data_6C1J # _entry.id 6C1J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6C1J pdb_00006c1j 10.2210/pdb6c1j/pdb WWPDB D_1000231927 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6C1J _pdbx_database_status.recvd_initial_deposition_date 2018-01-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yabukarski, F.' 1 ? 'Pinney, M.M.' 2 ? 'Herschlag, D.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Am. Chem. Soc.' _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 140 _citation.language ? _citation.page_first 9827 _citation.page_last 9843 _citation.title 'Structural Coupling Throughout the Active Site Hydrogen Bond Networks of Ketosteroid Isomerase and Photoactive Yellow Protein.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.8b01596 _citation.pdbx_database_id_PubMed 29990421 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pinney, M.M.' 1 ? primary 'Natarajan, A.' 2 ? primary 'Yabukarski, F.' 3 ? primary 'Sanchez, D.M.' 4 ? primary 'Liu, F.' 5 ? primary 'Liang, R.' 6 ? primary 'Doukov, T.' 7 ? primary 'Schwans, J.P.' 8 ? primary 'Martinez, T.J.' 9 ? primary 'Herschlag, D.' 10 ? # _cell.length_a 35.902 _cell.length_b 94.998 _cell.length_c 72.910 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 6C1J _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.entry_id 6C1J _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Steroid Delta-isomerase' 14515.515 1 5.3.3.1 'Y32F, Y57F, D40N' ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn 3,4-dinitrophenol 184.106 1 ? ? ? ? 5 water nat water 18.015 169 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Delta(5)-3-ketosteroid isomerase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNLPTAQEVQGLMARYIELVDVGDIEAIVQMFADDATVENPFGQPPIHGREQIAAFFRQGLGGGKVRACLTGPVRASHNG CGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSVREPQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MNLPTAQEVQGLMARYIELVDVGDIEAIVQMFADDATVENPFGQPPIHGREQIAAFFRQGLGGGKVRACLTGPVRASHNG CGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSVREPQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 LEU n 1 4 PRO n 1 5 THR n 1 6 ALA n 1 7 GLN n 1 8 GLU n 1 9 VAL n 1 10 GLN n 1 11 GLY n 1 12 LEU n 1 13 MET n 1 14 ALA n 1 15 ARG n 1 16 TYR n 1 17 ILE n 1 18 GLU n 1 19 LEU n 1 20 VAL n 1 21 ASP n 1 22 VAL n 1 23 GLY n 1 24 ASP n 1 25 ILE n 1 26 GLU n 1 27 ALA n 1 28 ILE n 1 29 VAL n 1 30 GLN n 1 31 MET n 1 32 PHE n 1 33 ALA n 1 34 ASP n 1 35 ASP n 1 36 ALA n 1 37 THR n 1 38 VAL n 1 39 GLU n 1 40 ASN n 1 41 PRO n 1 42 PHE n 1 43 GLY n 1 44 GLN n 1 45 PRO n 1 46 PRO n 1 47 ILE n 1 48 HIS n 1 49 GLY n 1 50 ARG n 1 51 GLU n 1 52 GLN n 1 53 ILE n 1 54 ALA n 1 55 ALA n 1 56 PHE n 1 57 PHE n 1 58 ARG n 1 59 GLN n 1 60 GLY n 1 61 LEU n 1 62 GLY n 1 63 GLY n 1 64 GLY n 1 65 LYS n 1 66 VAL n 1 67 ARG n 1 68 ALA n 1 69 CYS n 1 70 LEU n 1 71 THR n 1 72 GLY n 1 73 PRO n 1 74 VAL n 1 75 ARG n 1 76 ALA n 1 77 SER n 1 78 HIS n 1 79 ASN n 1 80 GLY n 1 81 CYS n 1 82 GLY n 1 83 ALA n 1 84 MET n 1 85 PRO n 1 86 PHE n 1 87 ARG n 1 88 VAL n 1 89 GLU n 1 90 MET n 1 91 VAL n 1 92 TRP n 1 93 ASN n 1 94 GLY n 1 95 GLN n 1 96 PRO n 1 97 CYS n 1 98 ALA n 1 99 LEU n 1 100 ASP n 1 101 VAL n 1 102 ILE n 1 103 ASP n 1 104 VAL n 1 105 MET n 1 106 ARG n 1 107 PHE n 1 108 ASP n 1 109 GLU n 1 110 HIS n 1 111 GLY n 1 112 ARG n 1 113 ILE n 1 114 GLN n 1 115 THR n 1 116 MET n 1 117 GLN n 1 118 ALA n 1 119 TYR n 1 120 TRP n 1 121 SER n 1 122 GLU n 1 123 VAL n 1 124 ASN n 1 125 LEU n 1 126 SER n 1 127 VAL n 1 128 ARG n 1 129 GLU n 1 130 PRO n 1 131 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 131 _entity_src_gen.gene_src_common_name 'Arthrobacter siderocapsulatus' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ksi _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas putida' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 303 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SDIS_PSEPU _struct_ref.pdbx_db_accession P07445 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNG CGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSVREPQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6C1J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 131 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07445 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 131 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6C1J PHE A 32 ? UNP P07445 TYR 32 'engineered mutation' 32 1 1 6C1J ASN A 40 ? UNP P07445 ASP 40 'engineered mutation' 40 2 1 6C1J PHE A 57 ? UNP P07445 TYR 57 'engineered mutation' 57 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DNX non-polymer . 3,4-dinitrophenol ? 'C6 H4 N2 O5' 184.106 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6C1J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details 'room temperature' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '18-22 % PEG 3350, 0.2 M magnesium chloride, 0.04 M potassium phosphate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.88558 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.88558 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.entry_id 6C1J _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 36.460 _reflns.d_resolution_high 1.060 _reflns.number_obs 55563 _reflns.number_all ? _reflns.percent_possible_obs 98.500 _reflns.pdbx_Rmerge_I_obs 0.065 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 17.600 _reflns.B_iso_Wilson_estimate 10.580 _reflns.pdbx_redundancy 11.200 _reflns.pdbx_Rrim_I_all 0.068 _reflns.pdbx_Rpim_I_all 0.020 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_number_measured_all 623131 _reflns.pdbx_scaling_rejects 321 _reflns.pdbx_chi_squared ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.details ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 1.060 1.080 ? 12414 2119 ? 1.043 ? ? ? 5.900 ? 1.700 ? ? ? ? ? ? 76.700 1.134 0.425 0.676 1 2 5.820 36.460 ? 4631 408 ? 0.045 ? ? ? 11.400 ? 47.800 ? ? ? ? ? ? 99.700 0.047 0.013 0.999 # _refine.entry_id 6C1J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 1.0630 _refine.ls_d_res_low 36.4550 _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.4400 _refine.ls_number_reflns_obs 55510 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1301 _refine.ls_R_factor_R_work 0.1289 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.1538 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_number_reflns_R_free 2778 _refine.ls_number_reflns_R_work 52732 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 17.5422 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.0700 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 3FZW _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 69.870 _refine.B_iso_min 6.600 _refine.pdbx_overall_phase_error 12.6500 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.0630 _refine_hist.d_res_low 36.4550 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 190 _refine_hist.number_atoms_total 1202 _refine_hist.pdbx_number_residues_total 127 _refine_hist.pdbx_B_iso_mean_ligand 18.70 _refine_hist.pdbx_B_iso_mean_solvent 29.91 _refine_hist.pdbx_number_atoms_protein 978 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 1593 0.007 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 2202 0.968 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 216 0.076 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 321 0.006 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 629 15.299 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_obs 1.0635 1.0818 20 76.0000 2028 . 0.2551 0.2649 . 118 0.0000 2146 . 'X-RAY DIFFRACTION' . 1.0818 1.1015 20 98.0000 2583 . 0.1870 0.2085 . 127 0.0000 2710 . 'X-RAY DIFFRACTION' . 1.1015 1.1227 20 99.0000 2647 . 0.1587 0.1673 . 125 0.0000 2772 . 'X-RAY DIFFRACTION' . 1.1227 1.1456 20 100.0000 2622 . 0.1336 0.1591 . 126 0.0000 2748 . 'X-RAY DIFFRACTION' . 1.1456 1.1705 20 100.0000 2621 . 0.1271 0.1440 . 140 0.0000 2761 . 'X-RAY DIFFRACTION' . 1.1705 1.1977 20 100.0000 2671 . 0.1219 0.1392 . 155 0.0000 2826 . 'X-RAY DIFFRACTION' . 1.1977 1.2277 20 100.0000 2627 . 0.1237 0.1400 . 132 0.0000 2759 . 'X-RAY DIFFRACTION' . 1.2277 1.2609 20 100.0000 2638 . 0.1174 0.1296 . 144 0.0000 2782 . 'X-RAY DIFFRACTION' . 1.2609 1.2980 20 100.0000 2644 . 0.1125 0.1458 . 145 0.0000 2789 . 'X-RAY DIFFRACTION' . 1.2980 1.3399 20 100.0000 2664 . 0.1064 0.1481 . 131 0.0000 2795 . 'X-RAY DIFFRACTION' . 1.3399 1.3878 20 100.0000 2665 . 0.1098 0.1265 . 144 0.0000 2809 . 'X-RAY DIFFRACTION' . 1.3878 1.4433 20 100.0000 2646 . 0.1075 0.1335 . 153 0.0000 2799 . 'X-RAY DIFFRACTION' . 1.4433 1.5090 20 100.0000 2648 . 0.1033 0.1154 . 148 0.0000 2796 . 'X-RAY DIFFRACTION' . 1.5090 1.5886 20 100.0000 2671 . 0.1028 0.1261 . 146 0.0000 2817 . 'X-RAY DIFFRACTION' . 1.5886 1.6881 20 100.0000 2659 . 0.1100 0.1348 . 156 0.0000 2815 . 'X-RAY DIFFRACTION' . 1.6881 1.8185 20 100.0000 2695 . 0.1130 0.1363 . 131 0.0000 2826 . 'X-RAY DIFFRACTION' . 1.8185 2.0014 20 100.0000 2707 . 0.1170 0.1347 . 127 0.0000 2834 . 'X-RAY DIFFRACTION' . 2.0014 2.2910 20 100.0000 2694 . 0.1228 0.1357 . 140 0.0000 2834 . 'X-RAY DIFFRACTION' . 2.2910 2.8863 20 100.0000 2751 . 0.1348 0.1671 . 131 0.0000 2882 . 'X-RAY DIFFRACTION' . 2.8863 36.4764 20 100.0000 2851 . 0.1490 0.1837 . 159 0.0000 3010 . 'X-RAY DIFFRACTION' . # _struct.entry_id 6C1J _struct.title 'Crystal Structure of Ketosteroid Isomerase Y32F/Y57F/D40N mutant from Pseudomonas Putida (pKSI) bound to 3,4-dinitrophenol' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6C1J _struct_keywords.text 'ENZYME, ISOMERASE' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 5 ? GLY A 23 ? THR A 5 GLY A 23 1 ? 19 HELX_P HELX_P2 AA2 ASP A 24 ? MET A 31 ? ASP A 24 MET A 31 1 ? 8 HELX_P HELX_P3 AA3 GLY A 49 ? GLY A 62 ? GLY A 49 GLY A 62 1 ? 14 HELX_P HELX_P4 AA4 SER A 121 ? VAL A 123 ? SER A 121 VAL A 123 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 18 OE1 A ? ? 1_555 C MG . MG ? ? A GLU 18 A MG 202 1_555 ? ? ? ? ? ? ? 2.926 ? ? metalc2 metalc ? ? A ASP 21 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 21 A MG 202 1_555 ? ? ? ? ? ? ? 2.132 ? ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 201 A HOH 323 1_555 ? ? ? ? ? ? ? 2.041 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 201 A HOH 339 1_555 ? ? ? ? ? ? ? 2.131 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 201 A HOH 344 1_555 ? ? ? ? ? ? ? 2.039 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 201 A HOH 392 1_555 ? ? ? ? ? ? ? 2.153 ? ? metalc7 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 201 A HOH 435 1_555 ? ? ? ? ? ? ? 2.198 ? ? metalc8 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 201 A HOH 453 1_555 ? ? ? ? ? ? ? 2.043 ? ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 202 A HOH 303 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc10 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 202 A HOH 308 1_555 ? ? ? ? ? ? ? 1.889 ? ? metalc11 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O B ? A MG 202 A HOH 363 1_555 ? ? ? ? ? ? ? 2.095 ? ? metalc12 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 202 A HOH 387 1_555 ? ? ? ? ? ? ? 2.161 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 40 A . ? ASN 40 A PRO 41 A ? PRO 41 A 1 -2.37 2 ASN 40 A . ? ASN 40 A PRO 41 A ? PRO 41 A 1 -16.49 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 47 ? HIS A 48 ? ILE A 47 HIS A 48 AA1 2 PHE A 32 ? GLU A 39 ? PHE A 32 GLU A 39 AA1 3 ILE A 113 ? TYR A 119 ? ILE A 113 TYR A 119 AA1 4 GLN A 95 ? PHE A 107 ? GLN A 95 PHE A 107 AA1 5 CYS A 81 ? TRP A 92 ? CYS A 81 TRP A 92 AA1 6 ARG A 75 ? ALA A 76 ? ARG A 75 ALA A 76 AA2 1 ARG A 67 ? LEU A 70 ? ARG A 67 LEU A 70 AA2 2 CYS A 81 ? TRP A 92 ? CYS A 81 TRP A 92 AA2 3 GLN A 95 ? PHE A 107 ? GLN A 95 PHE A 107 AA2 4 LEU A 125 ? SER A 126 ? LEU A 125 SER A 126 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 47 ? O ILE A 47 N VAL A 38 ? N VAL A 38 AA1 2 3 N ALA A 33 ? N ALA A 33 O ILE A 113 ? O ILE A 113 AA1 3 4 O TYR A 119 ? O TYR A 119 N ILE A 102 ? N ILE A 102 AA1 4 5 O CYS A 97 ? O CYS A 97 N MET A 90 ? N MET A 90 AA1 5 6 O ALA A 83 ? O ALA A 83 N ARG A 75 ? N ARG A 75 AA2 1 2 N ARG A 67 ? N ARG A 67 O GLU A 89 ? O GLU A 89 AA2 2 3 N MET A 90 ? N MET A 90 O CYS A 97 ? O CYS A 97 AA2 3 4 N ALA A 98 ? N ALA A 98 O SER A 126 ? O SER A 126 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 201 ? 6 'binding site for residue MG A 201' AC2 Software A MG 202 ? 6 'binding site for residue MG A 202' AC3 Software A CL 203 ? 6 'binding site for residue CL A 203' AC4 Software A DNX 204 ? 11 'binding site for residue DNX A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HOH F . ? HOH A 323 . ? 1_555 ? 2 AC1 6 HOH F . ? HOH A 339 . ? 1_555 ? 3 AC1 6 HOH F . ? HOH A 344 . ? 1_555 ? 4 AC1 6 HOH F . ? HOH A 392 . ? 1_555 ? 5 AC1 6 HOH F . ? HOH A 435 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 453 . ? 1_555 ? 7 AC2 6 GLU A 18 ? GLU A 18 . ? 1_555 ? 8 AC2 6 ASP A 21 ? ASP A 21 . ? 1_555 ? 9 AC2 6 HOH F . ? HOH A 303 . ? 1_555 ? 10 AC2 6 HOH F . ? HOH A 308 . ? 1_555 ? 11 AC2 6 HOH F . ? HOH A 363 . ? 1_555 ? 12 AC2 6 HOH F . ? HOH A 387 . ? 1_555 ? 13 AC3 6 THR A 71 ? THR A 71 . ? 1_555 ? 14 AC3 6 GLY A 72 ? GLY A 72 . ? 4_555 ? 15 AC3 6 ARG A 75 ? ARG A 75 . ? 4_555 ? 16 AC3 6 HOH F . ? HOH A 362 . ? 1_555 ? 17 AC3 6 HOH F . ? HOH A 428 . ? 4_555 ? 18 AC3 6 HOH F . ? HOH A 428 . ? 1_555 ? 19 AC4 11 TYR A 16 ? TYR A 16 . ? 1_555 ? 20 AC4 11 ASN A 40 ? ASN A 40 . ? 1_555 ? 21 AC4 11 PHE A 56 ? PHE A 56 . ? 1_555 ? 22 AC4 11 PHE A 57 ? PHE A 57 . ? 1_555 ? 23 AC4 11 LEU A 61 ? LEU A 61 . ? 1_555 ? 24 AC4 11 PHE A 86 ? PHE A 86 . ? 1_555 ? 25 AC4 11 ASP A 103 ? ASP A 103 . ? 1_555 ? 26 AC4 11 MET A 116 ? MET A 116 . ? 1_555 ? 27 AC4 11 HOH F . ? HOH A 310 . ? 3_455 ? 28 AC4 11 HOH F . ? HOH A 400 . ? 3_455 ? 29 AC4 11 HOH F . ? HOH A 425 . ? 3_455 ? # _atom_sites.entry_id 6C1J _atom_sites.fract_transf_matrix[1][1] 0.027854 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010527 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013716 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL H MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 MET 116 116 116 MET MET A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 TRP 120 120 120 TRP TRP A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ARG 128 128 ? ? ? A . n A 1 129 GLU 129 129 ? ? ? A . n A 1 130 PRO 130 130 ? ? ? A . n A 1 131 GLN 131 131 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 201 1 MG MG A . C 2 MG 1 202 2 MG MG A . D 3 CL 1 203 1 CL CL A . E 4 DNX 1 204 1 DNX LIG A . F 5 HOH 1 301 61 HOH HOH A . F 5 HOH 2 302 86 HOH HOH A . F 5 HOH 3 303 139 HOH HOH A . F 5 HOH 4 304 207 HOH HOH A . F 5 HOH 5 305 113 HOH HOH A . F 5 HOH 6 306 67 HOH HOH A . F 5 HOH 7 307 85 HOH HOH A . F 5 HOH 8 308 49 HOH HOH A . F 5 HOH 9 309 18 HOH HOH A . F 5 HOH 10 310 140 HOH HOH A . F 5 HOH 11 311 25 HOH HOH A . F 5 HOH 12 312 51 HOH HOH A . F 5 HOH 13 313 64 HOH HOH A . F 5 HOH 14 314 158 HOH HOH A . F 5 HOH 15 315 110 HOH HOH A . F 5 HOH 16 316 82 HOH HOH A . F 5 HOH 17 317 12 HOH HOH A . F 5 HOH 18 318 17 HOH HOH A . F 5 HOH 19 319 14 HOH HOH A . F 5 HOH 20 320 6 HOH HOH A . F 5 HOH 21 321 160 HOH HOH A . F 5 HOH 22 322 56 HOH HOH A . F 5 HOH 23 323 39 HOH HOH A . F 5 HOH 24 324 75 HOH HOH A . F 5 HOH 25 325 50 HOH HOH A . F 5 HOH 26 326 234 HOH HOH A . F 5 HOH 27 327 24 HOH HOH A . F 5 HOH 28 328 209 HOH HOH A . F 5 HOH 29 329 2 HOH HOH A . F 5 HOH 30 330 36 HOH HOH A . F 5 HOH 31 331 5 HOH HOH A . F 5 HOH 32 332 37 HOH HOH A . F 5 HOH 33 333 20 HOH HOH A . F 5 HOH 34 334 77 HOH HOH A . F 5 HOH 35 335 143 HOH HOH A . F 5 HOH 36 336 53 HOH HOH A . F 5 HOH 37 337 127 HOH HOH A . F 5 HOH 38 338 21 HOH HOH A . F 5 HOH 39 339 137 HOH HOH A . F 5 HOH 40 340 33 HOH HOH A . F 5 HOH 41 341 9 HOH HOH A . F 5 HOH 42 342 58 HOH HOH A . F 5 HOH 43 343 41 HOH HOH A . F 5 HOH 44 344 66 HOH HOH A . F 5 HOH 45 345 57 HOH HOH A . F 5 HOH 46 346 128 HOH HOH A . F 5 HOH 47 347 19 HOH HOH A . F 5 HOH 48 348 116 HOH HOH A . F 5 HOH 49 349 42 HOH HOH A . F 5 HOH 50 350 60 HOH HOH A . F 5 HOH 51 351 7 HOH HOH A . F 5 HOH 52 352 91 HOH HOH A . F 5 HOH 53 353 215 HOH HOH A . F 5 HOH 54 354 16 HOH HOH A . F 5 HOH 55 355 94 HOH HOH A . F 5 HOH 56 356 13 HOH HOH A . F 5 HOH 57 357 101 HOH HOH A . F 5 HOH 58 358 11 HOH HOH A . F 5 HOH 59 359 26 HOH HOH A . F 5 HOH 60 360 23 HOH HOH A . F 5 HOH 61 361 220 HOH HOH A . F 5 HOH 62 362 176 HOH HOH A . F 5 HOH 63 363 196 HOH HOH A . F 5 HOH 64 364 44 HOH HOH A . F 5 HOH 65 365 59 HOH HOH A . F 5 HOH 66 366 30 HOH HOH A . F 5 HOH 67 367 206 HOH HOH A . F 5 HOH 68 368 119 HOH HOH A . F 5 HOH 69 369 198 HOH HOH A . F 5 HOH 70 370 229 HOH HOH A . F 5 HOH 71 371 83 HOH HOH A . F 5 HOH 72 372 35 HOH HOH A . F 5 HOH 73 373 34 HOH HOH A . F 5 HOH 74 374 69 HOH HOH A . F 5 HOH 75 375 165 HOH HOH A . F 5 HOH 76 376 104 HOH HOH A . F 5 HOH 77 377 29 HOH HOH A . F 5 HOH 78 378 136 HOH HOH A . F 5 HOH 79 379 28 HOH HOH A . F 5 HOH 80 380 177 HOH HOH A . F 5 HOH 81 381 238 HOH HOH A . F 5 HOH 82 382 45 HOH HOH A . F 5 HOH 83 383 132 HOH HOH A . F 5 HOH 84 384 175 HOH HOH A . F 5 HOH 85 385 106 HOH HOH A . F 5 HOH 86 386 65 HOH HOH A . F 5 HOH 87 387 201 HOH HOH A . F 5 HOH 88 388 93 HOH HOH A . F 5 HOH 89 389 145 HOH HOH A . F 5 HOH 90 390 52 HOH HOH A . F 5 HOH 91 391 213 HOH HOH A . F 5 HOH 92 392 68 HOH HOH A . F 5 HOH 93 393 205 HOH HOH A . F 5 HOH 94 394 43 HOH HOH A . F 5 HOH 95 395 98 HOH HOH A . F 5 HOH 96 396 118 HOH HOH A . F 5 HOH 97 397 216 HOH HOH A . F 5 HOH 98 398 239 HOH HOH A . F 5 HOH 99 399 240 HOH HOH A . F 5 HOH 100 400 90 HOH HOH A . F 5 HOH 101 401 73 HOH HOH A . F 5 HOH 102 402 92 HOH HOH A . F 5 HOH 103 403 155 HOH HOH A . F 5 HOH 104 404 63 HOH HOH A . F 5 HOH 105 405 124 HOH HOH A . F 5 HOH 106 406 144 HOH HOH A . F 5 HOH 107 407 153 HOH HOH A . F 5 HOH 108 408 95 HOH HOH A . F 5 HOH 109 409 131 HOH HOH A . F 5 HOH 110 410 222 HOH HOH A . F 5 HOH 111 411 126 HOH HOH A . F 5 HOH 112 412 150 HOH HOH A . F 5 HOH 113 413 108 HOH HOH A . F 5 HOH 114 414 31 HOH HOH A . F 5 HOH 115 415 72 HOH HOH A . F 5 HOH 116 416 22 HOH HOH A . F 5 HOH 117 417 187 HOH HOH A . F 5 HOH 118 418 172 HOH HOH A . F 5 HOH 119 419 138 HOH HOH A . F 5 HOH 120 420 236 HOH HOH A . F 5 HOH 121 421 159 HOH HOH A . F 5 HOH 122 422 121 HOH HOH A . F 5 HOH 123 423 129 HOH HOH A . F 5 HOH 124 424 200 HOH HOH A . F 5 HOH 125 425 81 HOH HOH A . F 5 HOH 126 426 46 HOH HOH A . F 5 HOH 127 427 243 HOH HOH A . F 5 HOH 128 428 32 HOH HOH A . F 5 HOH 129 429 218 HOH HOH A . F 5 HOH 130 430 157 HOH HOH A . F 5 HOH 131 431 97 HOH HOH A . F 5 HOH 132 432 194 HOH HOH A . F 5 HOH 133 433 141 HOH HOH A . F 5 HOH 134 434 99 HOH HOH A . F 5 HOH 135 435 87 HOH HOH A . F 5 HOH 136 436 242 HOH HOH A . F 5 HOH 137 437 214 HOH HOH A . F 5 HOH 138 438 178 HOH HOH A . F 5 HOH 139 439 169 HOH HOH A . F 5 HOH 140 440 47 HOH HOH A . F 5 HOH 141 441 152 HOH HOH A . F 5 HOH 142 442 235 HOH HOH A . F 5 HOH 143 443 197 HOH HOH A . F 5 HOH 144 444 88 HOH HOH A . F 5 HOH 145 445 228 HOH HOH A . F 5 HOH 146 446 223 HOH HOH A . F 5 HOH 147 447 210 HOH HOH A . F 5 HOH 148 448 74 HOH HOH A . F 5 HOH 149 449 237 HOH HOH A . F 5 HOH 150 450 117 HOH HOH A . F 5 HOH 151 451 123 HOH HOH A . F 5 HOH 152 452 105 HOH HOH A . F 5 HOH 153 453 84 HOH HOH A . F 5 HOH 154 454 219 HOH HOH A . F 5 HOH 155 455 162 HOH HOH A . F 5 HOH 156 456 232 HOH HOH A . F 5 HOH 157 457 241 HOH HOH A . F 5 HOH 158 458 204 HOH HOH A . F 5 HOH 159 459 151 HOH HOH A . F 5 HOH 160 460 79 HOH HOH A . F 5 HOH 161 461 233 HOH HOH A . F 5 HOH 162 462 70 HOH HOH A . F 5 HOH 163 463 111 HOH HOH A . F 5 HOH 164 464 71 HOH HOH A . F 5 HOH 165 465 186 HOH HOH A . F 5 HOH 166 466 221 HOH HOH A . F 5 HOH 167 467 161 HOH HOH A . F 5 HOH 168 468 154 HOH HOH A . F 5 HOH 169 469 225 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2720 ? 1 MORE -58 ? 1 'SSA (A^2)' 11970 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 428 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 A A GLU 18 ? A GLU 18 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 130.6 ? 2 OE1 A A GLU 18 ? A GLU 18 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 303 ? 1_555 127.6 ? 3 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 303 ? 1_555 82.1 ? 4 OE1 A A GLU 18 ? A GLU 18 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 308 ? 1_555 54.4 ? 5 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 308 ? 1_555 92.6 ? 6 O ? F HOH . ? A HOH 303 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 308 ? 1_555 91.0 ? 7 OE1 A A GLU 18 ? A GLU 18 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O B F HOH . ? A HOH 363 ? 1_555 60.4 ? 8 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O B F HOH . ? A HOH 363 ? 1_555 87.0 ? 9 O ? F HOH . ? A HOH 303 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O B F HOH . ? A HOH 363 ? 1_555 169.1 ? 10 O ? F HOH . ? A HOH 308 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O B F HOH . ? A HOH 363 ? 1_555 89.1 ? 11 OE1 A A GLU 18 ? A GLU 18 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 387 ? 1_555 123.4 ? 12 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 387 ? 1_555 85.4 ? 13 O ? F HOH . ? A HOH 303 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 387 ? 1_555 94.3 ? 14 O ? F HOH . ? A HOH 308 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 387 ? 1_555 174.0 ? 15 O B F HOH . ? A HOH 363 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 387 ? 1_555 85.2 ? 16 O ? F HOH . ? A HOH 323 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 339 ? 1_555 88.4 ? 17 O ? F HOH . ? A HOH 323 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 344 ? 1_555 86.8 ? 18 O ? F HOH . ? A HOH 339 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 344 ? 1_555 174.8 ? 19 O ? F HOH . ? A HOH 323 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 392 ? 1_555 86.4 ? 20 O ? F HOH . ? A HOH 339 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 392 ? 1_555 90.5 ? 21 O ? F HOH . ? A HOH 344 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 392 ? 1_555 87.4 ? 22 O ? F HOH . ? A HOH 323 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 435 ? 1_555 89.5 ? 23 O ? F HOH . ? A HOH 339 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 435 ? 1_555 97.9 ? 24 O ? F HOH . ? A HOH 344 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 435 ? 1_555 84.0 ? 25 O ? F HOH . ? A HOH 392 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 435 ? 1_555 170.6 ? 26 O ? F HOH . ? A HOH 323 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 453 ? 1_555 173.3 ? 27 O ? F HOH . ? A HOH 339 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 453 ? 1_555 98.3 ? 28 O ? F HOH . ? A HOH 344 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 453 ? 1_555 86.5 ? 29 O ? F HOH . ? A HOH 392 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 453 ? 1_555 94.2 ? 30 O ? F HOH . ? A HOH 435 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 453 ? 1_555 88.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-07-25 2 'Structure model' 1 1 2018-08-22 3 'Structure model' 1 2 2019-02-20 4 'Structure model' 1 3 2019-11-27 5 'Structure model' 1 4 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 3 'Structure model' 'Data collection' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.name' 5 3 'Structure model' '_pdbx_audit_support.funding_organization' 6 4 'Structure model' '_pdbx_audit_support.funding_organization' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.25 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 2 ? A -100.85 -159.49 2 1 ASN A 2 ? B -108.47 -157.17 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 128 ? A ARG 128 2 1 Y 1 A GLU 129 ? A GLU 129 3 1 Y 1 A PRO 130 ? A PRO 130 4 1 Y 1 A GLN 131 ? A GLN 131 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 DNX C1 C Y N 89 DNX C2 C Y N 90 DNX C3 C Y N 91 DNX N3 N N N 92 DNX C4 C Y N 93 DNX N4 N N N 94 DNX C5 C Y N 95 DNX C6 C Y N 96 DNX O1 O N N 97 DNX O31 O N N 98 DNX O32 O N N 99 DNX O41 O N N 100 DNX O42 O N N 101 DNX H2 H N N 102 DNX H5 H N N 103 DNX H6 H N N 104 DNX HO1 H N N 105 GLN N N N N 106 GLN CA C N S 107 GLN C C N N 108 GLN O O N N 109 GLN CB C N N 110 GLN CG C N N 111 GLN CD C N N 112 GLN OE1 O N N 113 GLN NE2 N N N 114 GLN OXT O N N 115 GLN H H N N 116 GLN H2 H N N 117 GLN HA H N N 118 GLN HB2 H N N 119 GLN HB3 H N N 120 GLN HG2 H N N 121 GLN HG3 H N N 122 GLN HE21 H N N 123 GLN HE22 H N N 124 GLN HXT H N N 125 GLU N N N N 126 GLU CA C N S 127 GLU C C N N 128 GLU O O N N 129 GLU CB C N N 130 GLU CG C N N 131 GLU CD C N N 132 GLU OE1 O N N 133 GLU OE2 O N N 134 GLU OXT O N N 135 GLU H H N N 136 GLU H2 H N N 137 GLU HA H N N 138 GLU HB2 H N N 139 GLU HB3 H N N 140 GLU HG2 H N N 141 GLU HG3 H N N 142 GLU HE2 H N N 143 GLU HXT H N N 144 GLY N N N N 145 GLY CA C N N 146 GLY C C N N 147 GLY O O N N 148 GLY OXT O N N 149 GLY H H N N 150 GLY H2 H N N 151 GLY HA2 H N N 152 GLY HA3 H N N 153 GLY HXT H N N 154 HIS N N N N 155 HIS CA C N S 156 HIS C C N N 157 HIS O O N N 158 HIS CB C N N 159 HIS CG C Y N 160 HIS ND1 N Y N 161 HIS CD2 C Y N 162 HIS CE1 C Y N 163 HIS NE2 N Y N 164 HIS OXT O N N 165 HIS H H N N 166 HIS H2 H N N 167 HIS HA H N N 168 HIS HB2 H N N 169 HIS HB3 H N N 170 HIS HD1 H N N 171 HIS HD2 H N N 172 HIS HE1 H N N 173 HIS HE2 H N N 174 HIS HXT H N N 175 HOH O O N N 176 HOH H1 H N N 177 HOH H2 H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 MET N N N N 248 MET CA C N S 249 MET C C N N 250 MET O O N N 251 MET CB C N N 252 MET CG C N N 253 MET SD S N N 254 MET CE C N N 255 MET OXT O N N 256 MET H H N N 257 MET H2 H N N 258 MET HA H N N 259 MET HB2 H N N 260 MET HB3 H N N 261 MET HG2 H N N 262 MET HG3 H N N 263 MET HE1 H N N 264 MET HE2 H N N 265 MET HE3 H N N 266 MET HXT H N N 267 MG MG MG N N 268 PHE N N N N 269 PHE CA C N S 270 PHE C C N N 271 PHE O O N N 272 PHE CB C N N 273 PHE CG C Y N 274 PHE CD1 C Y N 275 PHE CD2 C Y N 276 PHE CE1 C Y N 277 PHE CE2 C Y N 278 PHE CZ C Y N 279 PHE OXT O N N 280 PHE H H N N 281 PHE H2 H N N 282 PHE HA H N N 283 PHE HB2 H N N 284 PHE HB3 H N N 285 PHE HD1 H N N 286 PHE HD2 H N N 287 PHE HE1 H N N 288 PHE HE2 H N N 289 PHE HZ H N N 290 PHE HXT H N N 291 PRO N N N N 292 PRO CA C N S 293 PRO C C N N 294 PRO O O N N 295 PRO CB C N N 296 PRO CG C N N 297 PRO CD C N N 298 PRO OXT O N N 299 PRO H H N N 300 PRO HA H N N 301 PRO HB2 H N N 302 PRO HB3 H N N 303 PRO HG2 H N N 304 PRO HG3 H N N 305 PRO HD2 H N N 306 PRO HD3 H N N 307 PRO HXT H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DNX C1 C2 doub Y N 83 DNX C1 C6 sing Y N 84 DNX C1 O1 sing N N 85 DNX C2 C3 sing Y N 86 DNX C3 N3 sing N N 87 DNX C3 C4 doub Y N 88 DNX N3 O31 doub N N 89 DNX N3 O32 sing N N 90 DNX C4 N4 sing N N 91 DNX C4 C5 sing Y N 92 DNX N4 O41 doub N N 93 DNX N4 O42 sing N N 94 DNX C5 C6 doub Y N 95 DNX C2 H2 sing N N 96 DNX C5 H5 sing N N 97 DNX C6 H6 sing N N 98 DNX O1 HO1 sing N N 99 GLN N CA sing N N 100 GLN N H sing N N 101 GLN N H2 sing N N 102 GLN CA C sing N N 103 GLN CA CB sing N N 104 GLN CA HA sing N N 105 GLN C O doub N N 106 GLN C OXT sing N N 107 GLN CB CG sing N N 108 GLN CB HB2 sing N N 109 GLN CB HB3 sing N N 110 GLN CG CD sing N N 111 GLN CG HG2 sing N N 112 GLN CG HG3 sing N N 113 GLN CD OE1 doub N N 114 GLN CD NE2 sing N N 115 GLN NE2 HE21 sing N N 116 GLN NE2 HE22 sing N N 117 GLN OXT HXT sing N N 118 GLU N CA sing N N 119 GLU N H sing N N 120 GLU N H2 sing N N 121 GLU CA C sing N N 122 GLU CA CB sing N N 123 GLU CA HA sing N N 124 GLU C O doub N N 125 GLU C OXT sing N N 126 GLU CB CG sing N N 127 GLU CB HB2 sing N N 128 GLU CB HB3 sing N N 129 GLU CG CD sing N N 130 GLU CG HG2 sing N N 131 GLU CG HG3 sing N N 132 GLU CD OE1 doub N N 133 GLU CD OE2 sing N N 134 GLU OE2 HE2 sing N N 135 GLU OXT HXT sing N N 136 GLY N CA sing N N 137 GLY N H sing N N 138 GLY N H2 sing N N 139 GLY CA C sing N N 140 GLY CA HA2 sing N N 141 GLY CA HA3 sing N N 142 GLY C O doub N N 143 GLY C OXT sing N N 144 GLY OXT HXT sing N N 145 HIS N CA sing N N 146 HIS N H sing N N 147 HIS N H2 sing N N 148 HIS CA C sing N N 149 HIS CA CB sing N N 150 HIS CA HA sing N N 151 HIS C O doub N N 152 HIS C OXT sing N N 153 HIS CB CG sing N N 154 HIS CB HB2 sing N N 155 HIS CB HB3 sing N N 156 HIS CG ND1 sing Y N 157 HIS CG CD2 doub Y N 158 HIS ND1 CE1 doub Y N 159 HIS ND1 HD1 sing N N 160 HIS CD2 NE2 sing Y N 161 HIS CD2 HD2 sing N N 162 HIS CE1 NE2 sing Y N 163 HIS CE1 HE1 sing N N 164 HIS NE2 HE2 sing N N 165 HIS OXT HXT sing N N 166 HOH O H1 sing N N 167 HOH O H2 sing N N 168 ILE N CA sing N N 169 ILE N H sing N N 170 ILE N H2 sing N N 171 ILE CA C sing N N 172 ILE CA CB sing N N 173 ILE CA HA sing N N 174 ILE C O doub N N 175 ILE C OXT sing N N 176 ILE CB CG1 sing N N 177 ILE CB CG2 sing N N 178 ILE CB HB sing N N 179 ILE CG1 CD1 sing N N 180 ILE CG1 HG12 sing N N 181 ILE CG1 HG13 sing N N 182 ILE CG2 HG21 sing N N 183 ILE CG2 HG22 sing N N 184 ILE CG2 HG23 sing N N 185 ILE CD1 HD11 sing N N 186 ILE CD1 HD12 sing N N 187 ILE CD1 HD13 sing N N 188 ILE OXT HXT sing N N 189 LEU N CA sing N N 190 LEU N H sing N N 191 LEU N H2 sing N N 192 LEU CA C sing N N 193 LEU CA CB sing N N 194 LEU CA HA sing N N 195 LEU C O doub N N 196 LEU C OXT sing N N 197 LEU CB CG sing N N 198 LEU CB HB2 sing N N 199 LEU CB HB3 sing N N 200 LEU CG CD1 sing N N 201 LEU CG CD2 sing N N 202 LEU CG HG sing N N 203 LEU CD1 HD11 sing N N 204 LEU CD1 HD12 sing N N 205 LEU CD1 HD13 sing N N 206 LEU CD2 HD21 sing N N 207 LEU CD2 HD22 sing N N 208 LEU CD2 HD23 sing N N 209 LEU OXT HXT sing N N 210 LYS N CA sing N N 211 LYS N H sing N N 212 LYS N H2 sing N N 213 LYS CA C sing N N 214 LYS CA CB sing N N 215 LYS CA HA sing N N 216 LYS C O doub N N 217 LYS C OXT sing N N 218 LYS CB CG sing N N 219 LYS CB HB2 sing N N 220 LYS CB HB3 sing N N 221 LYS CG CD sing N N 222 LYS CG HG2 sing N N 223 LYS CG HG3 sing N N 224 LYS CD CE sing N N 225 LYS CD HD2 sing N N 226 LYS CD HD3 sing N N 227 LYS CE NZ sing N N 228 LYS CE HE2 sing N N 229 LYS CE HE3 sing N N 230 LYS NZ HZ1 sing N N 231 LYS NZ HZ2 sing N N 232 LYS NZ HZ3 sing N N 233 LYS OXT HXT sing N N 234 MET N CA sing N N 235 MET N H sing N N 236 MET N H2 sing N N 237 MET CA C sing N N 238 MET CA CB sing N N 239 MET CA HA sing N N 240 MET C O doub N N 241 MET C OXT sing N N 242 MET CB CG sing N N 243 MET CB HB2 sing N N 244 MET CB HB3 sing N N 245 MET CG SD sing N N 246 MET CG HG2 sing N N 247 MET CG HG3 sing N N 248 MET SD CE sing N N 249 MET CE HE1 sing N N 250 MET CE HE2 sing N N 251 MET CE HE3 sing N N 252 MET OXT HXT sing N N 253 PHE N CA sing N N 254 PHE N H sing N N 255 PHE N H2 sing N N 256 PHE CA C sing N N 257 PHE CA CB sing N N 258 PHE CA HA sing N N 259 PHE C O doub N N 260 PHE C OXT sing N N 261 PHE CB CG sing N N 262 PHE CB HB2 sing N N 263 PHE CB HB3 sing N N 264 PHE CG CD1 doub Y N 265 PHE CG CD2 sing Y N 266 PHE CD1 CE1 sing Y N 267 PHE CD1 HD1 sing N N 268 PHE CD2 CE2 doub Y N 269 PHE CD2 HD2 sing N N 270 PHE CE1 CZ doub Y N 271 PHE CE1 HE1 sing N N 272 PHE CE2 CZ sing Y N 273 PHE CE2 HE2 sing N N 274 PHE CZ HZ sing N N 275 PHE OXT HXT sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1121778 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'CHLORIDE ION' CL 4 3,4-dinitrophenol DNX 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3FZW _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #