data_6EKH # _entry.id 6EKH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6EKH pdb_00006ekh 10.2210/pdb6ekh/pdb WWPDB D_1200006603 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-31 2 'Structure model' 1 1 2018-02-14 3 'Structure model' 1 2 2018-02-21 4 'Structure model' 1 3 2019-02-20 5 'Structure model' 1 4 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Database references' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_source 2 3 'Structure model' citation 3 4 'Structure model' pdbx_data_processing_status 4 4 'Structure model' pdbx_validate_close_contact 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_conn_type 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 10 5 'Structure model' pdbx_initial_refinement_model 11 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline' 2 2 'Structure model' '_diffrn_source.type' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 5 'Structure model' '_database_2.pdbx_DOI' 7 5 'Structure model' '_database_2.pdbx_database_accession' 8 5 'Structure model' '_struct_conn.pdbx_dist_value' 9 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6EKH _pdbx_database_status.recvd_initial_deposition_date 2017-09-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Altegoer, F.' 1 ? 'Bange, G.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 115 _citation.language ? _citation.page_first E1259 _citation.page_last E1268 _citation.title 'Structure and function of the archaeal response regulator CheY.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1716661115 _citation.pdbx_database_id_PubMed 29358409 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Quax, T.E.F.' 1 ? primary 'Altegoer, F.' 2 ? primary 'Rossi, F.' 3 ? primary 'Li, Z.' 4 ? primary 'Rodriguez-Franco, M.' 5 ? primary 'Kraus, F.' 6 ? primary 'Bange, G.' 7 ? primary 'Albers, S.V.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chemotaxis protein CheY' 13534.839 1 ? ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn 'BERYLLIUM TRIFLUORIDE ION' 66.007 1 ? ? ? ? 4 water nat water 18.015 3 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASIVKTMIVDDSAFMRNILKRILSTTNKYVVIGEAANGADAIKMAEELQPDLISMDIVMPETDGITATKAIKEKTPEIK IVMCTSVDQEQKMIDAVNAGADGYIVKPFQAPKILEQFNKLFP ; _entity_poly.pdbx_seq_one_letter_code_can ;MASIVKTMIVDDSAFMRNILKRILSTTNKYVVIGEAANGADAIKMAEELQPDLISMDIVMPETDGITATKAIKEKTPEIK IVMCTSVDQEQKMIDAVNAGADGYIVKPFQAPKILEQFNKLFP ; _entity_poly.pdbx_strand_id Y _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'BERYLLIUM TRIFLUORIDE ION' BEF 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 ILE n 1 5 VAL n 1 6 LYS n 1 7 THR n 1 8 MET n 1 9 ILE n 1 10 VAL n 1 11 ASP n 1 12 ASP n 1 13 SER n 1 14 ALA n 1 15 PHE n 1 16 MET n 1 17 ARG n 1 18 ASN n 1 19 ILE n 1 20 LEU n 1 21 LYS n 1 22 ARG n 1 23 ILE n 1 24 LEU n 1 25 SER n 1 26 THR n 1 27 THR n 1 28 ASN n 1 29 LYS n 1 30 TYR n 1 31 VAL n 1 32 VAL n 1 33 ILE n 1 34 GLY n 1 35 GLU n 1 36 ALA n 1 37 ALA n 1 38 ASN n 1 39 GLY n 1 40 ALA n 1 41 ASP n 1 42 ALA n 1 43 ILE n 1 44 LYS n 1 45 MET n 1 46 ALA n 1 47 GLU n 1 48 GLU n 1 49 LEU n 1 50 GLN n 1 51 PRO n 1 52 ASP n 1 53 LEU n 1 54 ILE n 1 55 SER n 1 56 MET n 1 57 ASP n 1 58 ILE n 1 59 VAL n 1 60 MET n 1 61 PRO n 1 62 GLU n 1 63 THR n 1 64 ASP n 1 65 GLY n 1 66 ILE n 1 67 THR n 1 68 ALA n 1 69 THR n 1 70 LYS n 1 71 ALA n 1 72 ILE n 1 73 LYS n 1 74 GLU n 1 75 LYS n 1 76 THR n 1 77 PRO n 1 78 GLU n 1 79 ILE n 1 80 LYS n 1 81 ILE n 1 82 VAL n 1 83 MET n 1 84 CYS n 1 85 THR n 1 86 SER n 1 87 VAL n 1 88 ASP n 1 89 GLN n 1 90 GLU n 1 91 GLN n 1 92 LYS n 1 93 MET n 1 94 ILE n 1 95 ASP n 1 96 ALA n 1 97 VAL n 1 98 ASN n 1 99 ALA n 1 100 GLY n 1 101 ALA n 1 102 ASP n 1 103 GLY n 1 104 TYR n 1 105 ILE n 1 106 VAL n 1 107 LYS n 1 108 PRO n 1 109 PHE n 1 110 GLN n 1 111 ALA n 1 112 PRO n 1 113 LYS n 1 114 ILE n 1 115 LEU n 1 116 GLU n 1 117 GLN n 1 118 PHE n 1 119 ASN n 1 120 LYS n 1 121 LEU n 1 122 PHE n 1 123 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 123 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'cheY, MMP0933' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanococcus maripaludis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 39152 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BEF non-polymer . 'BERYLLIUM TRIFLUORIDE ION' ? 'Be F3 -1' 66.007 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? Y . n A 1 2 ALA 2 2 ? ? ? Y . n A 1 3 SER 3 3 3 SER SER Y . n A 1 4 ILE 4 4 4 ILE ILE Y . n A 1 5 VAL 5 5 5 VAL VAL Y . n A 1 6 LYS 6 6 6 LYS LYS Y . n A 1 7 THR 7 7 7 THR THR Y . n A 1 8 MET 8 8 8 MET MET Y . n A 1 9 ILE 9 9 9 ILE ILE Y . n A 1 10 VAL 10 10 10 VAL VAL Y . n A 1 11 ASP 11 11 11 ASP ASP Y . n A 1 12 ASP 12 12 12 ASP ASP Y . n A 1 13 SER 13 13 13 SER SER Y . n A 1 14 ALA 14 14 14 ALA ALA Y . n A 1 15 PHE 15 15 15 PHE PHE Y . n A 1 16 MET 16 16 16 MET MET Y . n A 1 17 ARG 17 17 17 ARG ARG Y . n A 1 18 ASN 18 18 18 ASN ASN Y . n A 1 19 ILE 19 19 19 ILE ILE Y . n A 1 20 LEU 20 20 20 LEU LEU Y . n A 1 21 LYS 21 21 21 LYS LYS Y . n A 1 22 ARG 22 22 22 ARG ARG Y . n A 1 23 ILE 23 23 23 ILE ILE Y . n A 1 24 LEU 24 24 24 LEU LEU Y . n A 1 25 SER 25 25 25 SER SER Y . n A 1 26 THR 26 26 26 THR THR Y . n A 1 27 THR 27 27 27 THR THR Y . n A 1 28 ASN 28 28 28 ASN ASN Y . n A 1 29 LYS 29 29 29 LYS LYS Y . n A 1 30 TYR 30 30 30 TYR TYR Y . n A 1 31 VAL 31 31 31 VAL VAL Y . n A 1 32 VAL 32 32 32 VAL VAL Y . n A 1 33 ILE 33 33 33 ILE ILE Y . n A 1 34 GLY 34 34 34 GLY GLY Y . n A 1 35 GLU 35 35 35 GLU GLU Y . n A 1 36 ALA 36 36 36 ALA ALA Y . n A 1 37 ALA 37 37 37 ALA ALA Y . n A 1 38 ASN 38 38 38 ASN ASN Y . n A 1 39 GLY 39 39 39 GLY GLY Y . n A 1 40 ALA 40 40 40 ALA ALA Y . n A 1 41 ASP 41 41 41 ASP ASP Y . n A 1 42 ALA 42 42 42 ALA ALA Y . n A 1 43 ILE 43 43 43 ILE ILE Y . n A 1 44 LYS 44 44 44 LYS LYS Y . n A 1 45 MET 45 45 45 MET MET Y . n A 1 46 ALA 46 46 46 ALA ALA Y . n A 1 47 GLU 47 47 47 GLU GLU Y . n A 1 48 GLU 48 48 48 GLU GLU Y . n A 1 49 LEU 49 49 49 LEU LEU Y . n A 1 50 GLN 50 50 50 GLN GLN Y . n A 1 51 PRO 51 51 51 PRO PRO Y . n A 1 52 ASP 52 52 52 ASP ASP Y . n A 1 53 LEU 53 53 53 LEU LEU Y . n A 1 54 ILE 54 54 54 ILE ILE Y . n A 1 55 SER 55 55 55 SER SER Y . n A 1 56 MET 56 56 56 MET MET Y . n A 1 57 ASP 57 57 57 ASP ASP Y . n A 1 58 ILE 58 58 58 ILE ILE Y . n A 1 59 VAL 59 59 59 VAL VAL Y . n A 1 60 MET 60 60 60 MET MET Y . n A 1 61 PRO 61 61 61 PRO PRO Y . n A 1 62 GLU 62 62 62 GLU GLU Y . n A 1 63 THR 63 63 63 THR THR Y . n A 1 64 ASP 64 64 64 ASP ASP Y . n A 1 65 GLY 65 65 65 GLY GLY Y . n A 1 66 ILE 66 66 66 ILE ILE Y . n A 1 67 THR 67 67 67 THR THR Y . n A 1 68 ALA 68 68 68 ALA ALA Y . n A 1 69 THR 69 69 69 THR THR Y . n A 1 70 LYS 70 70 70 LYS LYS Y . n A 1 71 ALA 71 71 71 ALA ALA Y . n A 1 72 ILE 72 72 72 ILE ILE Y . n A 1 73 LYS 73 73 73 LYS LYS Y . n A 1 74 GLU 74 74 74 GLU GLU Y . n A 1 75 LYS 75 75 75 LYS LYS Y . n A 1 76 THR 76 76 76 THR THR Y . n A 1 77 PRO 77 77 77 PRO PRO Y . n A 1 78 GLU 78 78 78 GLU GLU Y . n A 1 79 ILE 79 79 79 ILE ILE Y . n A 1 80 LYS 80 80 80 LYS LYS Y . n A 1 81 ILE 81 81 81 ILE ILE Y . n A 1 82 VAL 82 82 82 VAL VAL Y . n A 1 83 MET 83 83 83 MET MET Y . n A 1 84 CYS 84 84 84 CYS CYS Y . n A 1 85 THR 85 85 85 THR THR Y . n A 1 86 SER 86 86 86 SER SER Y . n A 1 87 VAL 87 87 87 VAL VAL Y . n A 1 88 ASP 88 88 88 ASP ASP Y . n A 1 89 GLN 89 89 89 GLN GLN Y . n A 1 90 GLU 90 90 90 GLU GLU Y . n A 1 91 GLN 91 91 91 GLN GLN Y . n A 1 92 LYS 92 92 92 LYS LYS Y . n A 1 93 MET 93 93 93 MET MET Y . n A 1 94 ILE 94 94 94 ILE ILE Y . n A 1 95 ASP 95 95 95 ASP ASP Y . n A 1 96 ALA 96 96 96 ALA ALA Y . n A 1 97 VAL 97 97 97 VAL VAL Y . n A 1 98 ASN 98 98 98 ASN ASN Y . n A 1 99 ALA 99 99 99 ALA ALA Y . n A 1 100 GLY 100 100 100 GLY GLY Y . n A 1 101 ALA 101 101 101 ALA ALA Y . n A 1 102 ASP 102 102 102 ASP ASP Y . n A 1 103 GLY 103 103 103 GLY GLY Y . n A 1 104 TYR 104 104 104 TYR TYR Y . n A 1 105 ILE 105 105 105 ILE ILE Y . n A 1 106 VAL 106 106 106 VAL VAL Y . n A 1 107 LYS 107 107 107 LYS LYS Y . n A 1 108 PRO 108 108 108 PRO PRO Y . n A 1 109 PHE 109 109 109 PHE PHE Y . n A 1 110 GLN 110 110 110 GLN GLN Y . n A 1 111 ALA 111 111 111 ALA ALA Y . n A 1 112 PRO 112 112 112 PRO PRO Y . n A 1 113 LYS 113 113 113 LYS LYS Y . n A 1 114 ILE 114 114 114 ILE ILE Y . n A 1 115 LEU 115 115 115 LEU LEU Y . n A 1 116 GLU 116 116 116 GLU GLU Y . n A 1 117 GLN 117 117 117 GLN GLN Y . n A 1 118 PHE 118 118 118 PHE PHE Y . n A 1 119 ASN 119 119 119 ASN ASN Y . n A 1 120 LYS 120 120 120 LYS LYS Y . n A 1 121 LEU 121 121 121 LEU LEU Y . n A 1 122 PHE 122 122 122 PHE PHE Y . n A 1 123 PRO 123 123 123 PRO PRO Y . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 201 1 MG MG Y . C 3 BEF 1 202 1 BEF BEF Y . D 4 HOH 1 301 3 HOH HOH Y . D 4 HOH 2 302 1 HOH HOH Y . D 4 HOH 3 303 2 HOH HOH Y . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6EKH _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.332 _cell.length_a_esd ? _cell.length_b 71.332 _cell.length_b_esd ? _cell.length_c 77.115 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6EKH _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6EKH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 70.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M NaCl, 0.1 M HEPES pH 7.5, 20 % PEG 3000 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-09-02 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.966 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.966 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6EKH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.65 _reflns.d_resolution_low 48.21 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6584 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.9 _reflns.pdbx_Rmerge_I_obs 0.037 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.65 _reflns_shell.d_res_low 2.81 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 659 _reflns_shell.percent_possible_all 94.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.183 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.95 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6EKH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.654 _refine.ls_d_res_low 35.67 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6495 _refine.ls_number_reflns_R_free 327 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.54 _refine.ls_percent_reflns_R_free 5.03 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2859 _refine.ls_R_factor_R_free 0.3150 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2844 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6EKG _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 40.32 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.31 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 928 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 3 _refine_hist.number_atoms_total 936 _refine_hist.d_res_high 2.654 _refine_hist.d_res_low 35.67 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 948 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.657 ? 1268 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 2.990 ? 593 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 155 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 160 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6544 3.3441 . . 163 3094 97.00 . . . 0.3526 . 0.3450 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3441 48.2209 . . 164 3074 92.00 . . . 0.3042 . 0.2664 . . . . . . . . . . # _struct.entry_id 6EKH _struct.title 'Crystal structure of activated CheY from Methanoccocus maripaludis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6EKH _struct_keywords.text 'Chemotaxis, archaea, phosphorylation, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6LYQ5_METMP _struct_ref.pdbx_db_accession Q6LYQ5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASIVKTMIVDDSAFMRNILKRILSTTNKYVVIGEAANGADAIKMAEELQPDLISMDIVMPETDGITATKAIKEKTPEIK IVMCTSVDQEQKMIDAVNAGADGYIVKPFQAPKILEQFNKLFP ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6EKH _struct_ref_seq.pdbx_strand_id Y _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6LYQ5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 123 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 310 ? 1 MORE -7 ? 1 'SSA (A^2)' 6330 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 13 ? LEU A 24 ? SER Y 13 LEU Y 24 1 ? 12 HELX_P HELX_P2 AA2 ASN A 38 ? GLN A 50 ? ASN Y 38 GLN Y 50 1 ? 13 HELX_P HELX_P3 AA3 ASP A 64 ? THR A 76 ? ASP Y 64 THR Y 76 1 ? 13 HELX_P HELX_P4 AA4 GLN A 89 ? ALA A 99 ? GLN Y 89 ALA Y 99 1 ? 11 HELX_P HELX_P5 AA5 GLN A 110 ? PHE A 122 ? GLN Y 110 PHE Y 122 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 12 OD1 ? ? ? 1_555 B MG . MG ? ? Y ASP 12 Y MG 201 1_555 ? ? ? ? ? ? ? 2.105 ? ? metalc2 metalc ? ? A ASP 12 OD2 ? ? ? 1_555 B MG . MG ? ? Y ASP 12 Y MG 201 1_555 ? ? ? ? ? ? ? 2.206 ? ? metalc3 metalc ? ? A ASP 57 OD2 ? ? ? 1_555 B MG . MG ? ? Y ASP 57 Y MG 201 1_555 ? ? ? ? ? ? ? 2.258 ? ? metalc4 metalc ? ? A ASP 57 OD1 ? ? ? 1_555 C BEF . BE ? ? Y ASP 57 Y BEF 202 1_555 ? ? ? ? ? ? ? 1.433 ? ? metalc5 metalc ? ? A ASP 57 OD2 ? ? ? 1_555 C BEF . BE ? ? Y ASP 57 Y BEF 202 1_555 ? ? ? ? ? ? ? 1.744 ? ? metalc6 metalc ? ? A VAL 59 O ? ? ? 1_555 B MG . MG ? ? Y VAL 59 Y MG 201 1_555 ? ? ? ? ? ? ? 2.109 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 12 ? Y ASP 12 ? 1_555 MG ? B MG . ? Y MG 201 ? 1_555 OD2 ? A ASP 12 ? Y ASP 12 ? 1_555 61.2 ? 2 OD1 ? A ASP 12 ? Y ASP 12 ? 1_555 MG ? B MG . ? Y MG 201 ? 1_555 OD2 ? A ASP 57 ? Y ASP 57 ? 1_555 64.1 ? 3 OD2 ? A ASP 12 ? Y ASP 12 ? 1_555 MG ? B MG . ? Y MG 201 ? 1_555 OD2 ? A ASP 57 ? Y ASP 57 ? 1_555 125.1 ? 4 OD1 ? A ASP 12 ? Y ASP 12 ? 1_555 MG ? B MG . ? Y MG 201 ? 1_555 O ? A VAL 59 ? Y VAL 59 ? 1_555 100.9 ? 5 OD2 ? A ASP 12 ? Y ASP 12 ? 1_555 MG ? B MG . ? Y MG 201 ? 1_555 O ? A VAL 59 ? Y VAL 59 ? 1_555 108.8 ? 6 OD2 ? A ASP 57 ? Y ASP 57 ? 1_555 MG ? B MG . ? Y MG 201 ? 1_555 O ? A VAL 59 ? Y VAL 59 ? 1_555 76.2 ? 7 OD1 ? A ASP 57 ? Y ASP 57 ? 1_555 BE ? C BEF . ? Y BEF 202 ? 1_555 F1 ? C BEF . ? Y BEF 202 ? 1_555 159.3 ? 8 OD1 ? A ASP 57 ? Y ASP 57 ? 1_555 BE ? C BEF . ? Y BEF 202 ? 1_555 F2 ? C BEF . ? Y BEF 202 ? 1_555 61.1 ? 9 F1 ? C BEF . ? Y BEF 202 ? 1_555 BE ? C BEF . ? Y BEF 202 ? 1_555 F2 ? C BEF . ? Y BEF 202 ? 1_555 110.2 ? 10 OD1 ? A ASP 57 ? Y ASP 57 ? 1_555 BE ? C BEF . ? Y BEF 202 ? 1_555 F3 ? C BEF . ? Y BEF 202 ? 1_555 62.0 ? 11 F1 ? C BEF . ? Y BEF 202 ? 1_555 BE ? C BEF . ? Y BEF 202 ? 1_555 F3 ? C BEF . ? Y BEF 202 ? 1_555 107.0 ? 12 F2 ? C BEF . ? Y BEF 202 ? 1_555 BE ? C BEF . ? Y BEF 202 ? 1_555 F3 ? C BEF . ? Y BEF 202 ? 1_555 106.7 ? 13 OD1 ? A ASP 57 ? Y ASP 57 ? 1_555 BE ? C BEF . ? Y BEF 202 ? 1_555 OD2 ? A ASP 57 ? Y ASP 57 ? 1_555 86.1 ? 14 F1 ? C BEF . ? Y BEF 202 ? 1_555 BE ? C BEF . ? Y BEF 202 ? 1_555 OD2 ? A ASP 57 ? Y ASP 57 ? 1_555 114.5 ? 15 F2 ? C BEF . ? Y BEF 202 ? 1_555 BE ? C BEF . ? Y BEF 202 ? 1_555 OD2 ? A ASP 57 ? Y ASP 57 ? 1_555 107.6 ? 16 F3 ? C BEF . ? Y BEF 202 ? 1_555 BE ? C BEF . ? Y BEF 202 ? 1_555 OD2 ? A ASP 57 ? Y ASP 57 ? 1_555 110.6 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 107 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 107 _struct_mon_prot_cis.auth_asym_id Y _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 108 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 108 _struct_mon_prot_cis.pdbx_auth_asym_id_2 Y _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.53 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 30 ? ALA A 36 ? TYR Y 30 ALA Y 36 AA1 2 VAL A 5 ? VAL A 10 ? VAL Y 5 VAL Y 10 AA1 3 LEU A 53 ? MET A 56 ? LEU Y 53 MET Y 56 AA1 4 LYS A 80 ? THR A 85 ? LYS Y 80 THR Y 85 AA1 5 GLY A 103 ? VAL A 106 ? GLY Y 103 VAL Y 106 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 33 ? O ILE Y 33 N THR A 7 ? N THR Y 7 AA1 2 3 N VAL A 10 ? N VAL Y 10 O SER A 55 ? O SER Y 55 AA1 3 4 N MET A 56 ? N MET Y 56 O CYS A 84 ? O CYS Y 84 AA1 4 5 N MET A 83 ? N MET Y 83 O GLY A 103 ? O GLY Y 103 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software Y MG 201 ? 4 'binding site for residue MG Y 201' AC2 Software Y BEF 202 ? 10 'binding site for residue BEF Y 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASP A 12 ? ASP Y 12 . ? 1_555 ? 2 AC1 4 ASP A 57 ? ASP Y 57 . ? 1_555 ? 3 AC1 4 VAL A 59 ? VAL Y 59 . ? 1_555 ? 4 AC1 4 BEF C . ? BEF Y 202 . ? 1_555 ? 5 AC2 10 ASP A 11 ? ASP Y 11 . ? 1_555 ? 6 AC2 10 ASP A 12 ? ASP Y 12 . ? 1_555 ? 7 AC2 10 ASP A 57 ? ASP Y 57 . ? 1_555 ? 8 AC2 10 ILE A 58 ? ILE Y 58 . ? 1_555 ? 9 AC2 10 VAL A 59 ? VAL Y 59 . ? 1_555 ? 10 AC2 10 THR A 85 ? THR Y 85 . ? 1_555 ? 11 AC2 10 SER A 86 ? SER Y 86 . ? 1_555 ? 12 AC2 10 LYS A 107 ? LYS Y 107 . ? 1_555 ? 13 AC2 10 MG B . ? MG Y 201 . ? 1_555 ? 14 AC2 10 HOH D . ? HOH Y 302 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 ND2 Y ASN 38 ? ? CB Y GLU 62 ? ? 1.51 2 1 OD1 Y ASP 57 ? ? F2 Y BEF 202 ? ? 1.53 3 1 OD1 Y ASP 57 ? ? F3 Y BEF 202 ? ? 1.54 4 1 CG Y ASP 57 ? ? BE Y BEF 202 ? ? 1.76 5 1 ND2 Y ASN 38 ? ? N Y GLU 62 ? ? 1.88 6 1 ND2 Y ASN 38 ? ? CA Y GLU 62 ? ? 1.93 7 1 CG Y ASN 38 ? ? CB Y GLU 62 ? ? 2.17 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 Y _pdbx_validate_rmsd_angle.auth_comp_id_1 GLN _pdbx_validate_rmsd_angle.auth_seq_id_1 50 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 Y _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 51 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 Y _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 51 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.89 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 10.59 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 Y MET 1 ? A MET 1 2 1 Y 1 Y ALA 2 ? A ALA 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BEF BE BE N N 74 BEF F1 F N N 75 BEF F2 F N N 76 BEF F3 F N N 77 CYS N N N N 78 CYS CA C N R 79 CYS C C N N 80 CYS O O N N 81 CYS CB C N N 82 CYS SG S N N 83 CYS OXT O N N 84 CYS H H N N 85 CYS H2 H N N 86 CYS HA H N N 87 CYS HB2 H N N 88 CYS HB3 H N N 89 CYS HG H N N 90 CYS HXT H N N 91 GLN N N N N 92 GLN CA C N S 93 GLN C C N N 94 GLN O O N N 95 GLN CB C N N 96 GLN CG C N N 97 GLN CD C N N 98 GLN OE1 O N N 99 GLN NE2 N N N 100 GLN OXT O N N 101 GLN H H N N 102 GLN H2 H N N 103 GLN HA H N N 104 GLN HB2 H N N 105 GLN HB3 H N N 106 GLN HG2 H N N 107 GLN HG3 H N N 108 GLN HE21 H N N 109 GLN HE22 H N N 110 GLN HXT H N N 111 GLU N N N N 112 GLU CA C N S 113 GLU C C N N 114 GLU O O N N 115 GLU CB C N N 116 GLU CG C N N 117 GLU CD C N N 118 GLU OE1 O N N 119 GLU OE2 O N N 120 GLU OXT O N N 121 GLU H H N N 122 GLU H2 H N N 123 GLU HA H N N 124 GLU HB2 H N N 125 GLU HB3 H N N 126 GLU HG2 H N N 127 GLU HG3 H N N 128 GLU HE2 H N N 129 GLU HXT H N N 130 GLY N N N N 131 GLY CA C N N 132 GLY C C N N 133 GLY O O N N 134 GLY OXT O N N 135 GLY H H N N 136 GLY H2 H N N 137 GLY HA2 H N N 138 GLY HA3 H N N 139 GLY HXT H N N 140 HOH O O N N 141 HOH H1 H N N 142 HOH H2 H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 MG MG MG N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 PRO N N N N 257 PRO CA C N S 258 PRO C C N N 259 PRO O O N N 260 PRO CB C N N 261 PRO CG C N N 262 PRO CD C N N 263 PRO OXT O N N 264 PRO H H N N 265 PRO HA H N N 266 PRO HB2 H N N 267 PRO HB3 H N N 268 PRO HG2 H N N 269 PRO HG3 H N N 270 PRO HD2 H N N 271 PRO HD3 H N N 272 PRO HXT H N N 273 SER N N N N 274 SER CA C N S 275 SER C C N N 276 SER O O N N 277 SER CB C N N 278 SER OG O N N 279 SER OXT O N N 280 SER H H N N 281 SER H2 H N N 282 SER HA H N N 283 SER HB2 H N N 284 SER HB3 H N N 285 SER HG H N N 286 SER HXT H N N 287 THR N N N N 288 THR CA C N S 289 THR C C N N 290 THR O O N N 291 THR CB C N R 292 THR OG1 O N N 293 THR CG2 C N N 294 THR OXT O N N 295 THR H H N N 296 THR H2 H N N 297 THR HA H N N 298 THR HB H N N 299 THR HG1 H N N 300 THR HG21 H N N 301 THR HG22 H N N 302 THR HG23 H N N 303 THR HXT H N N 304 TYR N N N N 305 TYR CA C N S 306 TYR C C N N 307 TYR O O N N 308 TYR CB C N N 309 TYR CG C Y N 310 TYR CD1 C Y N 311 TYR CD2 C Y N 312 TYR CE1 C Y N 313 TYR CE2 C Y N 314 TYR CZ C Y N 315 TYR OH O N N 316 TYR OXT O N N 317 TYR H H N N 318 TYR H2 H N N 319 TYR HA H N N 320 TYR HB2 H N N 321 TYR HB3 H N N 322 TYR HD1 H N N 323 TYR HD2 H N N 324 TYR HE1 H N N 325 TYR HE2 H N N 326 TYR HH H N N 327 TYR HXT H N N 328 VAL N N N N 329 VAL CA C N S 330 VAL C C N N 331 VAL O O N N 332 VAL CB C N N 333 VAL CG1 C N N 334 VAL CG2 C N N 335 VAL OXT O N N 336 VAL H H N N 337 VAL H2 H N N 338 VAL HA H N N 339 VAL HB H N N 340 VAL HG11 H N N 341 VAL HG12 H N N 342 VAL HG13 H N N 343 VAL HG21 H N N 344 VAL HG22 H N N 345 VAL HG23 H N N 346 VAL HXT H N N 347 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BEF BE F1 sing N N 70 BEF BE F2 sing N N 71 BEF BE F3 sing N N 72 CYS N CA sing N N 73 CYS N H sing N N 74 CYS N H2 sing N N 75 CYS CA C sing N N 76 CYS CA CB sing N N 77 CYS CA HA sing N N 78 CYS C O doub N N 79 CYS C OXT sing N N 80 CYS CB SG sing N N 81 CYS CB HB2 sing N N 82 CYS CB HB3 sing N N 83 CYS SG HG sing N N 84 CYS OXT HXT sing N N 85 GLN N CA sing N N 86 GLN N H sing N N 87 GLN N H2 sing N N 88 GLN CA C sing N N 89 GLN CA CB sing N N 90 GLN CA HA sing N N 91 GLN C O doub N N 92 GLN C OXT sing N N 93 GLN CB CG sing N N 94 GLN CB HB2 sing N N 95 GLN CB HB3 sing N N 96 GLN CG CD sing N N 97 GLN CG HG2 sing N N 98 GLN CG HG3 sing N N 99 GLN CD OE1 doub N N 100 GLN CD NE2 sing N N 101 GLN NE2 HE21 sing N N 102 GLN NE2 HE22 sing N N 103 GLN OXT HXT sing N N 104 GLU N CA sing N N 105 GLU N H sing N N 106 GLU N H2 sing N N 107 GLU CA C sing N N 108 GLU CA CB sing N N 109 GLU CA HA sing N N 110 GLU C O doub N N 111 GLU C OXT sing N N 112 GLU CB CG sing N N 113 GLU CB HB2 sing N N 114 GLU CB HB3 sing N N 115 GLU CG CD sing N N 116 GLU CG HG2 sing N N 117 GLU CG HG3 sing N N 118 GLU CD OE1 doub N N 119 GLU CD OE2 sing N N 120 GLU OE2 HE2 sing N N 121 GLU OXT HXT sing N N 122 GLY N CA sing N N 123 GLY N H sing N N 124 GLY N H2 sing N N 125 GLY CA C sing N N 126 GLY CA HA2 sing N N 127 GLY CA HA3 sing N N 128 GLY C O doub N N 129 GLY C OXT sing N N 130 GLY OXT HXT sing N N 131 HOH O H1 sing N N 132 HOH O H2 sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 MET N CA sing N N 200 MET N H sing N N 201 MET N H2 sing N N 202 MET CA C sing N N 203 MET CA CB sing N N 204 MET CA HA sing N N 205 MET C O doub N N 206 MET C OXT sing N N 207 MET CB CG sing N N 208 MET CB HB2 sing N N 209 MET CB HB3 sing N N 210 MET CG SD sing N N 211 MET CG HG2 sing N N 212 MET CG HG3 sing N N 213 MET SD CE sing N N 214 MET CE HE1 sing N N 215 MET CE HE2 sing N N 216 MET CE HE3 sing N N 217 MET OXT HXT sing N N 218 PHE N CA sing N N 219 PHE N H sing N N 220 PHE N H2 sing N N 221 PHE CA C sing N N 222 PHE CA CB sing N N 223 PHE CA HA sing N N 224 PHE C O doub N N 225 PHE C OXT sing N N 226 PHE CB CG sing N N 227 PHE CB HB2 sing N N 228 PHE CB HB3 sing N N 229 PHE CG CD1 doub Y N 230 PHE CG CD2 sing Y N 231 PHE CD1 CE1 sing Y N 232 PHE CD1 HD1 sing N N 233 PHE CD2 CE2 doub Y N 234 PHE CD2 HD2 sing N N 235 PHE CE1 CZ doub Y N 236 PHE CE1 HE1 sing N N 237 PHE CE2 CZ sing Y N 238 PHE CE2 HE2 sing N N 239 PHE CZ HZ sing N N 240 PHE OXT HXT sing N N 241 PRO N CA sing N N 242 PRO N CD sing N N 243 PRO N H sing N N 244 PRO CA C sing N N 245 PRO CA CB sing N N 246 PRO CA HA sing N N 247 PRO C O doub N N 248 PRO C OXT sing N N 249 PRO CB CG sing N N 250 PRO CB HB2 sing N N 251 PRO CB HB3 sing N N 252 PRO CG CD sing N N 253 PRO CG HG2 sing N N 254 PRO CG HG3 sing N N 255 PRO CD HD2 sing N N 256 PRO CD HD3 sing N N 257 PRO OXT HXT sing N N 258 SER N CA sing N N 259 SER N H sing N N 260 SER N H2 sing N N 261 SER CA C sing N N 262 SER CA CB sing N N 263 SER CA HA sing N N 264 SER C O doub N N 265 SER C OXT sing N N 266 SER CB OG sing N N 267 SER CB HB2 sing N N 268 SER CB HB3 sing N N 269 SER OG HG sing N N 270 SER OXT HXT sing N N 271 THR N CA sing N N 272 THR N H sing N N 273 THR N H2 sing N N 274 THR CA C sing N N 275 THR CA CB sing N N 276 THR CA HA sing N N 277 THR C O doub N N 278 THR C OXT sing N N 279 THR CB OG1 sing N N 280 THR CB CG2 sing N N 281 THR CB HB sing N N 282 THR OG1 HG1 sing N N 283 THR CG2 HG21 sing N N 284 THR CG2 HG22 sing N N 285 THR CG2 HG23 sing N N 286 THR OXT HXT sing N N 287 TYR N CA sing N N 288 TYR N H sing N N 289 TYR N H2 sing N N 290 TYR CA C sing N N 291 TYR CA CB sing N N 292 TYR CA HA sing N N 293 TYR C O doub N N 294 TYR C OXT sing N N 295 TYR CB CG sing N N 296 TYR CB HB2 sing N N 297 TYR CB HB3 sing N N 298 TYR CG CD1 doub Y N 299 TYR CG CD2 sing Y N 300 TYR CD1 CE1 sing Y N 301 TYR CD1 HD1 sing N N 302 TYR CD2 CE2 doub Y N 303 TYR CD2 HD2 sing N N 304 TYR CE1 CZ doub Y N 305 TYR CE1 HE1 sing N N 306 TYR CE2 CZ sing Y N 307 TYR CE2 HE2 sing N N 308 TYR CZ OH sing N N 309 TYR OH HH sing N N 310 TYR OXT HXT sing N N 311 VAL N CA sing N N 312 VAL N H sing N N 313 VAL N H2 sing N N 314 VAL CA C sing N N 315 VAL CA CB sing N N 316 VAL CA HA sing N N 317 VAL C O doub N N 318 VAL C OXT sing N N 319 VAL CB CG1 sing N N 320 VAL CB CG2 sing N N 321 VAL CB HB sing N N 322 VAL CG1 HG11 sing N N 323 VAL CG1 HG12 sing N N 324 VAL CG1 HG13 sing N N 325 VAL CG2 HG21 sing N N 326 VAL CG2 HG22 sing N N 327 VAL CG2 HG23 sing N N 328 VAL OXT HXT sing N N 329 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id BEF _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id BEF _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6EKG _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6EKH _atom_sites.fract_transf_matrix[1][1] 0.014019 _atom_sites.fract_transf_matrix[1][2] 0.008094 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016188 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012968 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol BE C F MG N O S # loop_