data_6CG6 # _entry.id 6CG6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6CG6 pdb_00006cg6 10.2210/pdb6cg6/pdb WWPDB D_1000232696 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 6CG7 PDB . unspecified 6CGB PDB . unspecified 6CGS PDB . unspecified 6CGU PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6CG6 _pdbx_database_status.recvd_initial_deposition_date 2018-02-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Brasch, J.' 1 ? 'Harrison, O.J.' 2 ? 'Shapiro, L.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2211-1247 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 23 _citation.language ? _citation.page_first 1840 _citation.page_last 1852 _citation.title 'Homophilic and Heterophilic Interactions of Type II Cadherins Identify Specificity Groups Underlying Cell-Adhesive Behavior.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.celrep.2018.04.012 _citation.pdbx_database_id_PubMed 29742438 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brasch, J.' 1 ? primary 'Katsamba, P.S.' 2 ? primary 'Harrison, O.J.' 3 ? primary 'Ahlsen, G.' 4 ? primary 'Troyanovsky, R.B.' 5 ? primary 'Indra, I.' 6 ? primary 'Kaczynska, A.' 7 ? primary 'Kaeser, B.' 8 ? primary 'Troyanovsky, S.' 9 ? primary 'Honig, B.' 10 ? primary 'Shapiro, L.' 11 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6CG6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.524 _cell.length_a_esd ? _cell.length_b 87.524 _cell.length_b_esd ? _cell.length_c 67.758 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6CG6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Cadherin-10 23147.639 1 ? ? 'EC1-2 (UNP residues 55-261)' ? 2 non-polymer syn 'CALCIUM ION' 40.078 3 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 non-polymer syn 'TRIS(HYDROXYETHYL)AMINOMETHANE' 163.215 1 ? ? ? ? 5 water nat water 18.015 26 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name T2-cadherin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GWMWNQFFLLEEYTGSDYQYVGKLHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDREEKAFYTLRAQAINR RTLRPVEPESEFVIKIHDINDNEPTFPEEIYTASVPEMSVVGTSVVQVTATDADDPSYGNSARVIYSILQGQPYFSVEPE TGIIRTALPNMNRENKEQYQVVIQAKDMGGQMGGLSGTTTVNITLTD ; _entity_poly.pdbx_seq_one_letter_code_can ;GWMWNQFFLLEEYTGSDYQYVGKLHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDREEKAFYTLRAQAINR RTLRPVEPESEFVIKIHDINDNEPTFPEEIYTASVPEMSVVGTSVVQVTATDADDPSYGNSARVIYSILQGQPYFSVEPE TGIIRTALPNMNRENKEQYQVVIQAKDMGGQMGGLSGTTTVNITLTD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 TRP n 1 3 MET n 1 4 TRP n 1 5 ASN n 1 6 GLN n 1 7 PHE n 1 8 PHE n 1 9 LEU n 1 10 LEU n 1 11 GLU n 1 12 GLU n 1 13 TYR n 1 14 THR n 1 15 GLY n 1 16 SER n 1 17 ASP n 1 18 TYR n 1 19 GLN n 1 20 TYR n 1 21 VAL n 1 22 GLY n 1 23 LYS n 1 24 LEU n 1 25 HIS n 1 26 SER n 1 27 ASP n 1 28 GLN n 1 29 ASP n 1 30 LYS n 1 31 GLY n 1 32 ASP n 1 33 GLY n 1 34 SER n 1 35 LEU n 1 36 LYS n 1 37 TYR n 1 38 ILE n 1 39 LEU n 1 40 SER n 1 41 GLY n 1 42 ASP n 1 43 GLY n 1 44 ALA n 1 45 GLY n 1 46 THR n 1 47 LEU n 1 48 PHE n 1 49 ILE n 1 50 ILE n 1 51 ASP n 1 52 GLU n 1 53 LYS n 1 54 THR n 1 55 GLY n 1 56 ASP n 1 57 ILE n 1 58 HIS n 1 59 ALA n 1 60 THR n 1 61 ARG n 1 62 ARG n 1 63 ILE n 1 64 ASP n 1 65 ARG n 1 66 GLU n 1 67 GLU n 1 68 LYS n 1 69 ALA n 1 70 PHE n 1 71 TYR n 1 72 THR n 1 73 LEU n 1 74 ARG n 1 75 ALA n 1 76 GLN n 1 77 ALA n 1 78 ILE n 1 79 ASN n 1 80 ARG n 1 81 ARG n 1 82 THR n 1 83 LEU n 1 84 ARG n 1 85 PRO n 1 86 VAL n 1 87 GLU n 1 88 PRO n 1 89 GLU n 1 90 SER n 1 91 GLU n 1 92 PHE n 1 93 VAL n 1 94 ILE n 1 95 LYS n 1 96 ILE n 1 97 HIS n 1 98 ASP n 1 99 ILE n 1 100 ASN n 1 101 ASP n 1 102 ASN n 1 103 GLU n 1 104 PRO n 1 105 THR n 1 106 PHE n 1 107 PRO n 1 108 GLU n 1 109 GLU n 1 110 ILE n 1 111 TYR n 1 112 THR n 1 113 ALA n 1 114 SER n 1 115 VAL n 1 116 PRO n 1 117 GLU n 1 118 MET n 1 119 SER n 1 120 VAL n 1 121 VAL n 1 122 GLY n 1 123 THR n 1 124 SER n 1 125 VAL n 1 126 VAL n 1 127 GLN n 1 128 VAL n 1 129 THR n 1 130 ALA n 1 131 THR n 1 132 ASP n 1 133 ALA n 1 134 ASP n 1 135 ASP n 1 136 PRO n 1 137 SER n 1 138 TYR n 1 139 GLY n 1 140 ASN n 1 141 SER n 1 142 ALA n 1 143 ARG n 1 144 VAL n 1 145 ILE n 1 146 TYR n 1 147 SER n 1 148 ILE n 1 149 LEU n 1 150 GLN n 1 151 GLY n 1 152 GLN n 1 153 PRO n 1 154 TYR n 1 155 PHE n 1 156 SER n 1 157 VAL n 1 158 GLU n 1 159 PRO n 1 160 GLU n 1 161 THR n 1 162 GLY n 1 163 ILE n 1 164 ILE n 1 165 ARG n 1 166 THR n 1 167 ALA n 1 168 LEU n 1 169 PRO n 1 170 ASN n 1 171 MET n 1 172 ASN n 1 173 ARG n 1 174 GLU n 1 175 ASN n 1 176 LYS n 1 177 GLU n 1 178 GLN n 1 179 TYR n 1 180 GLN n 1 181 VAL n 1 182 VAL n 1 183 ILE n 1 184 GLN n 1 185 ALA n 1 186 LYS n 1 187 ASP n 1 188 MET n 1 189 GLY n 1 190 GLY n 1 191 GLN n 1 192 MET n 1 193 GLY n 1 194 GLY n 1 195 LEU n 1 196 SER n 1 197 GLY n 1 198 THR n 1 199 THR n 1 200 THR n 1 201 VAL n 1 202 ASN n 1 203 ILE n 1 204 THR n 1 205 LEU n 1 206 THR n 1 207 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 207 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Cdh10 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CAD10_MOUSE _struct_ref.pdbx_db_accession P70408 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GWMWNQFFLLEEYTGSDYQYVGKLHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDREEKAFYTLRAQAINR RTLRPVEPESEFVIKIHDINDNEPTFPEEIYTASVPEMSVVGTSVVQVTATDADDPSYGNSARVIYSILQGQPYFSVEPE TGIIRTALPNMNRENKEQYQVVIQAKDMGGQMGGLSGTTTVNITLTD ; _struct_ref.pdbx_align_begin 55 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6CG6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 207 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P70408 _struct_ref_seq.db_align_beg 55 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 261 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 207 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TAM non-polymer . 'TRIS(HYDROXYETHYL)AMINOMETHANE' ? 'C7 H17 N O3' 163.215 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6CG6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.80 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '6% v/v 2-propanol, 0.1 M MES, pH 6.0, 0.2 M calcium acetate, cryoprotectant: 30% v/v ethylene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2010-06-18 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS BEAMLINE X4C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X4C _diffrn_source.pdbx_synchrotron_site NSLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6CG6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 20 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7545 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.5 _reflns.pdbx_Rmerge_I_obs 0.123 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.83 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 732 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.041 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6CG6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.707 _refine.ls_d_res_low 19.735 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7545 _refine.ls_number_reflns_R_free 376 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.87 _refine.ls_percent_reflns_R_free 4.98 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2401 _refine.ls_R_factor_R_free 0.2833 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2377 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 6CGU' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 0.90 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.70 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.39 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.53 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1628 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 1672 _refine_hist.d_res_high 2.707 _refine_hist.d_res_low 19.735 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1679 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.502 ? 2277 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.800 ? 1005 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.046 ? 250 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 300 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7067 3.0971 . . 122 2328 100.00 . . . 0.4234 . 0.3234 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0971 3.8971 . . 124 2357 100.00 . . . 0.3261 . 0.2575 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8971 19.7357 . . 130 2484 100.00 . . . 0.2336 . 0.2077 . . . . . . . . . . # _struct.entry_id 6CG6 _struct.title 'mouse cadherin-10 EC1-2 adhesive fragment' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6CG6 _struct_keywords.text 'Cadherin EC domain Dimer Extracellular, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 5 ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 11 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 11 A CA 301 1_555 ? ? ? ? ? ? ? 2.483 ? ? metalc2 metalc ? ? A GLU 11 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 11 A CA 302 1_555 ? ? ? ? ? ? ? 2.751 ? ? metalc3 metalc ? ? A GLU 12 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 12 A CA 302 1_555 ? ? ? ? ? ? ? 2.597 ? ? metalc4 metalc ? ? A ASP 64 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 64 A CA 302 1_555 ? ? ? ? ? ? ? 2.181 ? ? metalc5 metalc ? ? A GLU 66 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 66 A CA 301 1_555 ? ? ? ? ? ? ? 2.724 ? ? metalc6 metalc ? ? A GLU 66 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 66 A CA 301 1_555 ? ? ? ? ? ? ? 2.388 ? ? metalc7 metalc ? ? A GLU 66 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 66 A CA 302 1_555 ? ? ? ? ? ? ? 2.376 ? ? metalc8 metalc ? ? A ASP 98 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 98 A CA 301 1_555 ? ? ? ? ? ? ? 2.455 ? ? metalc9 metalc ? ? A ILE 99 O ? ? ? 1_555 B CA . CA ? ? A ILE 99 A CA 301 1_555 ? ? ? ? ? ? ? 2.379 ? ? metalc10 metalc ? ? A ASN 100 OD1 ? ? ? 1_555 D CA . CA ? ? A ASN 100 A CA 303 1_555 ? ? ? ? ? ? ? 2.411 ? ? metalc11 metalc ? ? A ASP 101 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 101 A CA 301 1_555 ? ? ? ? ? ? ? 2.270 ? ? metalc12 metalc ? ? A ASP 101 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 101 A CA 302 1_555 ? ? ? ? ? ? ? 2.275 ? ? metalc13 metalc ? ? A ASN 102 O ? ? ? 1_555 D CA . CA ? ? A ASN 102 A CA 303 1_555 ? ? ? ? ? ? ? 2.265 ? ? metalc14 metalc ? ? A ASP 132 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 132 A CA 303 1_555 ? ? ? ? ? ? ? 2.578 ? ? metalc15 metalc ? ? A ASP 132 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 132 A CA 303 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc16 metalc ? ? A ASP 134 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 134 A CA 301 1_555 ? ? ? ? ? ? ? 2.433 ? ? metalc17 metalc ? ? A ASP 134 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 134 A CA 303 1_555 ? ? ? ? ? ? ? 2.367 ? ? metalc18 metalc ? ? A SER 141 O ? ? ? 1_555 D CA . CA ? ? A SER 141 A CA 303 1_555 ? ? ? ? ? ? ? 2.428 ? ? metalc19 metalc ? ? A ASP 187 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 187 A CA 303 1_555 ? ? ? ? ? ? ? 2.351 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 152 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 152 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 153 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 153 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.36 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 4 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 6 ? LEU A 10 ? GLN A 6 LEU A 10 AA1 2 SER A 90 ? HIS A 97 ? SER A 90 HIS A 97 AA1 3 PHE A 70 ? ASN A 79 ? PHE A 70 ASN A 79 AA1 4 LEU A 35 ? GLY A 41 ? LEU A 35 GLY A 41 AA2 1 GLN A 19 ? LYS A 23 ? GLN A 19 LYS A 23 AA2 2 ASP A 56 ? ALA A 59 ? ASP A 56 ALA A 59 AA2 3 PHE A 48 ? ILE A 50 ? PHE A 48 ILE A 50 AA3 1 ILE A 110 ? PRO A 116 ? ILE A 110 PRO A 116 AA3 2 SER A 196 ? THR A 206 ? SER A 196 THR A 206 AA3 3 GLN A 178 ? LYS A 186 ? GLN A 178 LYS A 186 AA3 4 ILE A 145 ? GLN A 150 ? ILE A 145 GLN A 150 AA4 1 SER A 124 ? GLN A 127 ? SER A 124 GLN A 127 AA4 2 ILE A 163 ? THR A 166 ? ILE A 163 THR A 166 AA4 3 PHE A 155 ? VAL A 157 ? PHE A 155 VAL A 157 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 9 ? N LEU A 9 O HIS A 97 ? O HIS A 97 AA1 2 3 O PHE A 92 ? O PHE A 92 N LEU A 73 ? N LEU A 73 AA1 3 4 O ARG A 74 ? O ARG A 74 N SER A 40 ? N SER A 40 AA2 1 2 N GLY A 22 ? N GLY A 22 O ILE A 57 ? O ILE A 57 AA2 2 3 O HIS A 58 ? O HIS A 58 N ILE A 49 ? N ILE A 49 AA3 1 2 N TYR A 111 ? N TYR A 111 O THR A 200 ? O THR A 200 AA3 2 3 O VAL A 201 ? O VAL A 201 N VAL A 181 ? N VAL A 181 AA3 3 4 O GLN A 184 ? O GLN A 184 N SER A 147 ? N SER A 147 AA4 1 2 N VAL A 126 ? N VAL A 126 O ILE A 164 ? O ILE A 164 AA4 2 3 O ARG A 165 ? O ARG A 165 N SER A 156 ? N SER A 156 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 301 ? 6 'binding site for residue CA A 301' AC2 Software A CA 302 ? 5 'binding site for residue CA A 302' AC3 Software A CA 303 ? 6 'binding site for residue CA A 303' AC4 Software A EDO 304 ? 3 'binding site for residue EDO A 304' AC5 Software A TAM 305 ? 3 'binding site for residue TAM A 305' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 11 ? GLU A 11 . ? 1_555 ? 2 AC1 6 GLU A 66 ? GLU A 66 . ? 1_555 ? 3 AC1 6 ASP A 98 ? ASP A 98 . ? 1_555 ? 4 AC1 6 ILE A 99 ? ILE A 99 . ? 1_555 ? 5 AC1 6 ASP A 101 ? ASP A 101 . ? 1_555 ? 6 AC1 6 ASP A 134 ? ASP A 134 . ? 1_555 ? 7 AC2 5 GLU A 11 ? GLU A 11 . ? 1_555 ? 8 AC2 5 GLU A 12 ? GLU A 12 . ? 1_555 ? 9 AC2 5 ASP A 64 ? ASP A 64 . ? 1_555 ? 10 AC2 5 GLU A 66 ? GLU A 66 . ? 1_555 ? 11 AC2 5 ASP A 101 ? ASP A 101 . ? 1_555 ? 12 AC3 6 ASN A 100 ? ASN A 100 . ? 1_555 ? 13 AC3 6 ASN A 102 ? ASN A 102 . ? 1_555 ? 14 AC3 6 ASP A 132 ? ASP A 132 . ? 1_555 ? 15 AC3 6 ASP A 134 ? ASP A 134 . ? 1_555 ? 16 AC3 6 SER A 141 ? SER A 141 . ? 1_555 ? 17 AC3 6 ASP A 187 ? ASP A 187 . ? 1_555 ? 18 AC4 3 PHE A 8 ? PHE A 8 . ? 8_555 ? 19 AC4 3 PHE A 8 ? PHE A 8 . ? 1_555 ? 20 AC4 3 TYR A 20 ? TYR A 20 . ? 1_555 ? 21 AC5 3 GLU A 12 ? GLU A 12 . ? 1_555 ? 22 AC5 3 ARG A 62 ? ARG A 62 . ? 1_555 ? 23 AC5 3 ASP A 64 ? ASP A 64 . ? 1_555 ? # _atom_sites.entry_id 6CG6 _atom_sites.fract_transf_matrix[1][1] 0.011425 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011425 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014758 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 TRP 2 2 2 TRP TRP A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 MET 171 171 171 MET MET A . n A 1 172 ASN 172 172 172 ASN ASN A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 MET 188 188 188 MET MET A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 GLN 191 191 191 GLN GLN A . n A 1 192 MET 192 192 192 MET MET A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 THR 200 200 200 THR THR A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 ASN 202 202 202 ASN ASN A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 ASP 207 207 207 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 301 1 CA CA A . C 2 CA 1 302 2 CA CA A . D 2 CA 1 303 3 CA CA A . E 3 EDO 1 304 1 EDO EDO A . F 4 TAM 1 305 1 TAM TAM A . G 5 HOH 1 401 23 HOH HOH A . G 5 HOH 2 402 21 HOH HOH A . G 5 HOH 3 403 13 HOH HOH A . G 5 HOH 4 404 29 HOH HOH A . G 5 HOH 5 405 12 HOH HOH A . G 5 HOH 6 406 14 HOH HOH A . G 5 HOH 7 407 25 HOH HOH A . G 5 HOH 8 408 18 HOH HOH A . G 5 HOH 9 409 8 HOH HOH A . G 5 HOH 10 410 15 HOH HOH A . G 5 HOH 11 411 28 HOH HOH A . G 5 HOH 12 412 24 HOH HOH A . G 5 HOH 13 413 10 HOH HOH A . G 5 HOH 14 414 20 HOH HOH A . G 5 HOH 15 415 22 HOH HOH A . G 5 HOH 16 416 4 HOH HOH A . G 5 HOH 17 417 11 HOH HOH A . G 5 HOH 18 418 17 HOH HOH A . G 5 HOH 19 419 5 HOH HOH A . G 5 HOH 20 420 19 HOH HOH A . G 5 HOH 21 421 26 HOH HOH A . G 5 HOH 22 422 16 HOH HOH A . G 5 HOH 23 423 9 HOH HOH A . G 5 HOH 24 424 27 HOH HOH A . G 5 HOH 25 425 6 HOH HOH A . G 5 HOH 26 426 7 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3160 ? 1 MORE -42 ? 1 'SSA (A^2)' 21920 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 33.8790000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 76.7 ? 2 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 99.2 ? 3 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 50.4 ? 4 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 87.9 ? 5 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 116.0 ? 6 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 72.5 ? 7 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A ILE 99 ? A ILE 99 ? 1_555 94.6 ? 8 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A ILE 99 ? A ILE 99 ? 1_555 153.3 ? 9 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A ILE 99 ? A ILE 99 ? 1_555 155.9 ? 10 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A ILE 99 ? A ILE 99 ? 1_555 88.4 ? 11 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 101 ? A ASP 101 ? 1_555 92.7 ? 12 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 101 ? A ASP 101 ? 1_555 75.7 ? 13 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 101 ? A ASP 101 ? 1_555 119.1 ? 14 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 101 ? A ASP 101 ? 1_555 168.0 ? 15 O ? A ILE 99 ? A ILE 99 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 101 ? A ASP 101 ? 1_555 79.7 ? 16 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 134 ? A ASP 134 ? 1_555 174.1 ? 17 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 134 ? A ASP 134 ? 1_555 104.8 ? 18 OE2 ? A GLU 66 ? A GLU 66 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 134 ? A ASP 134 ? 1_555 85.9 ? 19 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 134 ? A ASP 134 ? 1_555 96.3 ? 20 O ? A ILE 99 ? A ILE 99 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 134 ? A ASP 134 ? 1_555 81.6 ? 21 OD1 ? A ASP 101 ? A ASP 101 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OD1 ? A ASP 134 ? A ASP 134 ? 1_555 82.3 ? 22 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 OE2 ? A GLU 12 ? A GLU 12 ? 1_555 79.0 ? 23 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 OD1 ? A ASP 64 ? A ASP 64 ? 1_555 80.8 ? 24 OE2 ? A GLU 12 ? A GLU 12 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 OD1 ? A ASP 64 ? A ASP 64 ? 1_555 79.3 ? 25 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 82.5 ? 26 OE2 ? A GLU 12 ? A GLU 12 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 160.2 ? 27 OD1 ? A ASP 64 ? A ASP 64 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 90.8 ? 28 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 OD2 ? A ASP 101 ? A ASP 101 ? 1_555 93.6 ? 29 OE2 ? A GLU 12 ? A GLU 12 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 OD2 ? A ASP 101 ? A ASP 101 ? 1_555 82.9 ? 30 OD1 ? A ASP 64 ? A ASP 64 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 OD2 ? A ASP 101 ? A ASP 101 ? 1_555 162.1 ? 31 OE1 ? A GLU 66 ? A GLU 66 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 OD2 ? A ASP 101 ? A ASP 101 ? 1_555 105.4 ? 32 OD1 ? A ASN 100 ? A ASN 100 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? A ASN 102 ? A ASN 102 ? 1_555 112.5 ? 33 OD1 ? A ASN 100 ? A ASN 100 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 137.2 ? 34 O ? A ASN 102 ? A ASN 102 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 81.7 ? 35 OD1 ? A ASN 100 ? A ASN 100 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 132 ? A ASP 132 ? 1_555 152.6 ? 36 O ? A ASN 102 ? A ASN 102 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 132 ? A ASP 132 ? 1_555 93.2 ? 37 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 132 ? A ASP 132 ? 1_555 52.8 ? 38 OD1 ? A ASN 100 ? A ASN 100 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 134 ? A ASP 134 ? 1_555 66.9 ? 39 O ? A ASN 102 ? A ASN 102 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 134 ? A ASP 134 ? 1_555 86.3 ? 40 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 134 ? A ASP 134 ? 1_555 74.5 ? 41 OD2 ? A ASP 132 ? A ASP 132 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 134 ? A ASP 134 ? 1_555 126.6 ? 42 OD1 ? A ASN 100 ? A ASN 100 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? A SER 141 ? A SER 141 ? 1_555 78.8 ? 43 O ? A ASN 102 ? A ASN 102 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? A SER 141 ? A SER 141 ? 1_555 158.2 ? 44 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? A SER 141 ? A SER 141 ? 1_555 77.8 ? 45 OD2 ? A ASP 132 ? A ASP 132 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? A SER 141 ? A SER 141 ? 1_555 80.3 ? 46 OD2 ? A ASP 134 ? A ASP 134 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? A SER 141 ? A SER 141 ? 1_555 81.2 ? 47 OD1 ? A ASN 100 ? A ASN 100 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 187 ? A ASP 187 ? 1_555 75.6 ? 48 O ? A ASN 102 ? A ASN 102 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 187 ? A ASP 187 ? 1_555 99.3 ? 49 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 187 ? A ASP 187 ? 1_555 144.4 ? 50 OD2 ? A ASP 132 ? A ASP 132 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 187 ? A ASP 187 ? 1_555 91.7 ? 51 OD2 ? A ASP 134 ? A ASP 134 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 187 ? A ASP 187 ? 1_555 141.1 ? 52 O ? A SER 141 ? A SER 141 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OD2 ? A ASP 187 ? A ASP 187 ? 1_555 101.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-09 2 'Structure model' 1 1 2018-05-23 3 'Structure model' 1 2 2019-11-27 4 'Structure model' 1 3 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 3 'Structure model' '_pdbx_audit_support.funding_organization' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' 10 4 'Structure model' '_struct_conn.pdbx_dist_value' 11 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 46 ? ? -113.42 -79.88 2 1 LYS A 68 ? ? -171.31 123.33 3 1 GLU A 89 ? ? -67.22 81.01 4 1 VAL A 125 ? ? -103.35 -63.32 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 EDO C1 C N N 75 EDO O1 O N N 76 EDO C2 C N N 77 EDO O2 O N N 78 EDO H11 H N N 79 EDO H12 H N N 80 EDO HO1 H N N 81 EDO H21 H N N 82 EDO H22 H N N 83 EDO HO2 H N N 84 GLN N N N N 85 GLN CA C N S 86 GLN C C N N 87 GLN O O N N 88 GLN CB C N N 89 GLN CG C N N 90 GLN CD C N N 91 GLN OE1 O N N 92 GLN NE2 N N N 93 GLN OXT O N N 94 GLN H H N N 95 GLN H2 H N N 96 GLN HA H N N 97 GLN HB2 H N N 98 GLN HB3 H N N 99 GLN HG2 H N N 100 GLN HG3 H N N 101 GLN HE21 H N N 102 GLN HE22 H N N 103 GLN HXT H N N 104 GLU N N N N 105 GLU CA C N S 106 GLU C C N N 107 GLU O O N N 108 GLU CB C N N 109 GLU CG C N N 110 GLU CD C N N 111 GLU OE1 O N N 112 GLU OE2 O N N 113 GLU OXT O N N 114 GLU H H N N 115 GLU H2 H N N 116 GLU HA H N N 117 GLU HB2 H N N 118 GLU HB3 H N N 119 GLU HG2 H N N 120 GLU HG3 H N N 121 GLU HE2 H N N 122 GLU HXT H N N 123 GLY N N N N 124 GLY CA C N N 125 GLY C C N N 126 GLY O O N N 127 GLY OXT O N N 128 GLY H H N N 129 GLY H2 H N N 130 GLY HA2 H N N 131 GLY HA3 H N N 132 GLY HXT H N N 133 HIS N N N N 134 HIS CA C N S 135 HIS C C N N 136 HIS O O N N 137 HIS CB C N N 138 HIS CG C Y N 139 HIS ND1 N Y N 140 HIS CD2 C Y N 141 HIS CE1 C Y N 142 HIS NE2 N Y N 143 HIS OXT O N N 144 HIS H H N N 145 HIS H2 H N N 146 HIS HA H N N 147 HIS HB2 H N N 148 HIS HB3 H N N 149 HIS HD1 H N N 150 HIS HD2 H N N 151 HIS HE1 H N N 152 HIS HE2 H N N 153 HIS HXT H N N 154 HOH O O N N 155 HOH H1 H N N 156 HOH H2 H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 TAM C C N N 301 TAM C1 C N N 302 TAM C2 C N N 303 TAM C3 C N N 304 TAM C4 C N N 305 TAM C5 C N N 306 TAM C6 C N N 307 TAM N N N N 308 TAM O4 O N N 309 TAM O5 O N N 310 TAM O6 O N N 311 TAM H11 H N N 312 TAM H12 H N N 313 TAM H21 H N N 314 TAM H22 H N N 315 TAM H31 H N N 316 TAM H32 H N N 317 TAM H41 H N N 318 TAM H42 H N N 319 TAM H51 H N N 320 TAM H52 H N N 321 TAM H61 H N N 322 TAM H62 H N N 323 TAM HN1 H N N 324 TAM HN2 H N N 325 TAM HO4 H N N 326 TAM HO5 H N N 327 TAM HO6 H N N 328 THR N N N N 329 THR CA C N S 330 THR C C N N 331 THR O O N N 332 THR CB C N R 333 THR OG1 O N N 334 THR CG2 C N N 335 THR OXT O N N 336 THR H H N N 337 THR H2 H N N 338 THR HA H N N 339 THR HB H N N 340 THR HG1 H N N 341 THR HG21 H N N 342 THR HG22 H N N 343 THR HG23 H N N 344 THR HXT H N N 345 TRP N N N N 346 TRP CA C N S 347 TRP C C N N 348 TRP O O N N 349 TRP CB C N N 350 TRP CG C Y N 351 TRP CD1 C Y N 352 TRP CD2 C Y N 353 TRP NE1 N Y N 354 TRP CE2 C Y N 355 TRP CE3 C Y N 356 TRP CZ2 C Y N 357 TRP CZ3 C Y N 358 TRP CH2 C Y N 359 TRP OXT O N N 360 TRP H H N N 361 TRP H2 H N N 362 TRP HA H N N 363 TRP HB2 H N N 364 TRP HB3 H N N 365 TRP HD1 H N N 366 TRP HE1 H N N 367 TRP HE3 H N N 368 TRP HZ2 H N N 369 TRP HZ3 H N N 370 TRP HH2 H N N 371 TRP HXT H N N 372 TYR N N N N 373 TYR CA C N S 374 TYR C C N N 375 TYR O O N N 376 TYR CB C N N 377 TYR CG C Y N 378 TYR CD1 C Y N 379 TYR CD2 C Y N 380 TYR CE1 C Y N 381 TYR CE2 C Y N 382 TYR CZ C Y N 383 TYR OH O N N 384 TYR OXT O N N 385 TYR H H N N 386 TYR H2 H N N 387 TYR HA H N N 388 TYR HB2 H N N 389 TYR HB3 H N N 390 TYR HD1 H N N 391 TYR HD2 H N N 392 TYR HE1 H N N 393 TYR HE2 H N N 394 TYR HH H N N 395 TYR HXT H N N 396 VAL N N N N 397 VAL CA C N S 398 VAL C C N N 399 VAL O O N N 400 VAL CB C N N 401 VAL CG1 C N N 402 VAL CG2 C N N 403 VAL OXT O N N 404 VAL H H N N 405 VAL H2 H N N 406 VAL HA H N N 407 VAL HB H N N 408 VAL HG11 H N N 409 VAL HG12 H N N 410 VAL HG13 H N N 411 VAL HG21 H N N 412 VAL HG22 H N N 413 VAL HG23 H N N 414 VAL HXT H N N 415 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 EDO C1 O1 sing N N 70 EDO C1 C2 sing N N 71 EDO C1 H11 sing N N 72 EDO C1 H12 sing N N 73 EDO O1 HO1 sing N N 74 EDO C2 O2 sing N N 75 EDO C2 H21 sing N N 76 EDO C2 H22 sing N N 77 EDO O2 HO2 sing N N 78 GLN N CA sing N N 79 GLN N H sing N N 80 GLN N H2 sing N N 81 GLN CA C sing N N 82 GLN CA CB sing N N 83 GLN CA HA sing N N 84 GLN C O doub N N 85 GLN C OXT sing N N 86 GLN CB CG sing N N 87 GLN CB HB2 sing N N 88 GLN CB HB3 sing N N 89 GLN CG CD sing N N 90 GLN CG HG2 sing N N 91 GLN CG HG3 sing N N 92 GLN CD OE1 doub N N 93 GLN CD NE2 sing N N 94 GLN NE2 HE21 sing N N 95 GLN NE2 HE22 sing N N 96 GLN OXT HXT sing N N 97 GLU N CA sing N N 98 GLU N H sing N N 99 GLU N H2 sing N N 100 GLU CA C sing N N 101 GLU CA CB sing N N 102 GLU CA HA sing N N 103 GLU C O doub N N 104 GLU C OXT sing N N 105 GLU CB CG sing N N 106 GLU CB HB2 sing N N 107 GLU CB HB3 sing N N 108 GLU CG CD sing N N 109 GLU CG HG2 sing N N 110 GLU CG HG3 sing N N 111 GLU CD OE1 doub N N 112 GLU CD OE2 sing N N 113 GLU OE2 HE2 sing N N 114 GLU OXT HXT sing N N 115 GLY N CA sing N N 116 GLY N H sing N N 117 GLY N H2 sing N N 118 GLY CA C sing N N 119 GLY CA HA2 sing N N 120 GLY CA HA3 sing N N 121 GLY C O doub N N 122 GLY C OXT sing N N 123 GLY OXT HXT sing N N 124 HIS N CA sing N N 125 HIS N H sing N N 126 HIS N H2 sing N N 127 HIS CA C sing N N 128 HIS CA CB sing N N 129 HIS CA HA sing N N 130 HIS C O doub N N 131 HIS C OXT sing N N 132 HIS CB CG sing N N 133 HIS CB HB2 sing N N 134 HIS CB HB3 sing N N 135 HIS CG ND1 sing Y N 136 HIS CG CD2 doub Y N 137 HIS ND1 CE1 doub Y N 138 HIS ND1 HD1 sing N N 139 HIS CD2 NE2 sing Y N 140 HIS CD2 HD2 sing N N 141 HIS CE1 NE2 sing Y N 142 HIS CE1 HE1 sing N N 143 HIS NE2 HE2 sing N N 144 HIS OXT HXT sing N N 145 HOH O H1 sing N N 146 HOH O H2 sing N N 147 ILE N CA sing N N 148 ILE N H sing N N 149 ILE N H2 sing N N 150 ILE CA C sing N N 151 ILE CA CB sing N N 152 ILE CA HA sing N N 153 ILE C O doub N N 154 ILE C OXT sing N N 155 ILE CB CG1 sing N N 156 ILE CB CG2 sing N N 157 ILE CB HB sing N N 158 ILE CG1 CD1 sing N N 159 ILE CG1 HG12 sing N N 160 ILE CG1 HG13 sing N N 161 ILE CG2 HG21 sing N N 162 ILE CG2 HG22 sing N N 163 ILE CG2 HG23 sing N N 164 ILE CD1 HD11 sing N N 165 ILE CD1 HD12 sing N N 166 ILE CD1 HD13 sing N N 167 ILE OXT HXT sing N N 168 LEU N CA sing N N 169 LEU N H sing N N 170 LEU N H2 sing N N 171 LEU CA C sing N N 172 LEU CA CB sing N N 173 LEU CA HA sing N N 174 LEU C O doub N N 175 LEU C OXT sing N N 176 LEU CB CG sing N N 177 LEU CB HB2 sing N N 178 LEU CB HB3 sing N N 179 LEU CG CD1 sing N N 180 LEU CG CD2 sing N N 181 LEU CG HG sing N N 182 LEU CD1 HD11 sing N N 183 LEU CD1 HD12 sing N N 184 LEU CD1 HD13 sing N N 185 LEU CD2 HD21 sing N N 186 LEU CD2 HD22 sing N N 187 LEU CD2 HD23 sing N N 188 LEU OXT HXT sing N N 189 LYS N CA sing N N 190 LYS N H sing N N 191 LYS N H2 sing N N 192 LYS CA C sing N N 193 LYS CA CB sing N N 194 LYS CA HA sing N N 195 LYS C O doub N N 196 LYS C OXT sing N N 197 LYS CB CG sing N N 198 LYS CB HB2 sing N N 199 LYS CB HB3 sing N N 200 LYS CG CD sing N N 201 LYS CG HG2 sing N N 202 LYS CG HG3 sing N N 203 LYS CD CE sing N N 204 LYS CD HD2 sing N N 205 LYS CD HD3 sing N N 206 LYS CE NZ sing N N 207 LYS CE HE2 sing N N 208 LYS CE HE3 sing N N 209 LYS NZ HZ1 sing N N 210 LYS NZ HZ2 sing N N 211 LYS NZ HZ3 sing N N 212 LYS OXT HXT sing N N 213 MET N CA sing N N 214 MET N H sing N N 215 MET N H2 sing N N 216 MET CA C sing N N 217 MET CA CB sing N N 218 MET CA HA sing N N 219 MET C O doub N N 220 MET C OXT sing N N 221 MET CB CG sing N N 222 MET CB HB2 sing N N 223 MET CB HB3 sing N N 224 MET CG SD sing N N 225 MET CG HG2 sing N N 226 MET CG HG3 sing N N 227 MET SD CE sing N N 228 MET CE HE1 sing N N 229 MET CE HE2 sing N N 230 MET CE HE3 sing N N 231 MET OXT HXT sing N N 232 PHE N CA sing N N 233 PHE N H sing N N 234 PHE N H2 sing N N 235 PHE CA C sing N N 236 PHE CA CB sing N N 237 PHE CA HA sing N N 238 PHE C O doub N N 239 PHE C OXT sing N N 240 PHE CB CG sing N N 241 PHE CB HB2 sing N N 242 PHE CB HB3 sing N N 243 PHE CG CD1 doub Y N 244 PHE CG CD2 sing Y N 245 PHE CD1 CE1 sing Y N 246 PHE CD1 HD1 sing N N 247 PHE CD2 CE2 doub Y N 248 PHE CD2 HD2 sing N N 249 PHE CE1 CZ doub Y N 250 PHE CE1 HE1 sing N N 251 PHE CE2 CZ sing Y N 252 PHE CE2 HE2 sing N N 253 PHE CZ HZ sing N N 254 PHE OXT HXT sing N N 255 PRO N CA sing N N 256 PRO N CD sing N N 257 PRO N H sing N N 258 PRO CA C sing N N 259 PRO CA CB sing N N 260 PRO CA HA sing N N 261 PRO C O doub N N 262 PRO C OXT sing N N 263 PRO CB CG sing N N 264 PRO CB HB2 sing N N 265 PRO CB HB3 sing N N 266 PRO CG CD sing N N 267 PRO CG HG2 sing N N 268 PRO CG HG3 sing N N 269 PRO CD HD2 sing N N 270 PRO CD HD3 sing N N 271 PRO OXT HXT sing N N 272 SER N CA sing N N 273 SER N H sing N N 274 SER N H2 sing N N 275 SER CA C sing N N 276 SER CA CB sing N N 277 SER CA HA sing N N 278 SER C O doub N N 279 SER C OXT sing N N 280 SER CB OG sing N N 281 SER CB HB2 sing N N 282 SER CB HB3 sing N N 283 SER OG HG sing N N 284 SER OXT HXT sing N N 285 TAM C C1 sing N N 286 TAM C C2 sing N N 287 TAM C C3 sing N N 288 TAM C N sing N N 289 TAM C1 C4 sing N N 290 TAM C1 H11 sing N N 291 TAM C1 H12 sing N N 292 TAM C2 C5 sing N N 293 TAM C2 H21 sing N N 294 TAM C2 H22 sing N N 295 TAM C3 C6 sing N N 296 TAM C3 H31 sing N N 297 TAM C3 H32 sing N N 298 TAM C4 O4 sing N N 299 TAM C4 H41 sing N N 300 TAM C4 H42 sing N N 301 TAM C5 O5 sing N N 302 TAM C5 H51 sing N N 303 TAM C5 H52 sing N N 304 TAM C6 O6 sing N N 305 TAM C6 H61 sing N N 306 TAM C6 H62 sing N N 307 TAM N HN1 sing N N 308 TAM N HN2 sing N N 309 TAM O4 HO4 sing N N 310 TAM O5 HO5 sing N N 311 TAM O6 HO6 sing N N 312 THR N CA sing N N 313 THR N H sing N N 314 THR N H2 sing N N 315 THR CA C sing N N 316 THR CA CB sing N N 317 THR CA HA sing N N 318 THR C O doub N N 319 THR C OXT sing N N 320 THR CB OG1 sing N N 321 THR CB CG2 sing N N 322 THR CB HB sing N N 323 THR OG1 HG1 sing N N 324 THR CG2 HG21 sing N N 325 THR CG2 HG22 sing N N 326 THR CG2 HG23 sing N N 327 THR OXT HXT sing N N 328 TRP N CA sing N N 329 TRP N H sing N N 330 TRP N H2 sing N N 331 TRP CA C sing N N 332 TRP CA CB sing N N 333 TRP CA HA sing N N 334 TRP C O doub N N 335 TRP C OXT sing N N 336 TRP CB CG sing N N 337 TRP CB HB2 sing N N 338 TRP CB HB3 sing N N 339 TRP CG CD1 doub Y N 340 TRP CG CD2 sing Y N 341 TRP CD1 NE1 sing Y N 342 TRP CD1 HD1 sing N N 343 TRP CD2 CE2 doub Y N 344 TRP CD2 CE3 sing Y N 345 TRP NE1 CE2 sing Y N 346 TRP NE1 HE1 sing N N 347 TRP CE2 CZ2 sing Y N 348 TRP CE3 CZ3 doub Y N 349 TRP CE3 HE3 sing N N 350 TRP CZ2 CH2 doub Y N 351 TRP CZ2 HZ2 sing N N 352 TRP CZ3 CH2 sing Y N 353 TRP CZ3 HZ3 sing N N 354 TRP CH2 HH2 sing N N 355 TRP OXT HXT sing N N 356 TYR N CA sing N N 357 TYR N H sing N N 358 TYR N H2 sing N N 359 TYR CA C sing N N 360 TYR CA CB sing N N 361 TYR CA HA sing N N 362 TYR C O doub N N 363 TYR C OXT sing N N 364 TYR CB CG sing N N 365 TYR CB HB2 sing N N 366 TYR CB HB3 sing N N 367 TYR CG CD1 doub Y N 368 TYR CG CD2 sing Y N 369 TYR CD1 CE1 sing Y N 370 TYR CD1 HD1 sing N N 371 TYR CD2 CE2 doub Y N 372 TYR CD2 HD2 sing N N 373 TYR CE1 CZ doub Y N 374 TYR CE1 HE1 sing N N 375 TYR CE2 CZ sing Y N 376 TYR CE2 HE2 sing N N 377 TYR CZ OH sing N N 378 TYR OH HH sing N N 379 TYR OXT HXT sing N N 380 VAL N CA sing N N 381 VAL N H sing N N 382 VAL N H2 sing N N 383 VAL CA C sing N N 384 VAL CA CB sing N N 385 VAL CA HA sing N N 386 VAL C O doub N N 387 VAL C OXT sing N N 388 VAL CB CG1 sing N N 389 VAL CB CG2 sing N N 390 VAL CB HB sing N N 391 VAL CG1 HG11 sing N N 392 VAL CG1 HG12 sing N N 393 VAL CG1 HG13 sing N N 394 VAL CG2 HG21 sing N N 395 VAL CG2 HG22 sing N N 396 VAL CG2 HG23 sing N N 397 VAL OXT HXT sing N N 398 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R01 GM062270' 1 'National Science Foundation (NSF, United States)' 'United States' 'MCB- 0918535' 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 1,2-ETHANEDIOL EDO 4 'TRIS(HYDROXYETHYL)AMINOMETHANE' TAM 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6CGU _pdbx_initial_refinement_model.details 'PDB entry 6CGU' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'equilibrium centrifugation' _pdbx_struct_assembly_auth_evidence.details ? #