data_6BQ8 # _entry.id 6BQ8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6BQ8 pdb_00006bq8 10.2210/pdb6bq8/pdb WWPDB D_1000231229 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-03-21 2 'Structure model' 1 1 2018-04-11 3 'Structure model' 1 2 2019-02-20 4 'Structure model' 1 3 2020-01-01 5 'Structure model' 2 0 2023-05-10 6 'Structure model' 3 0 2023-05-17 7 'Structure model' 3 1 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 3 'Structure model' 'Data collection' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Atomic model' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Derived calculations' 10 5 'Structure model' 'Non-polymer description' 11 5 'Structure model' 'Structure summary' 12 6 'Structure model' 'Non-polymer description' 13 7 'Structure model' 'Data collection' 14 7 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' diffrn_source 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' atom_site 6 5 'Structure model' chem_comp 7 5 'Structure model' database_2 8 5 'Structure model' entity 9 5 'Structure model' pdbx_entity_nonpoly 10 5 'Structure model' pdbx_nonpoly_scheme 11 5 'Structure model' struct_site 12 6 'Structure model' chem_comp 13 7 'Structure model' chem_comp_atom 14 7 'Structure model' chem_comp_bond 15 7 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline' 5 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 6 3 'Structure model' '_pdbx_audit_support.funding_organization' 7 4 'Structure model' '_pdbx_audit_support.funding_organization' 8 5 'Structure model' '_atom_site.B_iso_or_equiv' 9 5 'Structure model' '_atom_site.Cartn_x' 10 5 'Structure model' '_atom_site.Cartn_y' 11 5 'Structure model' '_atom_site.Cartn_z' 12 5 'Structure model' '_atom_site.auth_atom_id' 13 5 'Structure model' '_atom_site.auth_comp_id' 14 5 'Structure model' '_atom_site.label_atom_id' 15 5 'Structure model' '_atom_site.label_comp_id' 16 5 'Structure model' '_atom_site.type_symbol' 17 5 'Structure model' '_chem_comp.formula' 18 5 'Structure model' '_chem_comp.formula_weight' 19 5 'Structure model' '_chem_comp.id' 20 5 'Structure model' '_chem_comp.mon_nstd_flag' 21 5 'Structure model' '_chem_comp.name' 22 5 'Structure model' '_chem_comp.type' 23 5 'Structure model' '_database_2.pdbx_DOI' 24 5 'Structure model' '_database_2.pdbx_database_accession' 25 5 'Structure model' '_entity.pdbx_description' 26 5 'Structure model' '_pdbx_entity_nonpoly.comp_id' 27 5 'Structure model' '_pdbx_entity_nonpoly.name' 28 5 'Structure model' '_pdbx_nonpoly_scheme.mon_id' 29 5 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id' 30 5 'Structure model' '_struct_site.details' 31 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 6 'Structure model' '_chem_comp.formula' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6BQ8 _pdbx_database_status.recvd_initial_deposition_date 2017-11-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kim, C.' 1 ? 'Kovalevsky, A.' 2 ? 'Gerlits, O.' 3 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Biochemistry BICHAW 0033 1520-4995 ? ? 57 ? 1833 1837 ;Neutron Crystallography Detects Differences in Protein Dynamics: Structure of the PKG II Cyclic Nucleotide Binding Domain in Complex with an Activator. ; 2018 ? 10.1021/acs.biochem.8b00010 29517905 ? ? ? ? ? ? ? ? US ? ? 1 'Acta Crystallogr. D Biol. Crystallogr.' ABCRE6 ? 1399-0047 ? ? 65 ? 567 573 'Generalized X-ray and neutron crystallographic analysis: more accurate and complete structures for biological macromolecules.' 2009 ? 10.1107/S0907444909011548 19465771 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gerlits, O.' 1 ? primary 'Campbell, J.C.' 2 ? primary 'Blakeley, M.P.' 3 ? primary 'Kim, C.' 4 ? primary 'Kovalevsky, A.' 5 ? 1 'Adams, P.D.' 6 ? 1 'Mustyakimov, M.' 7 ? 1 'Afonine, P.V.' 8 ? 1 'Langan, P.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'cGMP-dependent protein kinase 2' 17394.375 1 2.7.11.12 ? ? ? 2 non-polymer syn ;2-(~2~H_2_)amino-8-[(4-chlorophenyl)sulfanyl]-9-[(2S,4aR,6R,7R,7aS)-2-hydroxy-7-(~2~H)hydroxy-2-oxotetrahydro-2H,4H-2lambda~5~-furo[3,2-d][1,3,2]dioxaphosphinin-6-yl](~2~H)-1,9-dihydro-6H-purin-6-one ; 487.811 1 ? ? ? ? 3 non-polymer syn 'STRONTIUM ION' 87.620 1 ? ? ? ? 4 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 1 ? ? ? ? 5 water nat water 18.015 40 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'cGK2,cGMP-dependent protein kinase II,cGKII' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLI KTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLI KTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;2-(~2~H_2_)amino-8-[(4-chlorophenyl)sulfanyl]-9-[(2S,4aR,6R,7R,7aS)-2-hydroxy-7-(~2~H)hydroxy-2-oxotetrahydro-2H,4H-2lambda~5~-furo[3,2-d][1,3,2]dioxaphosphinin-6-yl](~2~H)-1,9-dihydro-6H-purin-6-one ; WNU 3 'STRONTIUM ION' SR 4 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 5 water DOD # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 THR n 1 4 ALA n 1 5 GLN n 1 6 ALA n 1 7 ARG n 1 8 ASP n 1 9 GLU n 1 10 GLN n 1 11 TYR n 1 12 ARG n 1 13 ASN n 1 14 PHE n 1 15 LEU n 1 16 ARG n 1 17 SER n 1 18 VAL n 1 19 SER n 1 20 LEU n 1 21 LEU n 1 22 LYS n 1 23 ASN n 1 24 LEU n 1 25 PRO n 1 26 GLU n 1 27 ASP n 1 28 LYS n 1 29 LEU n 1 30 THR n 1 31 LYS n 1 32 ILE n 1 33 ILE n 1 34 ASP n 1 35 CYS n 1 36 LEU n 1 37 GLU n 1 38 VAL n 1 39 GLU n 1 40 TYR n 1 41 TYR n 1 42 ASP n 1 43 LYS n 1 44 GLY n 1 45 ASP n 1 46 TYR n 1 47 ILE n 1 48 ILE n 1 49 ARG n 1 50 GLU n 1 51 GLY n 1 52 GLU n 1 53 GLU n 1 54 GLY n 1 55 SER n 1 56 THR n 1 57 PHE n 1 58 PHE n 1 59 ILE n 1 60 LEU n 1 61 ALA n 1 62 LYS n 1 63 GLY n 1 64 LYS n 1 65 VAL n 1 66 LYS n 1 67 VAL n 1 68 THR n 1 69 GLN n 1 70 SER n 1 71 THR n 1 72 GLU n 1 73 GLY n 1 74 HIS n 1 75 ASP n 1 76 GLN n 1 77 PRO n 1 78 GLN n 1 79 LEU n 1 80 ILE n 1 81 LYS n 1 82 THR n 1 83 LEU n 1 84 GLN n 1 85 LYS n 1 86 GLY n 1 87 GLU n 1 88 TYR n 1 89 PHE n 1 90 GLY n 1 91 GLU n 1 92 LYS n 1 93 ALA n 1 94 LEU n 1 95 ILE n 1 96 SER n 1 97 ASP n 1 98 ASP n 1 99 VAL n 1 100 ARG n 1 101 SER n 1 102 ALA n 1 103 ASN n 1 104 ILE n 1 105 ILE n 1 106 ALA n 1 107 GLU n 1 108 GLU n 1 109 ASN n 1 110 ASP n 1 111 VAL n 1 112 ALA n 1 113 CYS n 1 114 LEU n 1 115 VAL n 1 116 ILE n 1 117 ASP n 1 118 ARG n 1 119 GLU n 1 120 THR n 1 121 PHE n 1 122 ASN n 1 123 GLN n 1 124 THR n 1 125 VAL n 1 126 GLY n 1 127 THR n 1 128 PHE n 1 129 GLU n 1 130 GLU n 1 131 LEU n 1 132 GLN n 1 133 LYS n 1 134 TYR n 1 135 LEU n 1 136 GLU n 1 137 GLY n 1 138 TYR n 1 139 VAL n 1 140 ALA n 1 141 ASN n 1 142 LEU n 1 143 ASN n 1 144 ARG n 1 145 ASP n 1 146 ASP n 1 147 GLU n 1 148 LYS n 1 149 ARG n 1 150 HIS n 1 151 ALA n 1 152 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 152 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PRKG2, PRKGR2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SR non-polymer . 'STRONTIUM ION' ? 'Sr 2' 87.620 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 WNU non-polymer . ;2-(~2~H_2_)amino-8-[(4-chlorophenyl)sulfanyl]-9-[(2S,4aR,6R,7R,7aS)-2-hydroxy-7-(~2~H)hydroxy-2-oxotetrahydro-2H,4H-2lambda~5~-furo[3,2-d][1,3,2]dioxaphosphinin-6-yl](~2~H)-1,9-dihydro-6H-purin-6-one ; ? 'C16 H15 Cl N5 O7 P S' 487.811 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 267 ? ? ? A . n A 1 2 SER 2 268 ? ? ? A . n A 1 3 THR 3 269 269 THR THR A . n A 1 4 ALA 4 270 270 ALA ALA A . n A 1 5 GLN 5 271 271 GLN GLN A . n A 1 6 ALA 6 272 272 ALA ALA A . n A 1 7 ARG 7 273 273 ARG ARG A . n A 1 8 ASP 8 274 274 ASP ASP A . n A 1 9 GLU 9 275 275 GLU GLU A . n A 1 10 GLN 10 276 276 GLN GLN A . n A 1 11 TYR 11 277 277 TYR TYR A . n A 1 12 ARG 12 278 278 ARG ARG A . n A 1 13 ASN 13 279 279 ASN ASN A . n A 1 14 PHE 14 280 280 PHE PHE A . n A 1 15 LEU 15 281 281 LEU LEU A . n A 1 16 ARG 16 282 282 ARG ARG A . n A 1 17 SER 17 283 283 SER SER A . n A 1 18 VAL 18 284 284 VAL VAL A . n A 1 19 SER 19 285 285 SER SER A . n A 1 20 LEU 20 286 286 LEU LEU A . n A 1 21 LEU 21 287 287 LEU LEU A . n A 1 22 LYS 22 288 288 LYS LYS A . n A 1 23 ASN 23 289 289 ASN ASN A . n A 1 24 LEU 24 290 290 LEU LEU A . n A 1 25 PRO 25 291 291 PRO PRO A . n A 1 26 GLU 26 292 292 GLU GLU A . n A 1 27 ASP 27 293 293 ASP ASP A . n A 1 28 LYS 28 294 294 LYS LYS A . n A 1 29 LEU 29 295 295 LEU LEU A . n A 1 30 THR 30 296 296 THR THR A . n A 1 31 LYS 31 297 297 LYS LYS A . n A 1 32 ILE 32 298 298 ILE ILE A . n A 1 33 ILE 33 299 299 ILE ILE A . n A 1 34 ASP 34 300 300 ASP ASP A . n A 1 35 CYS 35 301 301 CYS CYS A . n A 1 36 LEU 36 302 302 LEU LEU A . n A 1 37 GLU 37 303 303 GLU GLU A . n A 1 38 VAL 38 304 304 VAL VAL A . n A 1 39 GLU 39 305 305 GLU GLU A . n A 1 40 TYR 40 306 306 TYR TYR A . n A 1 41 TYR 41 307 307 TYR TYR A . n A 1 42 ASP 42 308 308 ASP ASP A . n A 1 43 LYS 43 309 309 LYS LYS A . n A 1 44 GLY 44 310 310 GLY GLY A . n A 1 45 ASP 45 311 311 ASP ASP A . n A 1 46 TYR 46 312 312 TYR TYR A . n A 1 47 ILE 47 313 313 ILE ILE A . n A 1 48 ILE 48 314 314 ILE ILE A . n A 1 49 ARG 49 315 315 ARG ARG A . n A 1 50 GLU 50 316 316 GLU GLU A . n A 1 51 GLY 51 317 317 GLY GLY A . n A 1 52 GLU 52 318 318 GLU GLU A . n A 1 53 GLU 53 319 319 GLU GLU A . n A 1 54 GLY 54 320 320 GLY GLY A . n A 1 55 SER 55 321 321 SER SER A . n A 1 56 THR 56 322 322 THR THR A . n A 1 57 PHE 57 323 323 PHE PHE A . n A 1 58 PHE 58 324 324 PHE PHE A . n A 1 59 ILE 59 325 325 ILE ILE A . n A 1 60 LEU 60 326 326 LEU LEU A . n A 1 61 ALA 61 327 327 ALA ALA A . n A 1 62 LYS 62 328 328 LYS LYS A . n A 1 63 GLY 63 329 329 GLY GLY A . n A 1 64 LYS 64 330 330 LYS LYS A . n A 1 65 VAL 65 331 331 VAL VAL A . n A 1 66 LYS 66 332 332 LYS LYS A . n A 1 67 VAL 67 333 333 VAL VAL A . n A 1 68 THR 68 334 334 THR THR A . n A 1 69 GLN 69 335 335 GLN GLN A . n A 1 70 SER 70 336 336 SER SER A . n A 1 71 THR 71 337 337 THR THR A . n A 1 72 GLU 72 338 338 GLU GLU A . n A 1 73 GLY 73 339 339 GLY GLY A . n A 1 74 HIS 74 340 340 HIS HIS A . n A 1 75 ASP 75 341 341 ASP ASP A . n A 1 76 GLN 76 342 342 GLN GLN A . n A 1 77 PRO 77 343 343 PRO PRO A . n A 1 78 GLN 78 344 344 GLN GLN A . n A 1 79 LEU 79 345 345 LEU LEU A . n A 1 80 ILE 80 346 346 ILE ILE A . n A 1 81 LYS 81 347 347 LYS LYS A . n A 1 82 THR 82 348 348 THR THR A . n A 1 83 LEU 83 349 349 LEU LEU A . n A 1 84 GLN 84 350 350 GLN GLN A . n A 1 85 LYS 85 351 351 LYS LYS A . n A 1 86 GLY 86 352 352 GLY GLY A . n A 1 87 GLU 87 353 353 GLU GLU A . n A 1 88 TYR 88 354 354 TYR TYR A . n A 1 89 PHE 89 355 355 PHE PHE A . n A 1 90 GLY 90 356 356 GLY GLY A . n A 1 91 GLU 91 357 357 GLU GLU A . n A 1 92 LYS 92 358 358 LYS LYS A . n A 1 93 ALA 93 359 359 ALA ALA A . n A 1 94 LEU 94 360 360 LEU LEU A . n A 1 95 ILE 95 361 361 ILE ILE A . n A 1 96 SER 96 362 362 SER SER A . n A 1 97 ASP 97 363 363 ASP ASP A . n A 1 98 ASP 98 364 364 ASP ASP A . n A 1 99 VAL 99 365 365 VAL VAL A . n A 1 100 ARG 100 366 366 ARG ARG A . n A 1 101 SER 101 367 367 SER SER A . n A 1 102 ALA 102 368 368 ALA ALA A . n A 1 103 ASN 103 369 369 ASN ASN A . n A 1 104 ILE 104 370 370 ILE ILE A . n A 1 105 ILE 105 371 371 ILE ILE A . n A 1 106 ALA 106 372 372 ALA ALA A . n A 1 107 GLU 107 373 373 GLU GLU A . n A 1 108 GLU 108 374 374 GLU GLU A . n A 1 109 ASN 109 375 375 ASN ASN A . n A 1 110 ASP 110 376 376 ASP ASP A . n A 1 111 VAL 111 377 377 VAL VAL A . n A 1 112 ALA 112 378 378 ALA ALA A . n A 1 113 CYS 113 379 379 CYS CYS A . n A 1 114 LEU 114 380 380 LEU LEU A . n A 1 115 VAL 115 381 381 VAL VAL A . n A 1 116 ILE 116 382 382 ILE ILE A . n A 1 117 ASP 117 383 383 ASP ASP A . n A 1 118 ARG 118 384 384 ARG ARG A . n A 1 119 GLU 119 385 385 GLU GLU A . n A 1 120 THR 120 386 386 THR THR A . n A 1 121 PHE 121 387 387 PHE PHE A . n A 1 122 ASN 122 388 388 ASN ASN A . n A 1 123 GLN 123 389 389 GLN GLN A . n A 1 124 THR 124 390 390 THR THR A . n A 1 125 VAL 125 391 391 VAL VAL A . n A 1 126 GLY 126 392 392 GLY GLY A . n A 1 127 THR 127 393 393 THR THR A . n A 1 128 PHE 128 394 394 PHE PHE A . n A 1 129 GLU 129 395 395 GLU GLU A . n A 1 130 GLU 130 396 396 GLU GLU A . n A 1 131 LEU 131 397 397 LEU LEU A . n A 1 132 GLN 132 398 398 GLN GLN A . n A 1 133 LYS 133 399 399 LYS LYS A . n A 1 134 TYR 134 400 400 TYR TYR A . n A 1 135 LEU 135 401 401 LEU LEU A . n A 1 136 GLU 136 402 402 GLU GLU A . n A 1 137 GLY 137 403 403 GLY GLY A . n A 1 138 TYR 138 404 404 TYR TYR A . n A 1 139 VAL 139 405 405 VAL VAL A . n A 1 140 ALA 140 406 406 ALA ALA A . n A 1 141 ASN 141 407 407 ASN ASN A . n A 1 142 LEU 142 408 408 LEU LEU A . n A 1 143 ASN 143 409 409 ASN ASN A . n A 1 144 ARG 144 410 410 ARG ARG A . n A 1 145 ASP 145 411 411 ASP ASP A . n A 1 146 ASP 146 412 412 ASP ASP A . n A 1 147 GLU 147 413 413 GLU GLU A . n A 1 148 LYS 148 414 414 LYS LYS A . n A 1 149 ARG 149 415 415 ARG ARG A . n A 1 150 HIS 150 416 416 HIS HIS A . n A 1 151 ALA 151 417 417 ALA ALA A . n A 1 152 LYS 152 418 418 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 WNU 1 501 501 WNU 6FW A . C 3 SR 1 502 502 SR SR A . D 4 MPD 1 503 503 MPD MPD A . E 5 DOD 1 601 601 DOD DOD A . E 5 DOD 2 602 602 DOD DOD A . E 5 DOD 3 603 603 DOD DOD A . E 5 DOD 4 604 604 DOD DOD A . E 5 DOD 5 605 605 DOD DOD A . E 5 DOD 6 606 606 DOD DOD A . E 5 DOD 7 607 607 DOD DOD A . E 5 DOD 8 608 608 DOD DOD A . E 5 DOD 9 609 609 DOD DOD A . E 5 DOD 10 610 610 DOD DOD A . E 5 DOD 11 611 611 DOD DOD A . E 5 DOD 12 612 612 DOD DOD A . E 5 DOD 13 613 613 DOD DOD A . E 5 DOD 14 614 614 DOD DOD A . E 5 DOD 15 615 615 DOD DOD A . E 5 DOD 16 616 616 DOD DOD A . E 5 DOD 17 617 617 DOD DOD A . E 5 DOD 18 618 618 DOD DOD A . E 5 DOD 19 619 619 DOD DOD A . E 5 DOD 20 620 620 DOD DOD A . E 5 DOD 21 621 621 DOD DOD A . E 5 DOD 22 622 622 DOD DOD A . E 5 DOD 23 623 623 DOD DOD A . E 5 DOD 24 624 624 DOD DOD A . E 5 DOD 25 625 625 DOD DOD A . E 5 DOD 26 626 626 DOD DOD A . E 5 DOD 27 627 627 DOD DOD A . E 5 DOD 28 628 628 DOD DOD A . E 5 DOD 29 629 629 DOD DOD A . E 5 DOD 30 630 630 DOD DOD A . E 5 DOD 31 631 631 DOD DOD A . E 5 DOD 32 632 632 DOD DOD A . E 5 DOD 33 633 633 DOD DOD A . E 5 DOD 34 634 634 DOD DOD A . E 5 DOD 35 635 635 DOD DOD A . E 5 DOD 36 636 636 DOD DOD A . E 5 DOD 37 637 637 DOD DOD A . E 5 DOD 38 638 638 DOD DOD A . E 5 DOD 39 639 639 DOD DOD A . E 5 DOD 40 640 640 DOD DOD A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? nCNS ? ? ? 1.0.0 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? LAUEGEN ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? LSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.entry_id 6BQ8 _cell.length_a 43.650 _cell.length_b 51.300 _cell.length_c 68.200 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 6BQ8 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.entry_id _exptl.crystals_number _exptl.details _exptl.method _exptl.method_details ? ? ? ? ? 6BQ8 1 ? 'X-RAY DIFFRACTION' ? ? ? ? ? ? 6BQ8 1 ? 'NEUTRON DIFFRACTION' ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% MPD, 20 mM SrCl2, 100 mM NaOAc pH 4.6' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt ? 293 ? ? 1 ? ? ? 1 ? ? ? ? ? ? ? 293 ? ? 1 ? ? ? 2 ? ? ? ? ? ? # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date 'OSMIC VARIMAX' 'IMAGE PLATE' 1 'RIGAKU RAXIS IV++' ? ? ? ? 2015-11-01 COLLIMATORS 'IMAGE PLATE' 2 'MAATEL IMAGINE' ? ? ? ? 2015-11-26 # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? ? ? ? ? ? ? 2 L ? ? LAUE ? neutron # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.5418 1.0 2 2.8 1.0 3 4.0 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? 'ROTATING ANODE' ? 'RIGAKU MICROMAX-007 HF' ? ? 1.5418 ? ? ? ? ? 2 ? ? 'NUCLEAR REACTOR' ? 'ILL BEAMLINE LADI III' ? ? 2.8-4.0 ? 'LADI III' ILL # loop_ _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.entry_id _reflns.observed_criterion_sigma_I _reflns.observed_criterion_sigma_F _reflns.d_resolution_low _reflns.d_resolution_high _reflns.number_obs _reflns.number_all _reflns.percent_possible_obs _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rsym_value _reflns.pdbx_netI_over_sigmaI _reflns.B_iso_Wilson_estimate _reflns.pdbx_redundancy _reflns.pdbx_CC_half _reflns.pdbx_Rpim_I_all _reflns.pdbx_Rrim_I_all 1 1 6BQ8 ? ? 10.00 2.00 10492 ? 97.3 0.064 ? 12.5 ? 3.3 ? ? ? 2 2 6BQ8 ? ? 40.00 2.20 5966 ? 74.7 0.141 ? 7.50 ? 3.60 ? ? ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.number_measured_obs _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_Rrim_I_all 1 1 2.00 2.06 97.6 0.535 ? 2.80 3.2 ? ? ? ? ? ? 2 2 2.20 2.32 51.9 0.190 ? 4.50 2.40 ? ? ? ? ? ? # loop_ _refine.pdbx_refine_id _refine.entry_id _refine.pdbx_diffrn_id _refine.pdbx_TLS_residual_ADP_flag _refine.ls_number_reflns_obs _refine.ls_number_reflns_all _refine.pdbx_ls_sigma_I _refine.pdbx_ls_sigma_F _refine.pdbx_data_cutoff_high_absF _refine.pdbx_data_cutoff_low_absF _refine.pdbx_data_cutoff_high_rms_absF _refine.ls_d_res_low _refine.ls_d_res_high _refine.ls_percent_reflns_obs _refine.ls_R_factor_obs _refine.ls_R_factor_all _refine.ls_R_factor_R_work _refine.ls_R_factor_R_free _refine.ls_R_factor_R_free_error _refine.ls_R_factor_R_free_error_details _refine.ls_percent_reflns_R_free _refine.ls_number_reflns_R_free _refine.ls_number_parameters _refine.ls_number_restraints _refine.occupancy_min _refine.occupancy_max _refine.correlation_coeff_Fo_to_Fc _refine.correlation_coeff_Fo_to_Fc_free _refine.B_iso_mean _refine.aniso_B[1][1] _refine.aniso_B[2][2] _refine.aniso_B[3][3] _refine.aniso_B[1][2] _refine.aniso_B[1][3] _refine.aniso_B[2][3] _refine.solvent_model_details _refine.solvent_model_param_ksol _refine.solvent_model_param_bsol _refine.pdbx_solvent_vdw_probe_radii _refine.pdbx_solvent_ion_probe_radii _refine.pdbx_solvent_shrinkage_radii _refine.pdbx_ls_cross_valid_method _refine.details _refine.pdbx_starting_model _refine.pdbx_method_to_determine_struct _refine.pdbx_isotropic_thermal_model _refine.pdbx_stereochemistry_target_values _refine.pdbx_stereochem_target_val_spec_case _refine.pdbx_R_Free_selection_details _refine.pdbx_overall_ESU_R _refine.pdbx_overall_ESU_R_Free _refine.overall_SU_ML _refine.pdbx_overall_phase_error _refine.overall_SU_B _refine.overall_SU_R_Cruickshank_DPI _refine.pdbx_overall_SU_R_free_Cruickshank_DPI _refine.pdbx_overall_SU_R_Blow_DPI _refine.pdbx_overall_SU_R_free_Blow_DPI 'X-RAY DIFFRACTION' 6BQ8 ? ? 10401 ? ? 2.0 ? ? ? 10.00 2.00 96.0 ? ? 0.199 0.245 ? ? 5.000 487 ? ? ? ? ? ? 38.16 ? ? ? ? ? ? ? ? ? ? ? ? 'FREE R-VALUE' ? 5BV6 'MOLECULAR REPLACEMENT' ? ? ? RANDOM ? ? ? ? ? ? ? ? ? 'NEUTRON DIFFRACTION' 6BQ8 ? ? 5949 ? ? 2.0 ? ? ? 40.00 2.2 72.6 ? ? 0.232 0.288 ? ? 5.000 287 ? ? ? ? ? ? 38.16 ? ? ? ? ? ? ? ? ? ? ? ? 'FREE R-VALUE' ? 5BV6 'MOLECULAR REPLACEMENT' ? ? ? RANDOM ? ? ? ? ? ? ? ? ? # loop_ _refine_analyze.pdbx_refine_id _refine_analyze.entry_id _refine_analyze.Luzzati_coordinate_error_obs _refine_analyze.Luzzati_sigma_a_obs _refine_analyze.Luzzati_d_res_low_obs _refine_analyze.Luzzati_coordinate_error_free _refine_analyze.Luzzati_sigma_a_free _refine_analyze.Luzzati_d_res_low_free _refine_analyze.number_disordered_residues _refine_analyze.occupancy_sum_hydrogen _refine_analyze.occupancy_sum_non_hydrogen 'X-RAY DIFFRACTION' 6BQ8 0.31 0.50 5.00 0.40 0.69 ? ? ? ? 'NEUTRON DIFFRACTION' 6BQ8 ? ? ? 0.27 0.23 ? ? ? ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1214 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 1294 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 10.00 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' 8 2.00 2.09 1304 0.296 93.3 0.292 0.049 5.000 59 . . . . 'NEUTRON DIFFRACTION' 8 2.20 2.31 996 0.361 49.4 0.477 0.049 5.0 24 . . . . # _struct.entry_id 6BQ8 _struct.title 'Joint X-ray/neutron structure of PKG II CNB-B domain in complex with 8-pCPT-cGMP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6BQ8 _struct_keywords.text ;protein kinase G, regulatory domain, neutron crystallography, activator, hydrogen bonding, protonation state, SIGNALING PROTEIN, Transferase ; _struct_keywords.pdbx_keywords 'Transferase,SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KGP2_HUMAN _struct_ref.pdbx_db_accession Q13237 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKT LQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAK ; _struct_ref.pdbx_align_begin 269 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6BQ8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 152 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13237 _struct_ref_seq.db_align_beg 269 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 418 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 269 _struct_ref_seq.pdbx_auth_seq_align_end 418 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6BQ8 GLY A 1 ? UNP Q13237 ? ? 'expression tag' 267 1 1 6BQ8 SER A 2 ? UNP Q13237 ? ? 'expression tag' 268 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4580 ? 1 MORE -8 ? 1 'SSA (A^2)' 8820 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 3 ? SER A 17 ? THR A 269 SER A 283 1 ? 15 HELX_P HELX_P2 AA2 VAL A 18 ? LYS A 22 ? VAL A 284 LYS A 288 5 ? 5 HELX_P HELX_P3 AA3 PRO A 25 ? LEU A 36 ? PRO A 291 LEU A 302 1 ? 12 HELX_P HELX_P4 AA4 GLY A 90 ? ASP A 97 ? GLY A 356 ASP A 363 1 ? 8 HELX_P HELX_P5 AA5 ASP A 117 ? THR A 124 ? ASP A 383 THR A 390 1 ? 8 HELX_P HELX_P6 AA6 VAL A 125 ? THR A 127 ? VAL A 391 THR A 393 5 ? 3 HELX_P HELX_P7 AA7 PHE A 128 ? HIS A 150 ? PHE A 394 HIS A 416 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ASP _struct_conn.ptnr1_label_seq_id 98 _struct_conn.ptnr1_label_atom_id OD2 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id SR _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id SR _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ASP _struct_conn.ptnr1_auth_seq_id 364 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id SR _struct_conn.ptnr2_auth_seq_id 502 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.710 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 37 ? TYR A 41 ? GLU A 303 TYR A 307 AA1 2 VAL A 111 ? ILE A 116 ? VAL A 377 ILE A 382 AA1 3 PHE A 57 ? LYS A 62 ? PHE A 323 LYS A 328 AA1 4 TYR A 88 ? PHE A 89 ? TYR A 354 PHE A 355 AA2 1 TYR A 46 ? ILE A 48 ? TYR A 312 ILE A 314 AA2 2 ASN A 103 ? ALA A 106 ? ASN A 369 ALA A 372 AA2 3 LYS A 64 ? GLN A 69 ? LYS A 330 GLN A 335 AA2 4 GLN A 78 ? GLN A 84 ? GLN A 344 GLN A 350 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 37 ? N GLU A 303 O VAL A 115 ? O VAL A 381 AA1 2 3 O LEU A 114 ? O LEU A 380 N ILE A 59 ? N ILE A 325 AA1 3 4 N PHE A 58 ? N PHE A 324 O PHE A 89 ? O PHE A 355 AA2 1 2 N ILE A 47 ? N ILE A 313 O ILE A 104 ? O ILE A 370 AA2 2 3 O ASN A 103 ? O ASN A 369 N THR A 68 ? N THR A 334 AA2 3 4 N GLN A 69 ? N GLN A 335 O GLN A 78 ? O GLN A 344 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A WNU 501 ? 16 'binding site for residue WNU A 501' AC2 Software A SR 502 ? 2 'binding site for residue SR A 502' AC3 Software A MPD 503 ? 2 'binding site for residue MPD A 503' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 GLN A 69 ? GLN A 335 . ? 1_555 ? 2 AC1 16 LYS A 81 ? LYS A 347 . ? 1_555 ? 3 AC1 16 TYR A 88 ? TYR A 354 . ? 1_555 ? 4 AC1 16 PHE A 89 ? PHE A 355 . ? 1_555 ? 5 AC1 16 GLY A 90 ? GLY A 356 . ? 1_555 ? 6 AC1 16 GLU A 91 ? GLU A 357 . ? 1_555 ? 7 AC1 16 LYS A 92 ? LYS A 358 . ? 1_555 ? 8 AC1 16 ALA A 93 ? ALA A 359 . ? 1_555 ? 9 AC1 16 ARG A 100 ? ARG A 366 . ? 1_555 ? 10 AC1 16 SER A 101 ? SER A 367 . ? 1_555 ? 11 AC1 16 ALA A 102 ? ALA A 368 . ? 1_555 ? 12 AC1 16 ILE A 104 ? ILE A 370 . ? 1_555 ? 13 AC1 16 ASP A 146 ? ASP A 412 . ? 1_555 ? 14 AC1 16 ARG A 149 ? ARG A 415 . ? 1_555 ? 15 AC1 16 DOD E . ? DOD A 605 . ? 1_555 ? 16 AC1 16 DOD E . ? DOD A 609 . ? 1_555 ? 17 AC2 2 ASP A 98 ? ASP A 364 . ? 1_555 ? 18 AC2 2 DOD E . ? DOD A 637 . ? 1_555 ? 19 AC3 2 GLN A 10 ? GLN A 276 . ? 1_555 ? 20 AC3 2 TYR A 11 ? TYR A 277 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 280 ? ? DG A SER 283 ? A 1.49 2 1 O A PHE 280 ? ? HG A SER 283 ? B 1.49 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 390 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -121.91 _pdbx_validate_torsion.psi -77.51 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 267 ? A GLY 1 2 1 Y 1 A SER 268 ? A SER 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DOD O O N N 88 DOD D1 D N N 89 DOD D2 D N N 90 GLN N N N N 91 GLN CA C N S 92 GLN C C N N 93 GLN O O N N 94 GLN CB C N N 95 GLN CG C N N 96 GLN CD C N N 97 GLN OE1 O N N 98 GLN NE2 N N N 99 GLN OXT O N N 100 GLN H H N N 101 GLN H2 H N N 102 GLN HA H N N 103 GLN HB2 H N N 104 GLN HB3 H N N 105 GLN HG2 H N N 106 GLN HG3 H N N 107 GLN HE21 H N N 108 GLN HE22 H N N 109 GLN HXT H N N 110 GLU N N N N 111 GLU CA C N S 112 GLU C C N N 113 GLU O O N N 114 GLU CB C N N 115 GLU CG C N N 116 GLU CD C N N 117 GLU OE1 O N N 118 GLU OE2 O N N 119 GLU OXT O N N 120 GLU H H N N 121 GLU H2 H N N 122 GLU HA H N N 123 GLU HB2 H N N 124 GLU HB3 H N N 125 GLU HG2 H N N 126 GLU HG3 H N N 127 GLU HE2 H N N 128 GLU HXT H N N 129 GLY N N N N 130 GLY CA C N N 131 GLY C C N N 132 GLY O O N N 133 GLY OXT O N N 134 GLY H H N N 135 GLY H2 H N N 136 GLY HA2 H N N 137 GLY HA3 H N N 138 GLY HXT H N N 139 HIS N N N N 140 HIS CA C N S 141 HIS C C N N 142 HIS O O N N 143 HIS CB C N N 144 HIS CG C Y N 145 HIS ND1 N Y N 146 HIS CD2 C Y N 147 HIS CE1 C Y N 148 HIS NE2 N Y N 149 HIS OXT O N N 150 HIS H H N N 151 HIS H2 H N N 152 HIS HA H N N 153 HIS HB2 H N N 154 HIS HB3 H N N 155 HIS HD1 H N N 156 HIS HD2 H N N 157 HIS HE1 H N N 158 HIS HE2 H N N 159 HIS HXT H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MPD C1 C N N 230 MPD C2 C N N 231 MPD O2 O N N 232 MPD CM C N N 233 MPD C3 C N N 234 MPD C4 C N S 235 MPD O4 O N N 236 MPD C5 C N N 237 MPD H11 H N N 238 MPD H12 H N N 239 MPD H13 H N N 240 MPD HO2 H N N 241 MPD HM1 H N N 242 MPD HM2 H N N 243 MPD HM3 H N N 244 MPD H31 H N N 245 MPD H32 H N N 246 MPD H4 H N N 247 MPD HO4 H N N 248 MPD H51 H N N 249 MPD H52 H N N 250 MPD H53 H N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 SR SR SR N N 306 THR N N N N 307 THR CA C N S 308 THR C C N N 309 THR O O N N 310 THR CB C N R 311 THR OG1 O N N 312 THR CG2 C N N 313 THR OXT O N N 314 THR H H N N 315 THR H2 H N N 316 THR HA H N N 317 THR HB H N N 318 THR HG1 H N N 319 THR HG21 H N N 320 THR HG22 H N N 321 THR HG23 H N N 322 THR HXT H N N 323 TYR N N N N 324 TYR CA C N S 325 TYR C C N N 326 TYR O O N N 327 TYR CB C N N 328 TYR CG C Y N 329 TYR CD1 C Y N 330 TYR CD2 C Y N 331 TYR CE1 C Y N 332 TYR CE2 C Y N 333 TYR CZ C Y N 334 TYR OH O N N 335 TYR OXT O N N 336 TYR H H N N 337 TYR H2 H N N 338 TYR HA H N N 339 TYR HB2 H N N 340 TYR HB3 H N N 341 TYR HD1 H N N 342 TYR HD2 H N N 343 TYR HE1 H N N 344 TYR HE2 H N N 345 TYR HH H N N 346 TYR HXT H N N 347 VAL N N N N 348 VAL CA C N S 349 VAL C C N N 350 VAL O O N N 351 VAL CB C N N 352 VAL CG1 C N N 353 VAL CG2 C N N 354 VAL OXT O N N 355 VAL H H N N 356 VAL H2 H N N 357 VAL HA H N N 358 VAL HB H N N 359 VAL HG11 H N N 360 VAL HG12 H N N 361 VAL HG13 H N N 362 VAL HG21 H N N 363 VAL HG22 H N N 364 VAL HG23 H N N 365 VAL HXT H N N 366 WNU C10 C N N 367 WNU N12 N N N 368 WNU C13 C N N 369 WNU C17 C Y N 370 WNU C20 C Y N 371 WNU C21 C Y N 372 WNU C22 C Y N 373 WNU C24 C Y N 374 WNU CL1 CL N N 375 WNU P28 P N N 376 WNU C01 C N N 377 WNU C02 C N R 378 WNU C03 C N S 379 WNU C04 C N R 380 WNU C05 C N R 381 WNU O06 O N N 382 WNU N07 N Y N 383 WNU C08 C Y N 384 WNU C09 C Y N 385 WNU O11 O N N 386 WNU N14 N N N 387 WNU N15 N N N 388 WNU N16 N Y N 389 WNU S18 S N N 390 WNU C19 C Y N 391 WNU C23 C Y N 392 WNU O26 O N N 393 WNU O27 O N N 394 WNU O29 O N N 395 WNU O30 O N N 396 WNU O31 O N N 397 WNU H121 H N N 398 WNU H201 H N N 399 WNU H211 H N N 400 WNU H241 H N N 401 WNU H012 H N N 402 WNU H011 H N N 403 WNU H021 H N N 404 WNU H031 H N N 405 WNU H041 H N N 406 WNU H051 H N N 407 WNU H152 H N N 408 WNU H151 H N N 409 WNU H231 H N N 410 WNU H261 H N N 411 WNU H1 H N N 412 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DOD O D1 sing N N 83 DOD O D2 sing N N 84 GLN N CA sing N N 85 GLN N H sing N N 86 GLN N H2 sing N N 87 GLN CA C sing N N 88 GLN CA CB sing N N 89 GLN CA HA sing N N 90 GLN C O doub N N 91 GLN C OXT sing N N 92 GLN CB CG sing N N 93 GLN CB HB2 sing N N 94 GLN CB HB3 sing N N 95 GLN CG CD sing N N 96 GLN CG HG2 sing N N 97 GLN CG HG3 sing N N 98 GLN CD OE1 doub N N 99 GLN CD NE2 sing N N 100 GLN NE2 HE21 sing N N 101 GLN NE2 HE22 sing N N 102 GLN OXT HXT sing N N 103 GLU N CA sing N N 104 GLU N H sing N N 105 GLU N H2 sing N N 106 GLU CA C sing N N 107 GLU CA CB sing N N 108 GLU CA HA sing N N 109 GLU C O doub N N 110 GLU C OXT sing N N 111 GLU CB CG sing N N 112 GLU CB HB2 sing N N 113 GLU CB HB3 sing N N 114 GLU CG CD sing N N 115 GLU CG HG2 sing N N 116 GLU CG HG3 sing N N 117 GLU CD OE1 doub N N 118 GLU CD OE2 sing N N 119 GLU OE2 HE2 sing N N 120 GLU OXT HXT sing N N 121 GLY N CA sing N N 122 GLY N H sing N N 123 GLY N H2 sing N N 124 GLY CA C sing N N 125 GLY CA HA2 sing N N 126 GLY CA HA3 sing N N 127 GLY C O doub N N 128 GLY C OXT sing N N 129 GLY OXT HXT sing N N 130 HIS N CA sing N N 131 HIS N H sing N N 132 HIS N H2 sing N N 133 HIS CA C sing N N 134 HIS CA CB sing N N 135 HIS CA HA sing N N 136 HIS C O doub N N 137 HIS C OXT sing N N 138 HIS CB CG sing N N 139 HIS CB HB2 sing N N 140 HIS CB HB3 sing N N 141 HIS CG ND1 sing Y N 142 HIS CG CD2 doub Y N 143 HIS ND1 CE1 doub Y N 144 HIS ND1 HD1 sing N N 145 HIS CD2 NE2 sing Y N 146 HIS CD2 HD2 sing N N 147 HIS CE1 NE2 sing Y N 148 HIS CE1 HE1 sing N N 149 HIS NE2 HE2 sing N N 150 HIS OXT HXT sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MPD C1 C2 sing N N 218 MPD C1 H11 sing N N 219 MPD C1 H12 sing N N 220 MPD C1 H13 sing N N 221 MPD C2 O2 sing N N 222 MPD C2 CM sing N N 223 MPD C2 C3 sing N N 224 MPD O2 HO2 sing N N 225 MPD CM HM1 sing N N 226 MPD CM HM2 sing N N 227 MPD CM HM3 sing N N 228 MPD C3 C4 sing N N 229 MPD C3 H31 sing N N 230 MPD C3 H32 sing N N 231 MPD C4 O4 sing N N 232 MPD C4 C5 sing N N 233 MPD C4 H4 sing N N 234 MPD O4 HO4 sing N N 235 MPD C5 H51 sing N N 236 MPD C5 H52 sing N N 237 MPD C5 H53 sing N N 238 PHE N CA sing N N 239 PHE N H sing N N 240 PHE N H2 sing N N 241 PHE CA C sing N N 242 PHE CA CB sing N N 243 PHE CA HA sing N N 244 PHE C O doub N N 245 PHE C OXT sing N N 246 PHE CB CG sing N N 247 PHE CB HB2 sing N N 248 PHE CB HB3 sing N N 249 PHE CG CD1 doub Y N 250 PHE CG CD2 sing Y N 251 PHE CD1 CE1 sing Y N 252 PHE CD1 HD1 sing N N 253 PHE CD2 CE2 doub Y N 254 PHE CD2 HD2 sing N N 255 PHE CE1 CZ doub Y N 256 PHE CE1 HE1 sing N N 257 PHE CE2 CZ sing Y N 258 PHE CE2 HE2 sing N N 259 PHE CZ HZ sing N N 260 PHE OXT HXT sing N N 261 PRO N CA sing N N 262 PRO N CD sing N N 263 PRO N H sing N N 264 PRO CA C sing N N 265 PRO CA CB sing N N 266 PRO CA HA sing N N 267 PRO C O doub N N 268 PRO C OXT sing N N 269 PRO CB CG sing N N 270 PRO CB HB2 sing N N 271 PRO CB HB3 sing N N 272 PRO CG CD sing N N 273 PRO CG HG2 sing N N 274 PRO CG HG3 sing N N 275 PRO CD HD2 sing N N 276 PRO CD HD3 sing N N 277 PRO OXT HXT sing N N 278 SER N CA sing N N 279 SER N H sing N N 280 SER N H2 sing N N 281 SER CA C sing N N 282 SER CA CB sing N N 283 SER CA HA sing N N 284 SER C O doub N N 285 SER C OXT sing N N 286 SER CB OG sing N N 287 SER CB HB2 sing N N 288 SER CB HB3 sing N N 289 SER OG HG sing N N 290 SER OXT HXT sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TYR N CA sing N N 308 TYR N H sing N N 309 TYR N H2 sing N N 310 TYR CA C sing N N 311 TYR CA CB sing N N 312 TYR CA HA sing N N 313 TYR C O doub N N 314 TYR C OXT sing N N 315 TYR CB CG sing N N 316 TYR CB HB2 sing N N 317 TYR CB HB3 sing N N 318 TYR CG CD1 doub Y N 319 TYR CG CD2 sing Y N 320 TYR CD1 CE1 sing Y N 321 TYR CD1 HD1 sing N N 322 TYR CD2 CE2 doub Y N 323 TYR CD2 HD2 sing N N 324 TYR CE1 CZ doub Y N 325 TYR CE1 HE1 sing N N 326 TYR CE2 CZ sing Y N 327 TYR CE2 HE2 sing N N 328 TYR CZ OH sing N N 329 TYR OH HH sing N N 330 TYR OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 WNU O29 P28 doub N N 350 WNU CL1 C22 sing N N 351 WNU P28 O27 sing N N 352 WNU P28 O31 sing N N 353 WNU P28 O30 sing N N 354 WNU O27 C03 sing N N 355 WNU O26 C04 sing N N 356 WNU C21 C22 doub Y N 357 WNU C21 C20 sing Y N 358 WNU C22 C23 sing Y N 359 WNU O30 C01 sing N N 360 WNU C03 C04 sing N N 361 WNU C03 C02 sing N N 362 WNU C04 C05 sing N N 363 WNU C20 C19 doub Y N 364 WNU C23 C24 doub Y N 365 WNU C02 C01 sing N N 366 WNU C02 O06 sing N N 367 WNU C05 O06 sing N N 368 WNU C05 N07 sing N N 369 WNU C19 C24 sing Y N 370 WNU C19 S18 sing N N 371 WNU N14 C08 sing N N 372 WNU N14 C13 doub N N 373 WNU N07 C08 sing Y N 374 WNU N07 C17 sing Y N 375 WNU N15 C13 sing N N 376 WNU C08 C09 doub Y N 377 WNU S18 C17 sing N N 378 WNU C13 N12 sing N N 379 WNU C17 N16 doub Y N 380 WNU C09 N16 sing Y N 381 WNU C09 C10 sing N N 382 WNU N12 C10 sing N N 383 WNU C10 O11 doub N N 384 WNU N12 H121 sing N N 385 WNU C20 H201 sing N N 386 WNU C21 H211 sing N N 387 WNU C24 H241 sing N N 388 WNU C01 H012 sing N N 389 WNU C01 H011 sing N N 390 WNU C02 H021 sing N N 391 WNU C03 H031 sing N N 392 WNU C04 H041 sing N N 393 WNU C05 H051 sing N N 394 WNU N15 H152 sing N N 395 WNU N15 H151 sing N N 396 WNU C23 H231 sing N N 397 WNU O26 H261 sing N N 398 WNU O31 H1 sing N N 399 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R01 GM090161' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code 5BV6 _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.details ? # loop_ _refine_funct_minimized.pdbx_refine_id _refine_funct_minimized.type 'NEUTRON DIFFRACTION' 'Joint X-ray/neutron ML' 'X-RAY DIFFRACTION' 'Joint X-ray/neutron ML' # _atom_sites.entry_id 6BQ8 _atom_sites.fract_transf_matrix[1][1] 0.022910 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019493 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014663 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL D H N O P S SR # loop_