _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 PRO n 1 3 THR n 1 4 SER n 1 5 ILE n 1 6 LEU n 1 7 ASP n 1 8 ILE n 1 9 ARG n 1 10 GLN n 1 11 GLY n 1 12 PRO n 1 13 LYS n 1 14 GLU n 1 15 PRO n 1 16 PHE n 1 17 ARG n 1 18 ASP n 1 19 TYR n 1 20 VAL n 1 21 ASP n 1 22 ARG n 1 23 PHE n 1 24 TYR n 1 25 LYS n 1 26 THR n 1 27 LEU n 1 28 ARG n 1 29 ALA n 1 30 GLU n 1 31 GLN n 1 32 ALA n 1 33 SER n 1 34 GLN n 1 35 GLU n 1 36 VAL n 1 37 LYS n 1 38 ASN n 1 39 TRP n 1 40 MET n 1 41 THR n 1 42 GLU n 1 43 THR n 1 44 LEU n 1 45 LEU n 1 46 VAL n 1 47 GLN n 1 48 ASN n 1 49 ALA n 1 50 ASN n 1 51 PRO n 1 52 ASP n 1 53 CYS n 1 54 LYS n 1 55 THR n 1 56 ILE n 1 57 LEU n 1 58 LYS n 1 59 ALA n 1 60 LEU n 1 61 GLY n 1 62 PRO n 1 63 ALA n 1 64 ALA n 1 65 THR n 1 66 LEU n 1 67 GLU n 1 68 GLU n 1 69 MET n 1 70 MET n 1 71 THR n 1 72 ALA n 1 73 CYS n 1 74 GLN n 1 75 GLY n 1 76 VAL n 1 77 GLY n 1 78 GLY n 1 79 PRO n 1 80 GLY n 1 81 HIS n 1 82 LYS n 1 83 ALA n 1 84 ARG n 1 85 VAL n 1 86 LEU n 1 87 ALA n 1 88 GLU n 1 89 ALA n 1 90 MET n 1 91 SER n 1 92 GLN n 1 93 VAL n 1 94 THR n 1 95 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 95 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus type 1 group M subtype B (isolate BH10)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11678 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GAG_HV1B1 _struct_ref.pdbx_db_accession P03347 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPG HKARVLAEAMSQVTN ; _struct_ref.pdbx_align_begin 278 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6BHR _struct_ref_seq.pdbx_strand_id G _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03347 _struct_ref_seq.db_align_beg 278 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 372 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 278 _struct_ref_seq.pdbx_auth_seq_align_end 372 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 IHP non-polymer . 'INOSITOL HEXAKISPHOSPHATE' 'MYO-INOSITOL HEXAKISPHOSPHATE; INOSITOL 1,2,3,4,5,6-HEXAKISPHOSPHATE' 'C6 H18 O24 P6' 660.035 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6BHR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.91 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M NaCl 20% PEG 3350 0.1 M Bis-Tris pH 5.35 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-03 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6BHR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.90 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 2665 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6BHR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.908 _refine.ls_d_res_low 35.469 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 2115 _refine.ls_number_reflns_R_free 129 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 76.80 _refine.ls_percent_reflns_R_free 6.10 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2188 _refine.ls_R_factor_R_free 0.2651 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2154 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5I4T _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.84 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.16 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 668 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 36 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 705 _refine_hist.d_res_high 2.908 _refine_hist.d_res_low 35.469 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 715 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.090 ? 982 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 11.106 ? 434 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.831 ? 113 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 121 ? f_plane_restr ? ? # _struct.entry_id 6BHR _struct.title 'HIV-1 immature CTD-SP1 hexamer in complex with IP6' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6BHR _struct_keywords.text 'assembly, co-factor, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 15 ? ARG A 28 ? PRO G 292 ARG G 305 1 ? 14 HELX_P HELX_P2 AA2 SER A 33 ? ASN A 48 ? SER G 310 ASN G 325 1 ? 16 HELX_P HELX_P3 AA3 ASN A 50 ? GLY A 61 ? ASN G 327 GLY G 338 1 ? 12 HELX_P HELX_P4 AA4 THR A 65 ? GLN A 74 ? THR G 342 GLN G 351 1 ? 10 HELX_P HELX_P5 AA5 GLY A 78 ? VAL A 93 ? GLY G 355 VAL G 370 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id G _struct_site.pdbx_auth_comp_id IHP _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'binding site for residue IHP G 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 LYS A 13 ? LYS G 290 . ? 3_555 ? 2 AC1 11 LYS A 13 ? LYS G 290 . ? 1_555 ? 3 AC1 11 LYS A 13 ? LYS G 290 . ? 4_555 ? 4 AC1 11 LYS A 13 ? LYS G 290 . ? 2_555 ? 5 AC1 11 LYS A 13 ? LYS G 290 . ? 6_555 ? 6 AC1 11 LYS A 82 ? LYS G 359 . ? 2_555 ? 7 AC1 11 LYS A 82 ? LYS G 359 . ? 6_555 ? 8 AC1 11 LYS A 82 ? LYS G 359 . ? 1_555 ? 9 AC1 11 LYS A 82 ? LYS G 359 . ? 4_555 ? 10 AC1 11 LYS A 82 ? LYS G 359 . ? 3_555 ? 11 AC1 11 LYS A 82 ? LYS G 359 . ? 5_555 ? # _atom_sites.entry_id 6BHR _atom_sites.fract_transf_matrix[1][1] 0.014097 _atom_sites.fract_transf_matrix[1][2] 0.008139 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016277 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023786 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 278 ? ? ? G . n A 1 2 PRO 2 279 ? ? ? G . n A 1 3 THR 3 280 280 THR THR G . n A 1 4 SER 4 281 281 SER SER G . n A 1 5 ILE 5 282 282 ILE ILE G . n A 1 6 LEU 6 283 283 LEU LEU G . n A 1 7 ASP 7 284 284 ASP ASP G . n A 1 8 ILE 8 285 285 ILE ILE G . n A 1 9 ARG 9 286 286 ARG ARG G . n A 1 10 GLN 10 287 287 GLN GLN G . n A 1 11 GLY 11 288 288 GLY GLY G . n A 1 12 PRO 12 289 289 PRO PRO G . n A 1 13 LYS 13 290 290 LYS LYS G . n A 1 14 GLU 14 291 291 GLU GLU G . n A 1 15 PRO 15 292 292 PRO PRO G . n A 1 16 PHE 16 293 293 PHE PHE G . n A 1 17 ARG 17 294 294 ARG ARG G . n A 1 18 ASP 18 295 295 ASP ASP G . n A 1 19 TYR 19 296 296 TYR TYR G . n A 1 20 VAL 20 297 297 VAL VAL G . n A 1 21 ASP 21 298 298 ASP ASP G . n A 1 22 ARG 22 299 299 ARG ARG G . n A 1 23 PHE 23 300 300 PHE PHE G . n A 1 24 TYR 24 301 301 TYR TYR G . n A 1 25 LYS 25 302 302 LYS LYS G . n A 1 26 THR 26 303 303 THR THR G . n A 1 27 LEU 27 304 304 LEU LEU G . n A 1 28 ARG 28 305 305 ARG ARG G . n A 1 29 ALA 29 306 306 ALA ALA G . n A 1 30 GLU 30 307 307 GLU GLU G . n A 1 31 GLN 31 308 308 GLN GLN G . n A 1 32 ALA 32 309 309 ALA ALA G . n A 1 33 SER 33 310 310 SER SER G . n A 1 34 GLN 34 311 311 GLN GLN G . n A 1 35 GLU 35 312 312 GLU GLU G . n A 1 36 VAL 36 313 313 VAL VAL G . n A 1 37 LYS 37 314 314 LYS LYS G . n A 1 38 ASN 38 315 315 ASN ASN G . n A 1 39 TRP 39 316 316 TRP TRP G . n A 1 40 MET 40 317 317 MET MET G . n A 1 41 THR 41 318 318 THR THR G . n A 1 42 GLU 42 319 319 GLU GLU G . n A 1 43 THR 43 320 320 THR THR G . n A 1 44 LEU 44 321 321 LEU LEU G . n A 1 45 LEU 45 322 322 LEU LEU G . n A 1 46 VAL 46 323 323 VAL VAL G . n A 1 47 GLN 47 324 324 GLN GLN G . n A 1 48 ASN 48 325 325 ASN ASN G . n A 1 49 ALA 49 326 326 ALA ALA G . n A 1 50 ASN 50 327 327 ASN ASN G . n A 1 51 PRO 51 328 328 PRO PRO G . n A 1 52 ASP 52 329 329 ASP ASP G . n A 1 53 CYS 53 330 330 CYS CYS G . n A 1 54 LYS 54 331 331 LYS LYS G . n A 1 55 THR 55 332 332 THR THR G . n A 1 56 ILE 56 333 333 ILE ILE G . n A 1 57 LEU 57 334 334 LEU LEU G . n A 1 58 LYS 58 335 335 LYS LYS G . n A 1 59 ALA 59 336 336 ALA ALA G . n A 1 60 LEU 60 337 337 LEU LEU G . n A 1 61 GLY 61 338 338 GLY GLY G . n A 1 62 PRO 62 339 339 PRO PRO G . n A 1 63 ALA 63 340 340 ALA ALA G . n A 1 64 ALA 64 341 341 ALA ALA G . n A 1 65 THR 65 342 342 THR THR G . n A 1 66 LEU 66 343 343 LEU LEU G . n A 1 67 GLU 67 344 344 GLU GLU G . n A 1 68 GLU 68 345 345 GLU GLU G . n A 1 69 MET 69 346 346 MET MET G . n A 1 70 MET 70 347 347 MET MET G . n A 1 71 THR 71 348 348 THR THR G . n A 1 72 ALA 72 349 349 ALA ALA G . n A 1 73 CYS 73 350 350 CYS CYS G . n A 1 74 GLN 74 351 351 GLN GLN G . n A 1 75 GLY 75 352 352 GLY GLY G . n A 1 76 VAL 76 353 353 VAL VAL G . n A 1 77 GLY 77 354 354 GLY GLY G . n A 1 78 GLY 78 355 355 GLY GLY G . n A 1 79 PRO 79 356 356 PRO PRO G . n A 1 80 GLY 80 357 357 GLY GLY G . n A 1 81 HIS 81 358 358 HIS HIS G . n A 1 82 LYS 82 359 359 LYS LYS G . n A 1 83 ALA 83 360 360 ALA ALA G . n A 1 84 ARG 84 361 361 ARG ARG G . n A 1 85 VAL 85 362 362 VAL VAL G . n A 1 86 LEU 86 363 363 LEU LEU G . n A 1 87 ALA 87 364 364 ALA ALA G . n A 1 88 GLU 88 365 365 GLU GLU G . n A 1 89 ALA 89 366 366 ALA ALA G . n A 1 90 MET 90 367 367 MET MET G . n A 1 91 SER 91 368 368 SER SER G . n A 1 92 GLN 92 369 369 GLN GLN G . n A 1 93 VAL 93 370 370 VAL VAL G . n A 1 94 THR 94 371 ? ? ? G . n A 1 95 ASN 95 372 ? ? ? G . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IHP 1 401 902 IHP IHP G . C 3 HOH 1 501 1 HOH HOH G . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 14450 ? 1 MORE -167 ? 1 'SSA (A^2)' 26350 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 y,-x+y,z 0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 x-y,x,z 0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id G _pdbx_struct_special_symmetry.auth_comp_id IHP _pdbx_struct_special_symmetry.auth_seq_id 401 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id IHP _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-08-08 2 'Structure model' 1 1 2018-08-15 3 'Structure model' 1 2 2018-09-05 4 'Structure model' 1 3 2019-02-20 5 'Structure model' 1 4 2019-12-11 6 'Structure model' 1 5 2020-10-14 7 'Structure model' 1 6 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 4 'Structure model' 'Data collection' 7 5 'Structure model' 'Author supporting evidence' 8 6 'Structure model' 'Structure summary' 9 7 'Structure model' 'Data collection' 10 7 'Structure model' 'Database references' 11 7 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' pdbx_audit_support 6 6 'Structure model' chem_comp 7 7 'Structure model' chem_comp_atom 8 7 'Structure model' chem_comp_bond 9 7 'Structure model' database_2 10 7 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.name' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 4 'Structure model' '_pdbx_audit_support.funding_organization' 8 5 'Structure model' '_pdbx_audit_support.funding_organization' 9 6 'Structure model' '_chem_comp.pdbx_synonyms' 10 7 'Structure model' '_database_2.pdbx_DOI' 11 7 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -12.7976 -15.9015 -3.0848 -0.0113 -0.0697 0.3524 -0.2841 0.0189 0.0789 0.0463 0.0764 0.1656 -0.0376 0.0155 0.0067 -0.1553 -0.0184 -0.0878 -0.1729 0.0315 -0.0573 0.0865 -0.0389 -0.1345 'X-RAY DIFFRACTION' 2 ? refined -17.9965 -22.2326 1.5152 0.2563 -0.1314 -0.0455 -0.1377 -0.0003 0.3555 0.0119 0.0079 0.0162 -0.0051 -0.0095 -0.0047 -0.0928 -0.0528 -0.1084 -0.1793 -0.0511 0.1075 0.1780 -0.0309 -0.2649 'X-RAY DIFFRACTION' 3 ? refined -22.0560 -11.8531 7.1936 0.3190 0.3328 0.1479 0.1180 0.0681 0.1198 0.0319 0.0380 0.0085 0.0283 -0.0028 0.0151 -0.0210 0.0402 -0.0307 -0.1299 0.1327 0.1076 -0.0958 -0.0510 0.0060 'X-RAY DIFFRACTION' 4 ? refined -7.9327 -6.1931 20.9050 0.3038 0.3641 0.1570 0.0233 0.0676 0.0751 0.0225 0.0751 0.2512 -0.0143 0.0544 -0.1272 -0.0224 -0.0518 0.0408 0.0508 -0.0512 0.0217 0.0432 0.0041 -0.1105 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 280 through 306 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 307 through 337 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 338 through 354 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 355 through 370 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 G THR 280 ? OG1 ? A THR 3 OG1 2 1 Y 1 G THR 280 ? CG2 ? A THR 3 CG2 3 1 Y 1 G ASP 284 ? CG ? A ASP 7 CG 4 1 Y 1 G ASP 284 ? OD1 ? A ASP 7 OD1 5 1 Y 1 G ASP 284 ? OD2 ? A ASP 7 OD2 6 1 Y 1 G LYS 302 ? CG ? A LYS 25 CG 7 1 Y 1 G LYS 302 ? CD ? A LYS 25 CD 8 1 Y 1 G LYS 302 ? CE ? A LYS 25 CE 9 1 Y 1 G LYS 302 ? NZ ? A LYS 25 NZ 10 1 Y 1 G GLN 311 ? CG ? A GLN 34 CG 11 1 Y 1 G GLN 311 ? CD ? A GLN 34 CD 12 1 Y 1 G GLN 311 ? OE1 ? A GLN 34 OE1 13 1 Y 1 G GLN 311 ? NE2 ? A GLN 34 NE2 14 1 Y 1 G LYS 335 ? CG ? A LYS 58 CG 15 1 Y 1 G LYS 335 ? CD ? A LYS 58 CD 16 1 Y 1 G LYS 335 ? CE ? A LYS 58 CE 17 1 Y 1 G LYS 335 ? NZ ? A LYS 58 NZ 18 1 Y 1 G GLU 344 ? CG ? A GLU 67 CG 19 1 Y 1 G GLU 344 ? CD ? A GLU 67 CD 20 1 Y 1 G GLU 344 ? OE1 ? A GLU 67 OE1 21 1 Y 1 G GLU 344 ? OE2 ? A GLU 67 OE2 22 1 Y 1 G ARG 361 ? CG ? A ARG 84 CG 23 1 Y 1 G ARG 361 ? CD ? A ARG 84 CD 24 1 Y 1 G ARG 361 ? NE ? A ARG 84 NE 25 1 Y 1 G ARG 361 ? CZ ? A ARG 84 CZ 26 1 Y 1 G ARG 361 ? NH1 ? A ARG 84 NH1 27 1 Y 1 G ARG 361 ? NH2 ? A ARG 84 NH2 28 1 Y 1 G GLU 365 ? CG ? A GLU 88 CG 29 1 Y 1 G GLU 365 ? CD ? A GLU 88 CD 30 1 Y 1 G GLU 365 ? OE1 ? A GLU 88 OE1 31 1 Y 1 G GLU 365 ? OE2 ? A GLU 88 OE2 32 1 Y 1 G SER 368 ? OG ? A SER 91 OG 33 1 Y 1 G VAL 370 ? CG1 ? A VAL 93 CG1 34 1 Y 1 G VAL 370 ? CG2 ? A VAL 93 CG2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 G SER 278 ? A SER 1 2 1 Y 1 G PRO 279 ? A PRO 2 3 1 Y 1 G THR 371 ? A THR 94 4 1 Y 1 G ASN 372 ? A ASN 95 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 IHP C1 C N N 161 IHP C2 C N N 162 IHP C3 C N N 163 IHP C4 C N N 164 IHP C5 C N N 165 IHP C6 C N N 166 IHP O11 O N N 167 IHP P1 P N N 168 IHP O21 O N N 169 IHP O31 O N N 170 IHP O41 O N N 171 IHP O12 O N N 172 IHP P2 P N N 173 IHP O22 O N N 174 IHP O32 O N N 175 IHP O42 O N N 176 IHP O13 O N N 177 IHP P3 P N N 178 IHP O23 O N N 179 IHP O33 O N N 180 IHP O43 O N N 181 IHP O14 O N N 182 IHP P4 P N N 183 IHP O24 O N N 184 IHP O34 O N N 185 IHP O44 O N N 186 IHP O15 O N N 187 IHP P5 P N N 188 IHP O25 O N N 189 IHP O35 O N N 190 IHP O45 O N N 191 IHP O16 O N N 192 IHP P6 P N N 193 IHP O26 O N N 194 IHP O36 O N N 195 IHP O46 O N N 196 IHP H1 H N N 197 IHP H2 H N N 198 IHP H3 H N N 199 IHP H4 H N N 200 IHP H5 H N N 201 IHP H6 H N N 202 IHP H31 H N N 203 IHP H41 H N N 204 IHP H32 H N N 205 IHP H42 H N N 206 IHP H33 H N N 207 IHP H43 H N N 208 IHP H34 H N N 209 IHP H44 H N N 210 IHP H35 H N N 211 IHP H45 H N N 212 IHP H36 H N N 213 IHP H46 H N N 214 ILE N N N N 215 ILE CA C N S 216 ILE C C N N 217 ILE O O N N 218 ILE CB C N S 219 ILE CG1 C N N 220 ILE CG2 C N N 221 ILE CD1 C N N 222 ILE OXT O N N 223 ILE H H N N 224 ILE H2 H N N 225 ILE HA H N N 226 ILE HB H N N 227 ILE HG12 H N N 228 ILE HG13 H N N 229 ILE HG21 H N N 230 ILE HG22 H N N 231 ILE HG23 H N N 232 ILE HD11 H N N 233 ILE HD12 H N N 234 ILE HD13 H N N 235 ILE HXT H N N 236 LEU N N N N 237 LEU CA C N S 238 LEU C C N N 239 LEU O O N N 240 LEU CB C N N 241 LEU CG C N N 242 LEU CD1 C N N 243 LEU CD2 C N N 244 LEU OXT O N N 245 LEU H H N N 246 LEU H2 H N N 247 LEU HA H N N 248 LEU HB2 H N N 249 LEU HB3 H N N 250 LEU HG H N N 251 LEU HD11 H N N 252 LEU HD12 H N N 253 LEU HD13 H N N 254 LEU HD21 H N N 255 LEU HD22 H N N 256 LEU HD23 H N N 257 LEU HXT H N N 258 LYS N N N N 259 LYS CA C N S 260 LYS C C N N 261 LYS O O N N 262 LYS CB C N N 263 LYS CG C N N 264 LYS CD C N N 265 LYS CE C N N 266 LYS NZ N N N 267 LYS OXT O N N 268 LYS H H N N 269 LYS H2 H N N 270 LYS HA H N N 271 LYS HB2 H N N 272 LYS HB3 H N N 273 LYS HG2 H N N 274 LYS HG3 H N N 275 LYS HD2 H N N 276 LYS HD3 H N N 277 LYS HE2 H N N 278 LYS HE3 H N N 279 LYS HZ1 H N N 280 LYS HZ2 H N N 281 LYS HZ3 H N N 282 LYS HXT H N N 283 MET N N N N 284 MET CA C N S 285 MET C C N N 286 MET O O N N 287 MET CB C N N 288 MET CG C N N 289 MET SD S N N 290 MET CE C N N 291 MET OXT O N N 292 MET H H N N 293 MET H2 H N N 294 MET HA H N N 295 MET HB2 H N N 296 MET HB3 H N N 297 MET HG2 H N N 298 MET HG3 H N N 299 MET HE1 H N N 300 MET HE2 H N N 301 MET HE3 H N N 302 MET HXT H N N 303 PHE N N N N 304 PHE CA C N S 305 PHE C C N N 306 PHE O O N N 307 PHE CB C N N 308 PHE CG C Y N 309 PHE CD1 C Y N 310 PHE CD2 C Y N 311 PHE CE1 C Y N 312 PHE CE2 C Y N 313 PHE CZ C Y N 314 PHE OXT O N N 315 PHE H H N N 316 PHE H2 H N N 317 PHE HA H N N 318 PHE HB2 H N N 319 PHE HB3 H N N 320 PHE HD1 H N N 321 PHE HD2 H N N 322 PHE HE1 H N N 323 PHE HE2 H N N 324 PHE HZ H N N 325 PHE HXT H N N 326 PRO N N N N 327 PRO CA C N S 328 PRO C C N N 329 PRO O O N N 330 PRO CB C N N 331 PRO CG C N N 332 PRO CD C N N 333 PRO OXT O N N 334 PRO H H N N 335 PRO HA H N N 336 PRO HB2 H N N 337 PRO HB3 H N N 338 PRO HG2 H N N 339 PRO HG3 H N N 340 PRO HD2 H N N 341 PRO HD3 H N N 342 PRO HXT H N N 343 SER N N N N 344 SER CA C N S 345 SER C C N N 346 SER O O N N 347 SER CB C N N 348 SER OG O N N 349 SER OXT O N N 350 SER H H N N 351 SER H2 H N N 352 SER HA H N N 353 SER HB2 H N N 354 SER HB3 H N N 355 SER HG H N N 356 SER HXT H N N 357 THR N N N N 358 THR CA C N S 359 THR C C N N 360 THR O O N N 361 THR CB C N R 362 THR OG1 O N N 363 THR CG2 C N N 364 THR OXT O N N 365 THR H H N N 366 THR H2 H N N 367 THR HA H N N 368 THR HB H N N 369 THR HG1 H N N 370 THR HG21 H N N 371 THR HG22 H N N 372 THR HG23 H N N 373 THR HXT H N N 374 TRP N N N N 375 TRP CA C N S 376 TRP C C N N 377 TRP O O N N 378 TRP CB C N N 379 TRP CG C Y N 380 TRP CD1 C Y N 381 TRP CD2 C Y N 382 TRP NE1 N Y N 383 TRP CE2 C Y N 384 TRP CE3 C Y N 385 TRP CZ2 C Y N 386 TRP CZ3 C Y N 387 TRP CH2 C Y N 388 TRP OXT O N N 389 TRP H H N N 390 TRP H2 H N N 391 TRP HA H N N 392 TRP HB2 H N N 393 TRP HB3 H N N 394 TRP HD1 H N N 395 TRP HE1 H N N 396 TRP HE3 H N N 397 TRP HZ2 H N N 398 TRP HZ3 H N N 399 TRP HH2 H N N 400 TRP HXT H N N 401 TYR N N N N 402 TYR CA C N S 403 TYR C C N N 404 TYR O O N N 405 TYR CB C N N 406 TYR CG C Y N 407 TYR CD1 C Y N 408 TYR CD2 C Y N 409 TYR CE1 C Y N 410 TYR CE2 C Y N 411 TYR CZ C Y N 412 TYR OH O N N 413 TYR OXT O N N 414 TYR H H N N 415 TYR H2 H N N 416 TYR HA H N N 417 TYR HB2 H N N 418 TYR HB3 H N N 419 TYR HD1 H N N 420 TYR HD2 H N N 421 TYR HE1 H N N 422 TYR HE2 H N N 423 TYR HH H N N 424 TYR HXT H N N 425 VAL N N N N 426 VAL CA C N S 427 VAL C C N N 428 VAL O O N N 429 VAL CB C N N 430 VAL CG1 C N N 431 VAL CG2 C N N 432 VAL OXT O N N 433 VAL H H N N 434 VAL H2 H N N 435 VAL HA H N N 436 VAL HB H N N 437 VAL HG11 H N N 438 VAL HG12 H N N 439 VAL HG13 H N N 440 VAL HG21 H N N 441 VAL HG22 H N N 442 VAL HG23 H N N 443 VAL HXT H N N 444 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 IHP C1 C2 sing N N 152 IHP C1 C6 sing N N 153 IHP C1 O11 sing N N 154 IHP C1 H1 sing N N 155 IHP C2 C3 sing N N 156 IHP C2 O12 sing N N 157 IHP C2 H2 sing N N 158 IHP C3 C4 sing N N 159 IHP C3 O13 sing N N 160 IHP C3 H3 sing N N 161 IHP C4 C5 sing N N 162 IHP C4 O14 sing N N 163 IHP C4 H4 sing N N 164 IHP C5 C6 sing N N 165 IHP C5 O15 sing N N 166 IHP C5 H5 sing N N 167 IHP C6 O16 sing N N 168 IHP C6 H6 sing N N 169 IHP O11 P1 sing N N 170 IHP P1 O21 doub N N 171 IHP P1 O31 sing N N 172 IHP P1 O41 sing N N 173 IHP O31 H31 sing N N 174 IHP O41 H41 sing N N 175 IHP O12 P2 sing N N 176 IHP P2 O22 doub N N 177 IHP P2 O32 sing N N 178 IHP P2 O42 sing N N 179 IHP O32 H32 sing N N 180 IHP O42 H42 sing N N 181 IHP O13 P3 sing N N 182 IHP P3 O23 doub N N 183 IHP P3 O33 sing N N 184 IHP P3 O43 sing N N 185 IHP O33 H33 sing N N 186 IHP O43 H43 sing N N 187 IHP O14 P4 sing N N 188 IHP P4 O24 doub N N 189 IHP P4 O34 sing N N 190 IHP P4 O44 sing N N 191 IHP O34 H34 sing N N 192 IHP O44 H44 sing N N 193 IHP O15 P5 sing N N 194 IHP P5 O25 doub N N 195 IHP P5 O35 sing N N 196 IHP P5 O45 sing N N 197 IHP O35 H35 sing N N 198 IHP O45 H45 sing N N 199 IHP O16 P6 sing N N 200 IHP P6 O26 doub N N 201 IHP P6 O36 sing N N 202 IHP P6 O46 sing N N 203 IHP O36 H36 sing N N 204 IHP O46 H46 sing N N 205 ILE N CA sing N N 206 ILE N H sing N N 207 ILE N H2 sing N N 208 ILE CA C sing N N 209 ILE CA CB sing N N 210 ILE CA HA sing N N 211 ILE C O doub N N 212 ILE C OXT sing N N 213 ILE CB CG1 sing N N 214 ILE CB CG2 sing N N 215 ILE CB HB sing N N 216 ILE CG1 CD1 sing N N 217 ILE CG1 HG12 sing N N 218 ILE CG1 HG13 sing N N 219 ILE CG2 HG21 sing N N 220 ILE CG2 HG22 sing N N 221 ILE CG2 HG23 sing N N 222 ILE CD1 HD11 sing N N 223 ILE CD1 HD12 sing N N 224 ILE CD1 HD13 sing N N 225 ILE OXT HXT sing N N 226 LEU N CA sing N N 227 LEU N H sing N N 228 LEU N H2 sing N N 229 LEU CA C sing N N 230 LEU CA CB sing N N 231 LEU CA HA sing N N 232 LEU C O doub N N 233 LEU C OXT sing N N 234 LEU CB CG sing N N 235 LEU CB HB2 sing N N 236 LEU CB HB3 sing N N 237 LEU CG CD1 sing N N 238 LEU CG CD2 sing N N 239 LEU CG HG sing N N 240 LEU CD1 HD11 sing N N 241 LEU CD1 HD12 sing N N 242 LEU CD1 HD13 sing N N 243 LEU CD2 HD21 sing N N 244 LEU CD2 HD22 sing N N 245 LEU CD2 HD23 sing N N 246 LEU OXT HXT sing N N 247 LYS N CA sing N N 248 LYS N H sing N N 249 LYS N H2 sing N N 250 LYS CA C sing N N 251 LYS CA CB sing N N 252 LYS CA HA sing N N 253 LYS C O doub N N 254 LYS C OXT sing N N 255 LYS CB CG sing N N 256 LYS CB HB2 sing N N 257 LYS CB HB3 sing N N 258 LYS CG CD sing N N 259 LYS CG HG2 sing N N 260 LYS CG HG3 sing N N 261 LYS CD CE sing N N 262 LYS CD HD2 sing N N 263 LYS CD HD3 sing N N 264 LYS CE NZ sing N N 265 LYS CE HE2 sing N N 266 LYS CE HE3 sing N N 267 LYS NZ HZ1 sing N N 268 LYS NZ HZ2 sing N N 269 LYS NZ HZ3 sing N N 270 LYS OXT HXT sing N N 271 MET N CA sing N N 272 MET N H sing N N 273 MET N H2 sing N N 274 MET CA C sing N N 275 MET CA CB sing N N 276 MET CA HA sing N N 277 MET C O doub N N 278 MET C OXT sing N N 279 MET CB CG sing N N 280 MET CB HB2 sing N N 281 MET CB HB3 sing N N 282 MET CG SD sing N N 283 MET CG HG2 sing N N 284 MET CG HG3 sing N N 285 MET SD CE sing N N 286 MET CE HE1 sing N N 287 MET CE HE2 sing N N 288 MET CE HE3 sing N N 289 MET OXT HXT sing N N 290 PHE N CA sing N N 291 PHE N H sing N N 292 PHE N H2 sing N N 293 PHE CA C sing N N 294 PHE CA CB sing N N 295 PHE CA HA sing N N 296 PHE C O doub N N 297 PHE C OXT sing N N 298 PHE CB CG sing N N 299 PHE CB HB2 sing N N 300 PHE CB HB3 sing N N 301 PHE CG CD1 doub Y N 302 PHE CG CD2 sing Y N 303 PHE CD1 CE1 sing Y N 304 PHE CD1 HD1 sing N N 305 PHE CD2 CE2 doub Y N 306 PHE CD2 HD2 sing N N 307 PHE CE1 CZ doub Y N 308 PHE CE1 HE1 sing N N 309 PHE CE2 CZ sing Y N 310 PHE CE2 HE2 sing N N 311 PHE CZ HZ sing N N 312 PHE OXT HXT sing N N 313 PRO N CA sing N N 314 PRO N CD sing N N 315 PRO N H sing N N 316 PRO CA C sing N N 317 PRO CA CB sing N N 318 PRO CA HA sing N N 319 PRO C O doub N N 320 PRO C OXT sing N N 321 PRO CB CG sing N N 322 PRO CB HB2 sing N N 323 PRO CB HB3 sing N N 324 PRO CG CD sing N N 325 PRO CG HG2 sing N N 326 PRO CG HG3 sing N N 327 PRO CD HD2 sing N N 328 PRO CD HD3 sing N N 329 PRO OXT HXT sing N N 330 SER N CA sing N N 331 SER N H sing N N 332 SER N H2 sing N N 333 SER CA C sing N N 334 SER CA CB sing N N 335 SER CA HA sing N N 336 SER C O doub N N 337 SER C OXT sing N N 338 SER CB OG sing N N 339 SER CB HB2 sing N N 340 SER CB HB3 sing N N 341 SER OG HG sing N N 342 SER OXT HXT sing N N 343 THR N CA sing N N 344 THR N H sing N N 345 THR N H2 sing N N 346 THR CA C sing N N 347 THR CA CB sing N N 348 THR CA HA sing N N 349 THR C O doub N N 350 THR C OXT sing N N 351 THR CB OG1 sing N N 352 THR CB CG2 sing N N 353 THR CB HB sing N N 354 THR OG1 HG1 sing N N 355 THR CG2 HG21 sing N N 356 THR CG2 HG22 sing N N 357 THR CG2 HG23 sing N N 358 THR OXT HXT sing N N 359 TRP N CA sing N N 360 TRP N H sing N N 361 TRP N H2 sing N N 362 TRP CA C sing N N 363 TRP CA CB sing N N 364 TRP CA HA sing N N 365 TRP C O doub N N 366 TRP C OXT sing N N 367 TRP CB CG sing N N 368 TRP CB HB2 sing N N 369 TRP CB HB3 sing N N 370 TRP CG CD1 doub Y N 371 TRP CG CD2 sing Y N 372 TRP CD1 NE1 sing Y N 373 TRP CD1 HD1 sing N N 374 TRP CD2 CE2 doub Y N 375 TRP CD2 CE3 sing Y N 376 TRP NE1 CE2 sing Y N 377 TRP NE1 HE1 sing N N 378 TRP CE2 CZ2 sing Y N 379 TRP CE3 CZ3 doub Y N 380 TRP CE3 HE3 sing N N 381 TRP CZ2 CH2 doub Y N 382 TRP CZ2 HZ2 sing N N 383 TRP CZ3 CH2 sing Y N 384 TRP CZ3 HZ3 sing N N 385 TRP CH2 HH2 sing N N 386 TRP OXT HXT sing N N 387 TYR N CA sing N N 388 TYR N H sing N N 389 TYR N H2 sing N N 390 TYR CA C sing N N 391 TYR CA CB sing N N 392 TYR CA HA sing N N 393 TYR C O doub N N 394 TYR C OXT sing N N 395 TYR CB CG sing N N 396 TYR CB HB2 sing N N 397 TYR CB HB3 sing N N 398 TYR CG CD1 doub Y N 399 TYR CG CD2 sing Y N 400 TYR CD1 CE1 sing Y N 401 TYR CD1 HD1 sing N N 402 TYR CD2 CE2 doub Y N 403 TYR CD2 HD2 sing N N 404 TYR CE1 CZ doub Y N 405 TYR CE1 HE1 sing N N 406 TYR CE2 CZ sing Y N 407 TYR CE2 HE2 sing N N 408 TYR CZ OH sing N N 409 TYR OH HH sing N N 410 TYR OXT HXT sing N N 411 VAL N CA sing N N 412 VAL N H sing N N 413 VAL N H2 sing N N 414 VAL CA C sing N N 415 VAL CA CB sing N N 416 VAL CA HA sing N N 417 VAL C O doub N N 418 VAL C OXT sing N N 419 VAL CB CG1 sing N N 420 VAL CB CG2 sing N N 421 VAL CB HB sing N N 422 VAL CG1 HG11 sing N N 423 VAL CG1 HG12 sing N N 424 VAL CG1 HG13 sing N N 425 VAL CG2 HG21 sing N N 426 VAL CG2 HG22 sing N N 427 VAL CG2 HG23 sing N N 428 VAL OXT HXT sing N N 429 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R01-AI129678 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' U54-GM103297 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'INOSITOL HEXAKISPHOSPHATE' IHP 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5I4T _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'Generated by symmetry operation.' #