data_6EQJ # _entry.id 6EQJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6EQJ pdb_00006eqj 10.2210/pdb6eqj/pdb WWPDB D_1200007068 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-20 2 'Structure model' 1 1 2018-10-24 3 'Structure model' 1 2 2018-11-07 4 'Structure model' 1 3 2018-11-14 5 'Structure model' 1 4 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' citation 5 4 'Structure model' pdbx_database_proc 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.pdbx_database_id_PubMed' 10 3 'Structure model' '_citation.title' 11 4 'Structure model' '_citation.journal_volume' 12 4 'Structure model' '_citation.page_first' 13 4 'Structure model' '_citation.page_last' 14 5 'Structure model' '_database_2.pdbx_DOI' 15 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6EQJ _pdbx_database_status.recvd_initial_deposition_date 2017-10-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bailey, H.J.' 1 ? 'Kopec, J.' 2 ? 'Bilyard, M.K.' 3 ? 'Bezerra, G.A.' 4 ? 'Seo Lee, S.' 5 ? 'Arrowsmith, C.H.' 6 ? 'Edwards, A.M.' 7 ? 'Bountra, C.' 8 ? 'Davis, B.G.' 9 ? 'Yue, W.W.' 10 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 563 _citation.language ? _citation.page_first 235 _citation.page_last 240 _citation.title 'Palladium-mediated enzyme activation suggests multiphase initiation of glycogenesis.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-018-0644-7 _citation.pdbx_database_id_PubMed 30356213 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bilyard, M.K.' 1 ? primary 'Bailey, H.J.' 2 ? primary 'Raich, L.' 3 ? primary 'Gafitescu, M.A.' 4 ? primary 'Machida, T.' 5 ? primary 'Iglesias-Fernandez, J.' 6 ? primary 'Lee, S.S.' 7 ? primary 'Spicer, C.D.' 8 ? primary 'Rovira, C.' 9 ? primary 'Yue, W.W.' 10 ? primary 'Davis, B.G.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Glycogenin-1 29721.533 1 2.4.1.186 ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 5 ? ? ? ? 3 water nat water 18.015 42 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name GN1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPE LGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSF DGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISI(PHI)SYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEA HDPNMTHPEFLILWWNIFTTNVLPLLQ ; _entity_poly.pdbx_seq_one_letter_code_can ;SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPE LGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSF DGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIFSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPN MTHPEFLILWWNIFTTNVLPLLQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 THR n 1 4 ASP n 1 5 GLN n 1 6 ALA n 1 7 PHE n 1 8 VAL n 1 9 THR n 1 10 LEU n 1 11 THR n 1 12 THR n 1 13 ASN n 1 14 ASP n 1 15 ALA n 1 16 TYR n 1 17 ALA n 1 18 LYS n 1 19 GLY n 1 20 ALA n 1 21 LEU n 1 22 VAL n 1 23 LEU n 1 24 GLY n 1 25 SER n 1 26 SER n 1 27 LEU n 1 28 LYS n 1 29 GLN n 1 30 HIS n 1 31 ARG n 1 32 THR n 1 33 THR n 1 34 ARG n 1 35 ARG n 1 36 LEU n 1 37 VAL n 1 38 VAL n 1 39 LEU n 1 40 ALA n 1 41 THR n 1 42 PRO n 1 43 GLN n 1 44 VAL n 1 45 SER n 1 46 ASP n 1 47 SER n 1 48 MET n 1 49 ARG n 1 50 LYS n 1 51 VAL n 1 52 LEU n 1 53 GLU n 1 54 THR n 1 55 VAL n 1 56 PHE n 1 57 ASP n 1 58 GLU n 1 59 VAL n 1 60 ILE n 1 61 MET n 1 62 VAL n 1 63 ASP n 1 64 VAL n 1 65 LEU n 1 66 ASP n 1 67 SER n 1 68 GLY n 1 69 ASP n 1 70 SER n 1 71 ALA n 1 72 HIS n 1 73 LEU n 1 74 THR n 1 75 LEU n 1 76 MET n 1 77 LYS n 1 78 ARG n 1 79 PRO n 1 80 GLU n 1 81 LEU n 1 82 GLY n 1 83 VAL n 1 84 THR n 1 85 LEU n 1 86 THR n 1 87 LYS n 1 88 LEU n 1 89 HIS n 1 90 CYS n 1 91 TRP n 1 92 SER n 1 93 LEU n 1 94 THR n 1 95 GLN n 1 96 TYR n 1 97 SER n 1 98 LYS n 1 99 CYS n 1 100 VAL n 1 101 PHE n 1 102 MET n 1 103 ASP n 1 104 ALA n 1 105 ASP n 1 106 THR n 1 107 LEU n 1 108 VAL n 1 109 LEU n 1 110 ALA n 1 111 ASN n 1 112 ILE n 1 113 ASP n 1 114 ASP n 1 115 LEU n 1 116 PHE n 1 117 ASP n 1 118 ARG n 1 119 GLU n 1 120 GLU n 1 121 LEU n 1 122 SER n 1 123 ALA n 1 124 ALA n 1 125 PRO n 1 126 ASP n 1 127 PRO n 1 128 GLY n 1 129 TRP n 1 130 PRO n 1 131 ASP n 1 132 CYS n 1 133 PHE n 1 134 ASN n 1 135 SER n 1 136 GLY n 1 137 VAL n 1 138 PHE n 1 139 VAL n 1 140 TYR n 1 141 GLN n 1 142 PRO n 1 143 SER n 1 144 VAL n 1 145 GLU n 1 146 THR n 1 147 TYR n 1 148 ASN n 1 149 GLN n 1 150 LEU n 1 151 LEU n 1 152 HIS n 1 153 LEU n 1 154 ALA n 1 155 SER n 1 156 GLU n 1 157 GLN n 1 158 GLY n 1 159 SER n 1 160 PHE n 1 161 ASP n 1 162 GLY n 1 163 GLY n 1 164 ASP n 1 165 GLN n 1 166 GLY n 1 167 ILE n 1 168 LEU n 1 169 ASN n 1 170 THR n 1 171 PHE n 1 172 PHE n 1 173 SER n 1 174 SER n 1 175 TRP n 1 176 ALA n 1 177 THR n 1 178 THR n 1 179 ASP n 1 180 ILE n 1 181 ARG n 1 182 LYS n 1 183 HIS n 1 184 LEU n 1 185 PRO n 1 186 PHE n 1 187 ILE n 1 188 TYR n 1 189 ASN n 1 190 LEU n 1 191 SER n 1 192 SER n 1 193 ILE n 1 194 SER n 1 195 ILE n 1 196 PHI n 1 197 SER n 1 198 TYR n 1 199 LEU n 1 200 PRO n 1 201 ALA n 1 202 PHE n 1 203 LYS n 1 204 VAL n 1 205 PHE n 1 206 GLY n 1 207 ALA n 1 208 SER n 1 209 ALA n 1 210 LYS n 1 211 VAL n 1 212 VAL n 1 213 HIS n 1 214 PHE n 1 215 LEU n 1 216 GLY n 1 217 ARG n 1 218 VAL n 1 219 LYS n 1 220 PRO n 1 221 TRP n 1 222 ASN n 1 223 TYR n 1 224 THR n 1 225 TYR n 1 226 ASP n 1 227 PRO n 1 228 LYS n 1 229 THR n 1 230 LYS n 1 231 SER n 1 232 VAL n 1 233 LYS n 1 234 SER n 1 235 GLU n 1 236 ALA n 1 237 HIS n 1 238 ASP n 1 239 PRO n 1 240 ASN n 1 241 MET n 1 242 THR n 1 243 HIS n 1 244 PRO n 1 245 GLU n 1 246 PHE n 1 247 LEU n 1 248 ILE n 1 249 LEU n 1 250 TRP n 1 251 TRP n 1 252 ASN n 1 253 ILE n 1 254 PHE n 1 255 THR n 1 256 THR n 1 257 ASN n 1 258 VAL n 1 259 LEU n 1 260 PRO n 1 261 LEU n 1 262 LEU n 1 263 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 263 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GYG1, GYG' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PHI 'L-peptide linking' n IODO-PHENYLALANINE ? 'C9 H10 I N O2' 291.086 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 0 ? ? ? A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 THR 3 2 2 THR THR A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 GLN 5 4 4 GLN GLN A . n A 1 6 ALA 6 5 5 ALA ALA A . n A 1 7 PHE 7 6 6 PHE PHE A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 THR 9 8 8 THR THR A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 THR 11 10 10 THR THR A . n A 1 12 THR 12 11 11 THR THR A . n A 1 13 ASN 13 12 12 ASN ASN A . n A 1 14 ASP 14 13 13 ASP ASP A . n A 1 15 ALA 15 14 14 ALA ALA A . n A 1 16 TYR 16 15 15 TYR TYR A . n A 1 17 ALA 17 16 16 ALA ALA A . n A 1 18 LYS 18 17 17 LYS LYS A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 LEU 21 20 20 LEU LEU A . n A 1 22 VAL 22 21 21 VAL VAL A . n A 1 23 LEU 23 22 22 LEU LEU A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 SER 25 24 24 SER SER A . n A 1 26 SER 26 25 25 SER SER A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 LYS 28 27 27 LYS LYS A . n A 1 29 GLN 29 28 28 GLN GLN A . n A 1 30 HIS 30 29 29 HIS HIS A . n A 1 31 ARG 31 30 30 ARG ARG A . n A 1 32 THR 32 31 31 THR THR A . n A 1 33 THR 33 32 32 THR THR A . n A 1 34 ARG 34 33 33 ARG ARG A . n A 1 35 ARG 35 34 34 ARG ARG A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 VAL 37 36 36 VAL VAL A . n A 1 38 VAL 38 37 37 VAL VAL A . n A 1 39 LEU 39 38 38 LEU LEU A . n A 1 40 ALA 40 39 39 ALA ALA A . n A 1 41 THR 41 40 40 THR THR A . n A 1 42 PRO 42 41 41 PRO PRO A . n A 1 43 GLN 43 42 42 GLN GLN A . n A 1 44 VAL 44 43 43 VAL VAL A . n A 1 45 SER 45 44 44 SER SER A . n A 1 46 ASP 46 45 45 ASP ASP A . n A 1 47 SER 47 46 46 SER SER A . n A 1 48 MET 48 47 47 MET MET A . n A 1 49 ARG 49 48 48 ARG ARG A . n A 1 50 LYS 50 49 49 LYS LYS A . n A 1 51 VAL 51 50 50 VAL VAL A . n A 1 52 LEU 52 51 51 LEU LEU A . n A 1 53 GLU 53 52 52 GLU GLU A . n A 1 54 THR 54 53 53 THR THR A . n A 1 55 VAL 55 54 54 VAL VAL A . n A 1 56 PHE 56 55 55 PHE PHE A . n A 1 57 ASP 57 56 56 ASP ASP A . n A 1 58 GLU 58 57 57 GLU GLU A . n A 1 59 VAL 59 58 58 VAL VAL A . n A 1 60 ILE 60 59 59 ILE ILE A . n A 1 61 MET 61 60 60 MET MET A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 ASP 63 62 62 ASP ASP A . n A 1 64 VAL 64 63 63 VAL VAL A . n A 1 65 LEU 65 64 64 LEU LEU A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 SER 67 66 66 SER SER A . n A 1 68 GLY 68 67 67 GLY GLY A . n A 1 69 ASP 69 68 68 ASP ASP A . n A 1 70 SER 70 69 69 SER SER A . n A 1 71 ALA 71 70 70 ALA ALA A . n A 1 72 HIS 72 71 71 HIS HIS A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 THR 74 73 73 THR THR A . n A 1 75 LEU 75 74 74 LEU LEU A . n A 1 76 MET 76 75 75 MET MET A . n A 1 77 LYS 77 76 76 LYS LYS A . n A 1 78 ARG 78 77 77 ARG ARG A . n A 1 79 PRO 79 78 78 PRO PRO A . n A 1 80 GLU 80 79 79 GLU GLU A . n A 1 81 LEU 81 80 80 LEU LEU A . n A 1 82 GLY 82 81 81 GLY GLY A . n A 1 83 VAL 83 82 82 VAL VAL A . n A 1 84 THR 84 83 83 THR THR A . n A 1 85 LEU 85 84 84 LEU LEU A . n A 1 86 THR 86 85 85 THR THR A . n A 1 87 LYS 87 86 86 LYS LYS A . n A 1 88 LEU 88 87 87 LEU LEU A . n A 1 89 HIS 89 88 88 HIS HIS A . n A 1 90 CYS 90 89 89 CYS CYS A . n A 1 91 TRP 91 90 90 TRP TRP A . n A 1 92 SER 92 91 91 SER SER A . n A 1 93 LEU 93 92 92 LEU LEU A . n A 1 94 THR 94 93 93 THR THR A . n A 1 95 GLN 95 94 94 GLN GLN A . n A 1 96 TYR 96 95 95 TYR TYR A . n A 1 97 SER 97 96 96 SER SER A . n A 1 98 LYS 98 97 97 LYS LYS A . n A 1 99 CYS 99 98 98 CYS CYS A . n A 1 100 VAL 100 99 99 VAL VAL A . n A 1 101 PHE 101 100 100 PHE PHE A . n A 1 102 MET 102 101 101 MET MET A . n A 1 103 ASP 103 102 102 ASP ASP A . n A 1 104 ALA 104 103 103 ALA ALA A . n A 1 105 ASP 105 104 104 ASP ASP A . n A 1 106 THR 106 105 105 THR THR A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 VAL 108 107 107 VAL VAL A . n A 1 109 LEU 109 108 108 LEU LEU A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 ASN 111 110 110 ASN ASN A . n A 1 112 ILE 112 111 111 ILE ILE A . n A 1 113 ASP 113 112 112 ASP ASP A . n A 1 114 ASP 114 113 113 ASP ASP A . n A 1 115 LEU 115 114 114 LEU LEU A . n A 1 116 PHE 116 115 115 PHE PHE A . n A 1 117 ASP 117 116 116 ASP ASP A . n A 1 118 ARG 118 117 117 ARG ARG A . n A 1 119 GLU 119 118 118 GLU GLU A . n A 1 120 GLU 120 119 119 GLU GLU A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 SER 122 121 121 SER SER A . n A 1 123 ALA 123 122 122 ALA ALA A . n A 1 124 ALA 124 123 123 ALA ALA A . n A 1 125 PRO 125 124 124 PRO PRO A . n A 1 126 ASP 126 125 125 ASP ASP A . n A 1 127 PRO 127 126 126 PRO PRO A . n A 1 128 GLY 128 127 127 GLY GLY A . n A 1 129 TRP 129 128 128 TRP TRP A . n A 1 130 PRO 130 129 129 PRO PRO A . n A 1 131 ASP 131 130 130 ASP ASP A . n A 1 132 CYS 132 131 131 CYS CYS A . n A 1 133 PHE 133 132 132 PHE PHE A . n A 1 134 ASN 134 133 133 ASN ASN A . n A 1 135 SER 135 134 134 SER SER A . n A 1 136 GLY 136 135 135 GLY GLY A . n A 1 137 VAL 137 136 136 VAL VAL A . n A 1 138 PHE 138 137 137 PHE PHE A . n A 1 139 VAL 139 138 138 VAL VAL A . n A 1 140 TYR 140 139 139 TYR TYR A . n A 1 141 GLN 141 140 140 GLN GLN A . n A 1 142 PRO 142 141 141 PRO PRO A . n A 1 143 SER 143 142 142 SER SER A . n A 1 144 VAL 144 143 143 VAL VAL A . n A 1 145 GLU 145 144 144 GLU GLU A . n A 1 146 THR 146 145 145 THR THR A . n A 1 147 TYR 147 146 146 TYR TYR A . n A 1 148 ASN 148 147 147 ASN ASN A . n A 1 149 GLN 149 148 148 GLN GLN A . n A 1 150 LEU 150 149 149 LEU LEU A . n A 1 151 LEU 151 150 150 LEU LEU A . n A 1 152 HIS 152 151 151 HIS HIS A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 ALA 154 153 153 ALA ALA A . n A 1 155 SER 155 154 154 SER SER A . n A 1 156 GLU 156 155 155 GLU GLU A . n A 1 157 GLN 157 156 156 GLN GLN A . n A 1 158 GLY 158 157 157 GLY GLY A . n A 1 159 SER 159 158 158 SER SER A . n A 1 160 PHE 160 159 159 PHE PHE A . n A 1 161 ASP 161 160 160 ASP ASP A . n A 1 162 GLY 162 161 161 GLY GLY A . n A 1 163 GLY 163 162 162 GLY GLY A . n A 1 164 ASP 164 163 163 ASP ASP A . n A 1 165 GLN 165 164 164 GLN GLN A . n A 1 166 GLY 166 165 165 GLY GLY A . n A 1 167 ILE 167 166 166 ILE ILE A . n A 1 168 LEU 168 167 167 LEU LEU A . n A 1 169 ASN 169 168 168 ASN ASN A . n A 1 170 THR 170 169 169 THR THR A . n A 1 171 PHE 171 170 170 PHE PHE A . n A 1 172 PHE 172 171 171 PHE PHE A . n A 1 173 SER 173 172 172 SER SER A . n A 1 174 SER 174 173 173 SER SER A . n A 1 175 TRP 175 174 174 TRP TRP A . n A 1 176 ALA 176 175 175 ALA ALA A . n A 1 177 THR 177 176 176 THR THR A . n A 1 178 THR 178 177 177 THR THR A . n A 1 179 ASP 179 178 178 ASP ASP A . n A 1 180 ILE 180 179 179 ILE ILE A . n A 1 181 ARG 181 180 180 ARG ARG A . n A 1 182 LYS 182 181 181 LYS LYS A . n A 1 183 HIS 183 182 182 HIS HIS A . n A 1 184 LEU 184 183 183 LEU LEU A . n A 1 185 PRO 185 184 184 PRO PRO A . n A 1 186 PHE 186 185 185 PHE PHE A . n A 1 187 ILE 187 186 186 ILE ILE A . n A 1 188 TYR 188 187 187 TYR TYR A . n A 1 189 ASN 189 188 188 ASN ASN A . n A 1 190 LEU 190 189 189 LEU LEU A . n A 1 191 SER 191 190 190 SER SER A . n A 1 192 SER 192 191 191 SER SER A . n A 1 193 ILE 193 192 192 ILE ILE A . n A 1 194 SER 194 193 ? ? ? A . n A 1 195 ILE 195 194 ? ? ? A . n A 1 196 PHI 196 195 ? ? ? A . n A 1 197 SER 197 196 ? ? ? A . n A 1 198 TYR 198 197 ? ? ? A . n A 1 199 LEU 199 198 198 LEU LEU A . n A 1 200 PRO 200 199 199 PRO PRO A . n A 1 201 ALA 201 200 200 ALA ALA A . n A 1 202 PHE 202 201 201 PHE PHE A . n A 1 203 LYS 203 202 202 LYS LYS A . n A 1 204 VAL 204 203 203 VAL VAL A . n A 1 205 PHE 205 204 204 PHE PHE A . n A 1 206 GLY 206 205 205 GLY GLY A . n A 1 207 ALA 207 206 206 ALA ALA A . n A 1 208 SER 208 207 207 SER SER A . n A 1 209 ALA 209 208 208 ALA ALA A . n A 1 210 LYS 210 209 209 LYS LYS A . n A 1 211 VAL 211 210 210 VAL VAL A . n A 1 212 VAL 212 211 211 VAL VAL A . n A 1 213 HIS 213 212 212 HIS HIS A . n A 1 214 PHE 214 213 213 PHE PHE A . n A 1 215 LEU 215 214 214 LEU LEU A . n A 1 216 GLY 216 215 215 GLY GLY A . n A 1 217 ARG 217 216 216 ARG ARG A . n A 1 218 VAL 218 217 217 VAL VAL A . n A 1 219 LYS 219 218 218 LYS LYS A . n A 1 220 PRO 220 219 219 PRO PRO A . n A 1 221 TRP 221 220 220 TRP TRP A . n A 1 222 ASN 222 221 221 ASN ASN A . n A 1 223 TYR 223 222 222 TYR TYR A . n A 1 224 THR 224 223 223 THR THR A . n A 1 225 TYR 225 224 224 TYR TYR A . n A 1 226 ASP 226 225 225 ASP ASP A . n A 1 227 PRO 227 226 226 PRO PRO A . n A 1 228 LYS 228 227 227 LYS LYS A . n A 1 229 THR 229 228 228 THR THR A . n A 1 230 LYS 230 229 229 LYS LYS A . n A 1 231 SER 231 230 230 SER SER A . n A 1 232 VAL 232 231 231 VAL VAL A . n A 1 233 LYS 233 232 232 LYS LYS A . n A 1 234 SER 234 233 ? ? ? A . n A 1 235 GLU 235 234 ? ? ? A . n A 1 236 ALA 236 235 ? ? ? A . n A 1 237 HIS 237 236 ? ? ? A . n A 1 238 ASP 238 237 ? ? ? A . n A 1 239 PRO 239 238 ? ? ? A . n A 1 240 ASN 240 239 ? ? ? A . n A 1 241 MET 241 240 ? ? ? A . n A 1 242 THR 242 241 ? ? ? A . n A 1 243 HIS 243 242 ? ? ? A . n A 1 244 PRO 244 243 243 PRO PRO A . n A 1 245 GLU 245 244 244 GLU GLU A . n A 1 246 PHE 246 245 245 PHE PHE A . n A 1 247 LEU 247 246 246 LEU LEU A . n A 1 248 ILE 248 247 247 ILE ILE A . n A 1 249 LEU 249 248 248 LEU LEU A . n A 1 250 TRP 250 249 249 TRP TRP A . n A 1 251 TRP 251 250 250 TRP TRP A . n A 1 252 ASN 252 251 251 ASN ASN A . n A 1 253 ILE 253 252 252 ILE ILE A . n A 1 254 PHE 254 253 253 PHE PHE A . n A 1 255 THR 255 254 254 THR THR A . n A 1 256 THR 256 255 255 THR THR A . n A 1 257 ASN 257 256 256 ASN ASN A . n A 1 258 VAL 258 257 257 VAL VAL A . n A 1 259 LEU 259 258 258 LEU LEU A . n A 1 260 PRO 260 259 259 PRO PRO A . n A 1 261 LEU 261 260 260 LEU LEU A . n A 1 262 LEU 262 261 ? ? ? A . n A 1 263 GLN 263 262 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 301 263 EDO EDO A . C 2 EDO 1 302 264 EDO EDO A . D 2 EDO 1 303 266 EDO EDO A . E 2 EDO 1 304 269 EDO EDO A . F 2 EDO 1 305 1 EDO EDO A . G 3 HOH 1 401 17 HOH HOH A . G 3 HOH 2 402 54 HOH HOH A . G 3 HOH 3 403 41 HOH HOH A . G 3 HOH 4 404 20 HOH HOH A . G 3 HOH 5 405 4 HOH HOH A . G 3 HOH 6 406 39 HOH HOH A . G 3 HOH 7 407 46 HOH HOH A . G 3 HOH 8 408 2 HOH HOH A . G 3 HOH 9 409 27 HOH HOH A . G 3 HOH 10 410 1 HOH HOH A . G 3 HOH 11 411 14 HOH HOH A . G 3 HOH 12 412 12 HOH HOH A . G 3 HOH 13 413 25 HOH HOH A . G 3 HOH 14 414 22 HOH HOH A . G 3 HOH 15 415 3 HOH HOH A . G 3 HOH 16 416 28 HOH HOH A . G 3 HOH 17 417 38 HOH HOH A . G 3 HOH 18 418 51 HOH HOH A . G 3 HOH 19 419 43 HOH HOH A . G 3 HOH 20 420 40 HOH HOH A . G 3 HOH 21 421 50 HOH HOH A . G 3 HOH 22 422 23 HOH HOH A . G 3 HOH 23 423 29 HOH HOH A . G 3 HOH 24 424 13 HOH HOH A . G 3 HOH 25 425 6 HOH HOH A . G 3 HOH 26 426 26 HOH HOH A . G 3 HOH 27 427 31 HOH HOH A . G 3 HOH 28 428 10 HOH HOH A . G 3 HOH 29 429 16 HOH HOH A . G 3 HOH 30 430 24 HOH HOH A . G 3 HOH 31 431 55 HOH HOH A . G 3 HOH 32 432 8 HOH HOH A . G 3 HOH 33 433 18 HOH HOH A . G 3 HOH 34 434 47 HOH HOH A . G 3 HOH 35 435 44 HOH HOH A . G 3 HOH 36 436 53 HOH HOH A . G 3 HOH 37 437 9 HOH HOH A . G 3 HOH 38 438 45 HOH HOH A . G 3 HOH 39 439 15 HOH HOH A . G 3 HOH 40 440 21 HOH HOH A . G 3 HOH 41 441 33 HOH HOH A . G 3 HOH 42 442 30 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 28 ? CD ? A GLN 29 CD 2 1 Y 1 A GLN 28 ? OE1 ? A GLN 29 OE1 3 1 Y 1 A GLN 28 ? NE2 ? A GLN 29 NE2 4 1 Y 1 A ARG 30 ? CD ? A ARG 31 CD 5 1 Y 1 A ARG 30 ? NE ? A ARG 31 NE 6 1 Y 1 A ARG 30 ? CZ ? A ARG 31 CZ 7 1 Y 1 A ARG 30 ? NH1 ? A ARG 31 NH1 8 1 Y 1 A ARG 30 ? NH2 ? A ARG 31 NH2 9 1 Y 1 A LYS 49 ? CG ? A LYS 50 CG 10 1 Y 1 A LYS 49 ? CD ? A LYS 50 CD 11 1 Y 1 A LYS 49 ? CE ? A LYS 50 CE 12 1 Y 1 A LYS 49 ? NZ ? A LYS 50 NZ 13 1 Y 1 A LYS 76 ? CG ? A LYS 77 CG 14 1 Y 1 A LYS 76 ? CD ? A LYS 77 CD 15 1 Y 1 A LYS 76 ? CE ? A LYS 77 CE 16 1 Y 1 A LYS 76 ? NZ ? A LYS 77 NZ 17 1 Y 1 A ARG 180 ? CG ? A ARG 181 CG 18 1 Y 1 A ARG 180 ? CD ? A ARG 181 CD 19 1 Y 1 A ARG 180 ? NE ? A ARG 181 NE 20 1 Y 1 A ARG 180 ? CZ ? A ARG 181 CZ 21 1 Y 1 A ARG 180 ? NH1 ? A ARG 181 NH1 22 1 Y 1 A ARG 180 ? NH2 ? A ARG 181 NH2 23 1 Y 1 A LEU 198 ? CG ? A LEU 199 CG 24 1 Y 1 A LEU 198 ? CD1 ? A LEU 199 CD1 25 1 Y 1 A LEU 198 ? CD2 ? A LEU 199 CD2 26 1 Y 1 A LYS 202 ? CG ? A LYS 203 CG 27 1 Y 1 A LYS 202 ? CD ? A LYS 203 CD 28 1 Y 1 A LYS 202 ? CE ? A LYS 203 CE 29 1 Y 1 A LYS 202 ? NZ ? A LYS 203 NZ 30 1 Y 1 A SER 207 ? OG ? A SER 208 OG 31 1 Y 1 A ARG 216 ? CG ? A ARG 217 CG 32 1 Y 1 A ARG 216 ? CD ? A ARG 217 CD 33 1 Y 1 A ARG 216 ? NE ? A ARG 217 NE 34 1 Y 1 A ARG 216 ? CZ ? A ARG 217 CZ 35 1 Y 1 A ARG 216 ? NH1 ? A ARG 217 NH1 36 1 Y 1 A ARG 216 ? NH2 ? A ARG 217 NH2 37 1 Y 1 A LYS 227 ? CG ? A LYS 228 CG 38 1 Y 1 A LYS 227 ? CD ? A LYS 228 CD 39 1 Y 1 A LYS 227 ? CE ? A LYS 228 CE 40 1 Y 1 A LYS 227 ? NZ ? A LYS 228 NZ 41 1 Y 1 A LYS 229 ? CG ? A LYS 230 CG 42 1 Y 1 A LYS 229 ? CD ? A LYS 230 CD 43 1 Y 1 A LYS 229 ? CE ? A LYS 230 CE 44 1 Y 1 A LYS 229 ? NZ ? A LYS 230 NZ 45 1 Y 1 A LYS 232 ? CG ? A LYS 233 CG 46 1 Y 1 A LYS 232 ? CD ? A LYS 233 CD 47 1 Y 1 A LYS 232 ? CE ? A LYS 233 CE 48 1 Y 1 A LYS 232 ? NZ ? A LYS 233 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.1 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6EQJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.030 _cell.length_a_esd ? _cell.length_b 101.020 _cell.length_b_esd ? _cell.length_c 49.420 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6EQJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6EQJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '28% PEG smear broad, 0.1M sodium/potassium phosphate pH 6.2, 0.2M sodium chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97625 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97625 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 46.450 _reflns.entry_id 6EQJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.180 _reflns.d_resolution_low 101.020 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15830 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.600 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 0 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.081 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 88786 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.180 2.240 ? ? ? ? ? ? 1042 89.600 ? ? ? ? 0.771 ? ? ? ? ? ? ? ? 2.800 ? ? ? ? 0.933 0.510 ? 1 1 0.664 ? 9.750 101.020 ? ? ? ? ? ? 225 99.700 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 5.000 ? ? ? ? 0.042 0.018 ? 2 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 91.810 _refine.B_iso_mean 51.5879 _refine.B_iso_min 33.150 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6EQJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1800 _refine.ls_d_res_low 50.9670 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15792 _refine.ls_number_reflns_R_free 777 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.4800 _refine.ls_percent_reflns_R_free 4.9200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2304 _refine.ls_R_factor_R_free 0.2604 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2288 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.7800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1800 _refine_hist.d_res_low 50.9670 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 1956 _refine_hist.pdbx_number_residues_total 245 _refine_hist.pdbx_B_iso_mean_ligand 63.53 _refine_hist.pdbx_B_iso_mean_solvent 51.98 _refine_hist.pdbx_number_atoms_protein 1894 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.001 ? 1958 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.387 ? 2668 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.040 ? 313 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 334 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.063 ? 1131 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1801 2.3167 2414 . 132 2282 93.0000 . . . 0.3776 0.0000 0.3457 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.3167 2.4956 2616 . 119 2497 99.0000 . . . 0.3553 0.0000 0.2786 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.4956 2.7467 2632 . 131 2501 100.0000 . . . 0.3204 0.0000 0.2654 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.7467 3.1441 2634 . 140 2494 100.0000 . . . 0.3027 0.0000 0.2772 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.1441 3.9610 2676 . 128 2548 100.0000 . . . 0.2538 0.0000 0.2306 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.9610 50.9804 2820 . 127 2693 100.0000 . . . 0.2082 0.0000 0.1867 . . . . . . 6 . . . # _struct.entry_id 6EQJ _struct.title 'Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant, apo form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6EQJ _struct_keywords.text 'glycogenin-1, hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLYG_HUMAN _struct_ref.pdbx_db_accession P46976 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPEL GVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFD GGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNM THPEFLILWWNIFTTNVLPLLQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6EQJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 263 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P46976 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 262 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 262 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6EQJ SER A 1 ? UNP P46976 ? ? 'expression tag' 0 1 1 6EQJ PHI A 196 ? UNP P46976 TYR 195 conflict 195 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3960 ? 1 MORE 3 ? 1 'SSA (A^2)' 20410 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 59.0300000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 13 ? HIS A 30 ? ASN A 12 HIS A 29 1 ? 18 HELX_P HELX_P2 AA2 SER A 45 ? THR A 54 ? SER A 44 THR A 53 1 ? 10 HELX_P HELX_P3 AA3 ALA A 71 ? ARG A 78 ? ALA A 70 ARG A 77 1 ? 8 HELX_P HELX_P4 AA4 LEU A 81 ? LEU A 88 ? LEU A 80 LEU A 87 1 ? 8 HELX_P HELX_P5 AA5 HIS A 89 ? LEU A 93 ? HIS A 88 LEU A 92 5 ? 5 HELX_P HELX_P6 AA6 ILE A 112 ? ARG A 118 ? ILE A 111 ARG A 117 5 ? 7 HELX_P HELX_P7 AA7 SER A 143 ? GLN A 157 ? SER A 142 GLN A 156 1 ? 15 HELX_P HELX_P8 AA8 GLY A 163 ? PHE A 172 ? GLY A 162 PHE A 171 1 ? 10 HELX_P HELX_P9 AA9 ASP A 179 ? HIS A 183 ? ASP A 178 HIS A 182 5 ? 5 HELX_P HELX_P10 AB1 PRO A 185 ? ASN A 189 ? PRO A 184 ASN A 188 5 ? 5 HELX_P HELX_P11 AB2 PRO A 200 ? GLY A 206 ? PRO A 199 GLY A 205 1 ? 7 HELX_P HELX_P12 AB3 ALA A 207 ? ALA A 209 ? ALA A 206 ALA A 208 5 ? 3 HELX_P HELX_P13 AB4 LYS A 219 ? TYR A 223 ? LYS A 218 TYR A 222 5 ? 5 HELX_P HELX_P14 AB5 GLU A 245 ? ASN A 257 ? GLU A 244 ASN A 256 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 120 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 119 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 LEU _struct_mon_prot_cis.pdbx_label_seq_id_2 121 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 LEU _struct_mon_prot_cis.pdbx_auth_seq_id_2 120 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.82 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 58 ? MET A 61 ? GLU A 57 MET A 60 AA1 2 ARG A 35 ? ALA A 40 ? ARG A 34 ALA A 39 AA1 3 GLN A 5 ? THR A 11 ? GLN A 4 THR A 10 AA1 4 LYS A 98 ? MET A 102 ? LYS A 97 MET A 101 AA1 5 PHE A 133 ? TYR A 140 ? PHE A 132 TYR A 139 AA1 6 SER A 122 ? PRO A 125 ? SER A 121 PRO A 124 AA2 1 THR A 106 ? VAL A 108 ? THR A 105 VAL A 107 AA2 2 VAL A 211 ? HIS A 213 ? VAL A 210 HIS A 212 AA2 3 LEU A 190 ? SER A 191 ? LEU A 189 SER A 190 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 60 ? O ILE A 59 N ALA A 40 ? N ALA A 39 AA1 2 3 O VAL A 37 ? O VAL A 36 N PHE A 7 ? N PHE A 6 AA1 3 4 N VAL A 8 ? N VAL A 7 O MET A 102 ? O MET A 101 AA1 4 5 N CYS A 99 ? N CYS A 98 O TYR A 140 ? O TYR A 139 AA1 5 6 O VAL A 139 ? O VAL A 138 N SER A 122 ? N SER A 121 AA2 1 2 N LEU A 107 ? N LEU A 106 O VAL A 212 ? O VAL A 211 AA2 2 3 O HIS A 213 ? O HIS A 212 N LEU A 190 ? N LEU A 189 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 301 ? 7 'binding site for residue EDO A 301' AC2 Software A EDO 302 ? 5 'binding site for residue EDO A 302' AC3 Software A EDO 303 ? 4 'binding site for residue EDO A 303' AC4 Software A EDO 304 ? 2 'binding site for residue EDO A 304' AC5 Software A EDO 305 ? 8 'binding site for residue EDO A 305' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASP A 4 ? ASP A 3 . ? 1_555 ? 2 AC1 7 THR A 94 ? THR A 93 . ? 1_555 ? 3 AC1 7 GLN A 95 ? GLN A 94 . ? 1_555 ? 4 AC1 7 TYR A 96 ? TYR A 95 . ? 1_555 ? 5 AC1 7 SER A 97 ? SER A 96 . ? 1_555 ? 6 AC1 7 HIS A 152 ? HIS A 151 . ? 4_456 ? 7 AC1 7 GLU A 156 ? GLU A 155 . ? 4_456 ? 8 AC2 5 LEU A 10 ? LEU A 9 . ? 1_555 ? 9 AC2 5 THR A 11 ? THR A 10 . ? 1_555 ? 10 AC2 5 THR A 12 ? THR A 11 . ? 1_555 ? 11 AC2 5 TYR A 16 ? TYR A 15 . ? 1_555 ? 12 AC2 5 VAL A 83 ? VAL A 82 . ? 1_555 ? 13 AC3 4 GLU A 120 ? GLU A 119 . ? 1_555 ? 14 AC3 4 LEU A 121 ? LEU A 120 . ? 1_555 ? 15 AC3 4 TRP A 175 ? TRP A 174 . ? 1_555 ? 16 AC3 4 LYS A 182 ? LYS A 181 . ? 1_555 ? 17 AC4 2 HIS A 89 ? HIS A 88 . ? 1_555 ? 18 AC4 2 SER A 92 ? SER A 91 . ? 1_555 ? 19 AC5 8 SER A 26 ? SER A 25 . ? 1_555 ? 20 AC5 8 LEU A 27 ? LEU A 26 . ? 1_555 ? 21 AC5 8 HIS A 30 ? HIS A 29 . ? 1_555 ? 22 AC5 8 THR A 32 ? THR A 31 . ? 1_555 ? 23 AC5 8 VAL A 108 ? VAL A 107 . ? 1_555 ? 24 AC5 8 ASN A 111 ? ASN A 110 . ? 1_555 ? 25 AC5 8 ILE A 112 ? ILE A 111 . ? 1_555 ? 26 AC5 8 ASP A 113 ? ASP A 112 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 30 ? ? 58.54 81.15 2 1 THR A 177 ? ? -106.37 -89.83 3 1 ASN A 188 ? ? -160.95 61.57 4 1 PRO A 259 ? ? -72.38 47.71 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 0 ? A SER 1 2 1 Y 1 A SER 193 ? A SER 194 3 1 Y 1 A ILE 194 ? A ILE 195 4 1 Y 1 A PHI 195 ? A PHI 196 5 1 Y 1 A SER 196 ? A SER 197 6 1 Y 1 A TYR 197 ? A TYR 198 7 1 Y 1 A SER 233 ? A SER 234 8 1 Y 1 A GLU 234 ? A GLU 235 9 1 Y 1 A ALA 235 ? A ALA 236 10 1 Y 1 A HIS 236 ? A HIS 237 11 1 Y 1 A ASP 237 ? A ASP 238 12 1 Y 1 A PRO 238 ? A PRO 239 13 1 Y 1 A ASN 239 ? A ASN 240 14 1 Y 1 A MET 240 ? A MET 241 15 1 Y 1 A THR 241 ? A THR 242 16 1 Y 1 A HIS 242 ? A HIS 243 17 1 Y 1 A LEU 261 ? A LEU 262 18 1 Y 1 A GLN 262 ? A GLN 263 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PHI N N N N 283 PHI CA C N S 284 PHI CB C N N 285 PHI CG C Y N 286 PHI CD1 C Y N 287 PHI CD2 C Y N 288 PHI CE1 C Y N 289 PHI CE2 C Y N 290 PHI CZ C Y N 291 PHI I I N N 292 PHI C C N N 293 PHI O O N N 294 PHI OXT O N N 295 PHI H H N N 296 PHI H2 H N N 297 PHI HA H N N 298 PHI HB2 H N N 299 PHI HB3 H N N 300 PHI HD1 H N N 301 PHI HD2 H N N 302 PHI HE1 H N N 303 PHI HE2 H N N 304 PHI HXT H N N 305 PRO N N N N 306 PRO CA C N S 307 PRO C C N N 308 PRO O O N N 309 PRO CB C N N 310 PRO CG C N N 311 PRO CD C N N 312 PRO OXT O N N 313 PRO H H N N 314 PRO HA H N N 315 PRO HB2 H N N 316 PRO HB3 H N N 317 PRO HG2 H N N 318 PRO HG3 H N N 319 PRO HD2 H N N 320 PRO HD3 H N N 321 PRO HXT H N N 322 SER N N N N 323 SER CA C N S 324 SER C C N N 325 SER O O N N 326 SER CB C N N 327 SER OG O N N 328 SER OXT O N N 329 SER H H N N 330 SER H2 H N N 331 SER HA H N N 332 SER HB2 H N N 333 SER HB3 H N N 334 SER HG H N N 335 SER HXT H N N 336 THR N N N N 337 THR CA C N S 338 THR C C N N 339 THR O O N N 340 THR CB C N R 341 THR OG1 O N N 342 THR CG2 C N N 343 THR OXT O N N 344 THR H H N N 345 THR H2 H N N 346 THR HA H N N 347 THR HB H N N 348 THR HG1 H N N 349 THR HG21 H N N 350 THR HG22 H N N 351 THR HG23 H N N 352 THR HXT H N N 353 TRP N N N N 354 TRP CA C N S 355 TRP C C N N 356 TRP O O N N 357 TRP CB C N N 358 TRP CG C Y N 359 TRP CD1 C Y N 360 TRP CD2 C Y N 361 TRP NE1 N Y N 362 TRP CE2 C Y N 363 TRP CE3 C Y N 364 TRP CZ2 C Y N 365 TRP CZ3 C Y N 366 TRP CH2 C Y N 367 TRP OXT O N N 368 TRP H H N N 369 TRP H2 H N N 370 TRP HA H N N 371 TRP HB2 H N N 372 TRP HB3 H N N 373 TRP HD1 H N N 374 TRP HE1 H N N 375 TRP HE3 H N N 376 TRP HZ2 H N N 377 TRP HZ3 H N N 378 TRP HH2 H N N 379 TRP HXT H N N 380 TYR N N N N 381 TYR CA C N S 382 TYR C C N N 383 TYR O O N N 384 TYR CB C N N 385 TYR CG C Y N 386 TYR CD1 C Y N 387 TYR CD2 C Y N 388 TYR CE1 C Y N 389 TYR CE2 C Y N 390 TYR CZ C Y N 391 TYR OH O N N 392 TYR OXT O N N 393 TYR H H N N 394 TYR H2 H N N 395 TYR HA H N N 396 TYR HB2 H N N 397 TYR HB3 H N N 398 TYR HD1 H N N 399 TYR HD2 H N N 400 TYR HE1 H N N 401 TYR HE2 H N N 402 TYR HH H N N 403 TYR HXT H N N 404 VAL N N N N 405 VAL CA C N S 406 VAL C C N N 407 VAL O O N N 408 VAL CB C N N 409 VAL CG1 C N N 410 VAL CG2 C N N 411 VAL OXT O N N 412 VAL H H N N 413 VAL H2 H N N 414 VAL HA H N N 415 VAL HB H N N 416 VAL HG11 H N N 417 VAL HG12 H N N 418 VAL HG13 H N N 419 VAL HG21 H N N 420 VAL HG22 H N N 421 VAL HG23 H N N 422 VAL HXT H N N 423 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PHI N CA sing N N 269 PHI N H sing N N 270 PHI N H2 sing N N 271 PHI CA CB sing N N 272 PHI CA C sing N N 273 PHI CA HA sing N N 274 PHI CB CG sing N N 275 PHI CB HB2 sing N N 276 PHI CB HB3 sing N N 277 PHI CG CD1 doub Y N 278 PHI CG CD2 sing Y N 279 PHI CD1 CE1 sing Y N 280 PHI CD1 HD1 sing N N 281 PHI CD2 CE2 doub Y N 282 PHI CD2 HD2 sing N N 283 PHI CE1 CZ doub Y N 284 PHI CE1 HE1 sing N N 285 PHI CE2 CZ sing Y N 286 PHI CE2 HE2 sing N N 287 PHI CZ I sing N N 288 PHI C O doub N N 289 PHI C OXT sing N N 290 PHI OXT HXT sing N N 291 PRO N CA sing N N 292 PRO N CD sing N N 293 PRO N H sing N N 294 PRO CA C sing N N 295 PRO CA CB sing N N 296 PRO CA HA sing N N 297 PRO C O doub N N 298 PRO C OXT sing N N 299 PRO CB CG sing N N 300 PRO CB HB2 sing N N 301 PRO CB HB3 sing N N 302 PRO CG CD sing N N 303 PRO CG HG2 sing N N 304 PRO CG HG3 sing N N 305 PRO CD HD2 sing N N 306 PRO CD HD3 sing N N 307 PRO OXT HXT sing N N 308 SER N CA sing N N 309 SER N H sing N N 310 SER N H2 sing N N 311 SER CA C sing N N 312 SER CA CB sing N N 313 SER CA HA sing N N 314 SER C O doub N N 315 SER C OXT sing N N 316 SER CB OG sing N N 317 SER CB HB2 sing N N 318 SER CB HB3 sing N N 319 SER OG HG sing N N 320 SER OXT HXT sing N N 321 THR N CA sing N N 322 THR N H sing N N 323 THR N H2 sing N N 324 THR CA C sing N N 325 THR CA CB sing N N 326 THR CA HA sing N N 327 THR C O doub N N 328 THR C OXT sing N N 329 THR CB OG1 sing N N 330 THR CB CG2 sing N N 331 THR CB HB sing N N 332 THR OG1 HG1 sing N N 333 THR CG2 HG21 sing N N 334 THR CG2 HG22 sing N N 335 THR CG2 HG23 sing N N 336 THR OXT HXT sing N N 337 TRP N CA sing N N 338 TRP N H sing N N 339 TRP N H2 sing N N 340 TRP CA C sing N N 341 TRP CA CB sing N N 342 TRP CA HA sing N N 343 TRP C O doub N N 344 TRP C OXT sing N N 345 TRP CB CG sing N N 346 TRP CB HB2 sing N N 347 TRP CB HB3 sing N N 348 TRP CG CD1 doub Y N 349 TRP CG CD2 sing Y N 350 TRP CD1 NE1 sing Y N 351 TRP CD1 HD1 sing N N 352 TRP CD2 CE2 doub Y N 353 TRP CD2 CE3 sing Y N 354 TRP NE1 CE2 sing Y N 355 TRP NE1 HE1 sing N N 356 TRP CE2 CZ2 sing Y N 357 TRP CE3 CZ3 doub Y N 358 TRP CE3 HE3 sing N N 359 TRP CZ2 CH2 doub Y N 360 TRP CZ2 HZ2 sing N N 361 TRP CZ3 CH2 sing Y N 362 TRP CZ3 HZ3 sing N N 363 TRP CH2 HH2 sing N N 364 TRP OXT HXT sing N N 365 TYR N CA sing N N 366 TYR N H sing N N 367 TYR N H2 sing N N 368 TYR CA C sing N N 369 TYR CA CB sing N N 370 TYR CA HA sing N N 371 TYR C O doub N N 372 TYR C OXT sing N N 373 TYR CB CG sing N N 374 TYR CB HB2 sing N N 375 TYR CB HB3 sing N N 376 TYR CG CD1 doub Y N 377 TYR CG CD2 sing Y N 378 TYR CD1 CE1 sing Y N 379 TYR CD1 HD1 sing N N 380 TYR CD2 CE2 doub Y N 381 TYR CD2 HD2 sing N N 382 TYR CE1 CZ doub Y N 383 TYR CE1 HE1 sing N N 384 TYR CE2 CZ sing Y N 385 TYR CE2 HE2 sing N N 386 TYR CZ OH sing N N 387 TYR OH HH sing N N 388 TYR OXT HXT sing N N 389 VAL N CA sing N N 390 VAL N H sing N N 391 VAL N H2 sing N N 392 VAL CA C sing N N 393 VAL CA CB sing N N 394 VAL CA HA sing N N 395 VAL C O doub N N 396 VAL C OXT sing N N 397 VAL CB CG1 sing N N 398 VAL CB CG2 sing N N 399 VAL CB HB sing N N 400 VAL CG1 HG11 sing N N 401 VAL CG1 HG12 sing N N 402 VAL CG1 HG13 sing N N 403 VAL CG2 HG21 sing N N 404 VAL CG2 HG22 sing N N 405 VAL CG2 HG23 sing N N 406 VAL OXT HXT sing N N 407 # _atom_sites.entry_id 6EQJ _atom_sites.fract_transf_matrix[1][1] 0.016941 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009899 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020235 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_