data_6FPD # _entry.id 6FPD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.299 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6FPD WWPDB D_1200008718 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6FPD _pdbx_database_status.recvd_initial_deposition_date 2018-02-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Houser, J.' 1 0000-0003-4504-3891 'Demo, G.' 2 0000-0002-5472-9249 'Komarek, J.' 3 0000-0003-4496-1658 'Wimmerova, M.' 4 0000-0002-7108-4198 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 86 _citation.language ? _citation.page_first 897 _citation.page_last 911 _citation.title 'Structure and properties of AB21, a novel Agaricus bisporus protein with structural relation to bacterial pore-forming toxins.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.25522 _citation.pdbx_database_id_PubMed 29722060 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Komarek, J.' 1 ? primary 'Ivanov Kavkova, E.' 2 ? primary 'Houser, J.' 3 ? primary 'Horackova, A.' 4 ? primary 'Zdanska, J.' 5 ? primary 'Demo, G.' 6 ? primary 'Wimmerova, M.' 7 0000-0002-7108-4198 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6FPD _cell.details ? _cell.formula_units_Z ? _cell.length_a 73.936 _cell.length_a_esd ? _cell.length_b 73.936 _cell.length_b_esd ? _cell.length_c 70.592 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6FPD _symmetry.cell_setting ? _symmetry.Int_Tables_number 172 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein AB21' 22572.125 1 ? ? ? ? 2 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 water nat water 18.015 41 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SSNAIDFPFAHEDVVQKTVDDVRTLSNMSAAADQGVHDVNHSSKTLAERYKDDITALAVLPPRVDEFAKSFNDILWAGRT SATHGVSRITDFVDVTVVGIVEDIKTPEDRDEAVIELNAIAGQKSKPVDGFPGATRRLDGIWNTSSTDAANIAKVLAEAT DIEKTVKELTTAFSPAKAGYKKVQEALRAYASSITKLAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;SSNAIDFPFAHEDVVQKTVDDVRTLSNMSAAADQGVHDVNHSSKTLAERYKDDITALAVLPPRVDEFAKSFNDILWAGRT SATHGVSRITDFVDVTVVGIVEDIKTPEDRDEAVIELNAIAGQKSKPVDGFPGATRRLDGIWNTSSTDAANIAKVLAEAT DIEKTVKELTTAFSPAKAGYKKVQEALRAYASSITKLAAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 ASN n 1 4 ALA n 1 5 ILE n 1 6 ASP n 1 7 PHE n 1 8 PRO n 1 9 PHE n 1 10 ALA n 1 11 HIS n 1 12 GLU n 1 13 ASP n 1 14 VAL n 1 15 VAL n 1 16 GLN n 1 17 LYS n 1 18 THR n 1 19 VAL n 1 20 ASP n 1 21 ASP n 1 22 VAL n 1 23 ARG n 1 24 THR n 1 25 LEU n 1 26 SER n 1 27 ASN n 1 28 MET n 1 29 SER n 1 30 ALA n 1 31 ALA n 1 32 ALA n 1 33 ASP n 1 34 GLN n 1 35 GLY n 1 36 VAL n 1 37 HIS n 1 38 ASP n 1 39 VAL n 1 40 ASN n 1 41 HIS n 1 42 SER n 1 43 SER n 1 44 LYS n 1 45 THR n 1 46 LEU n 1 47 ALA n 1 48 GLU n 1 49 ARG n 1 50 TYR n 1 51 LYS n 1 52 ASP n 1 53 ASP n 1 54 ILE n 1 55 THR n 1 56 ALA n 1 57 LEU n 1 58 ALA n 1 59 VAL n 1 60 LEU n 1 61 PRO n 1 62 PRO n 1 63 ARG n 1 64 VAL n 1 65 ASP n 1 66 GLU n 1 67 PHE n 1 68 ALA n 1 69 LYS n 1 70 SER n 1 71 PHE n 1 72 ASN n 1 73 ASP n 1 74 ILE n 1 75 LEU n 1 76 TRP n 1 77 ALA n 1 78 GLY n 1 79 ARG n 1 80 THR n 1 81 SER n 1 82 ALA n 1 83 THR n 1 84 HIS n 1 85 GLY n 1 86 VAL n 1 87 SER n 1 88 ARG n 1 89 ILE n 1 90 THR n 1 91 ASP n 1 92 PHE n 1 93 VAL n 1 94 ASP n 1 95 VAL n 1 96 THR n 1 97 VAL n 1 98 VAL n 1 99 GLY n 1 100 ILE n 1 101 VAL n 1 102 GLU n 1 103 ASP n 1 104 ILE n 1 105 LYS n 1 106 THR n 1 107 PRO n 1 108 GLU n 1 109 ASP n 1 110 ARG n 1 111 ASP n 1 112 GLU n 1 113 ALA n 1 114 VAL n 1 115 ILE n 1 116 GLU n 1 117 LEU n 1 118 ASN n 1 119 ALA n 1 120 ILE n 1 121 ALA n 1 122 GLY n 1 123 GLN n 1 124 LYS n 1 125 SER n 1 126 LYS n 1 127 PRO n 1 128 VAL n 1 129 ASP n 1 130 GLY n 1 131 PHE n 1 132 PRO n 1 133 GLY n 1 134 ALA n 1 135 THR n 1 136 ARG n 1 137 ARG n 1 138 LEU n 1 139 ASP n 1 140 GLY n 1 141 ILE n 1 142 TRP n 1 143 ASN n 1 144 THR n 1 145 SER n 1 146 SER n 1 147 THR n 1 148 ASP n 1 149 ALA n 1 150 ALA n 1 151 ASN n 1 152 ILE n 1 153 ALA n 1 154 LYS n 1 155 VAL n 1 156 LEU n 1 157 ALA n 1 158 GLU n 1 159 ALA n 1 160 THR n 1 161 ASP n 1 162 ILE n 1 163 GLU n 1 164 LYS n 1 165 THR n 1 166 VAL n 1 167 LYS n 1 168 GLU n 1 169 LEU n 1 170 THR n 1 171 THR n 1 172 ALA n 1 173 PHE n 1 174 SER n 1 175 PRO n 1 176 ALA n 1 177 LYS n 1 178 ALA n 1 179 GLY n 1 180 TYR n 1 181 LYS n 1 182 LYS n 1 183 VAL n 1 184 GLN n 1 185 GLU n 1 186 ALA n 1 187 LEU n 1 188 ARG n 1 189 ALA n 1 190 TYR n 1 191 ALA n 1 192 SER n 1 193 SER n 1 194 ILE n 1 195 THR n 1 196 LYS n 1 197 LEU n 1 198 ALA n 1 199 ALA n 1 200 ALA n 1 201 LEU n 1 202 GLU n 1 203 HIS n 1 204 HIS n 1 205 HIS n 1 206 HIS n 1 207 HIS n 1 208 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 208 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Agaricus bisporus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5341 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6FPD _struct_ref.pdbx_db_accession 6FPD _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6FPD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 208 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6FPD _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 208 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 208 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FPD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.47 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.15 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20 mM MES, 150 mM NaCl, pH 6.2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-04-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.2 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 20.53 _reflns.entry_id 6FPD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.50 _reflns.d_resolution_low 36.96 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7689 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.5 _reflns.pdbx_Rmerge_I_obs 0.043 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 40.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.64 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 26.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1113 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.070 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 12.0 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.998 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -1.57 _refine.aniso_B[1][2] -0.79 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -1.57 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 5.10 _refine.B_iso_max ? _refine.B_iso_mean 29.887 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.900 _refine.correlation_coeff_Fo_to_Fc_free 0.822 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6FPD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 36.96 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7274 _refine.ls_number_reflns_R_free 383 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.87 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.24723 _refine.ls_R_factor_R_free 0.31719 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.24346 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.634 _refine.pdbx_overall_ESU_R_Free 0.363 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 15.369 _refine.overall_SU_ML 0.323 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1422 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 1468 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 36.96 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.019 1448 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1366 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.253 1.943 1974 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.919 3.000 3127 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.529 5.000 189 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.922 24.426 61 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.162 15.000 220 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.250 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.058 0.200 240 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.021 1656 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 313 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.297 3.029 762 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.293 3.029 761 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.262 4.535 949 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.261 4.536 950 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.053 3.104 686 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.052 3.104 686 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 1.874 4.629 1026 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 4.200 23.860 1671 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 4.199 23.871 1672 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.501 _refine_ls_shell.d_res_low 2.566 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 31 _refine_ls_shell.number_reflns_R_work 540 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.376 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.328 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6FPD _struct.title 'AB21 protein from Agaricus bisporus' _struct.pdbx_descriptor 'Protein AB21' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FPD _struct_keywords.text 'Agaricus bisporus, tetrahelical bundle, toxin-like, unknown function' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 7 ? ALA A 10 ? PHE A 7 ALA A 10 5 ? 4 HELX_P HELX_P2 AA2 HIS A 11 ? TYR A 50 ? HIS A 11 TYR A 50 1 ? 40 HELX_P HELX_P3 AA3 THR A 55 ? ALA A 58 ? THR A 55 ALA A 58 5 ? 4 HELX_P HELX_P4 AA4 VAL A 59 ? ASP A 94 ? VAL A 59 ASP A 94 1 ? 36 HELX_P HELX_P5 AA5 THR A 106 ? GLN A 123 ? THR A 106 GLN A 123 1 ? 18 HELX_P HELX_P6 AA6 PHE A 131 ? VAL A 155 ? PHE A 131 VAL A 155 1 ? 25 HELX_P HELX_P7 AA7 GLU A 163 ? LEU A 197 ? GLU A 163 LEU A 197 1 ? 35 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ASP _struct_conn.ptnr1_label_seq_id 148 _struct_conn.ptnr1_label_atom_id OD2 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id NA _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id NA _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ASP _struct_conn.ptnr1_auth_seq_id 148 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NA _struct_conn.ptnr2_auth_seq_id 301 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.242 _struct_conn.pdbx_value_order ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NA 301 ? 5 'binding site for residue NA A 301' AC2 Software A EDO 302 ? 2 'binding site for residue EDO A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 PRO A 8 ? PRO A 8 . ? 1_555 ? 2 AC1 5 PHE A 9 ? PHE A 9 . ? 1_555 ? 3 AC1 5 THR A 144 ? THR A 144 . ? 1_555 ? 4 AC1 5 ASP A 148 ? ASP A 148 . ? 1_555 ? 5 AC1 5 TYR A 180 ? TYR A 180 . ? 1_555 ? 6 AC2 2 LYS A 126 ? LYS A 126 . ? 1_555 ? 7 AC2 2 ASP A 129 ? ASP A 129 . ? 1_555 ? # _atom_sites.entry_id 6FPD _atom_sites.fract_transf_matrix[1][1] 0.013525 _atom_sites.fract_transf_matrix[1][2] 0.007809 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015618 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014166 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 ALA 4 4 ? ? ? A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 TRP 142 142 142 TRP TRP A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 GLU 158 158 ? ? ? A . n A 1 159 ALA 159 159 ? ? ? A . n A 1 160 THR 160 160 ? ? ? A . n A 1 161 ASP 161 161 ? ? ? A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 TYR 190 190 190 TYR TYR A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 ALA 200 200 ? ? ? A . n A 1 201 LEU 201 201 ? ? ? A . n A 1 202 GLU 202 202 ? ? ? A . n A 1 203 HIS 203 203 ? ? ? A . n A 1 204 HIS 204 204 ? ? ? A . n A 1 205 HIS 205 205 ? ? ? A . n A 1 206 HIS 206 206 ? ? ? A . n A 1 207 HIS 207 207 ? ? ? A . n A 1 208 HIS 208 208 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NA 1 301 1 NA NA A . C 3 EDO 1 302 1 EDO EDO A . D 4 HOH 1 401 16 HOH HOH A . D 4 HOH 2 402 32 HOH HOH A . D 4 HOH 3 403 4 HOH HOH A . D 4 HOH 4 404 9 HOH HOH A . D 4 HOH 5 405 7 HOH HOH A . D 4 HOH 6 406 27 HOH HOH A . D 4 HOH 7 407 19 HOH HOH A . D 4 HOH 8 408 14 HOH HOH A . D 4 HOH 9 409 10 HOH HOH A . D 4 HOH 10 410 11 HOH HOH A . D 4 HOH 11 411 30 HOH HOH A . D 4 HOH 12 412 17 HOH HOH A . D 4 HOH 13 413 37 HOH HOH A . D 4 HOH 14 414 13 HOH HOH A . D 4 HOH 15 415 18 HOH HOH A . D 4 HOH 16 416 38 HOH HOH A . D 4 HOH 17 417 31 HOH HOH A . D 4 HOH 18 418 25 HOH HOH A . D 4 HOH 19 419 8 HOH HOH A . D 4 HOH 20 420 5 HOH HOH A . D 4 HOH 21 421 2 HOH HOH A . D 4 HOH 22 422 26 HOH HOH A . D 4 HOH 23 423 3 HOH HOH A . D 4 HOH 24 424 35 HOH HOH A . D 4 HOH 25 425 20 HOH HOH A . D 4 HOH 26 426 6 HOH HOH A . D 4 HOH 27 427 29 HOH HOH A . D 4 HOH 28 428 15 HOH HOH A . D 4 HOH 29 429 28 HOH HOH A . D 4 HOH 30 430 36 HOH HOH A . D 4 HOH 31 431 1 HOH HOH A . D 4 HOH 32 432 22 HOH HOH A . D 4 HOH 33 433 23 HOH HOH A . D 4 HOH 34 434 21 HOH HOH A . D 4 HOH 35 435 12 HOH HOH A . D 4 HOH 36 436 33 HOH HOH A . D 4 HOH 37 437 34 HOH HOH A . D 4 HOH 38 438 24 HOH HOH A . D 4 HOH 39 439 39 HOH HOH A . D 4 HOH 40 440 41 HOH HOH A . D 4 HOH 41 441 40 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2790 ? 1 MORE -48 ? 1 'SSA (A^2)' 19290 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_445 -x-1,-y-1,z -1.0000000000 0.0000000000 0.0000000000 -36.9680000000 0.0000000000 -1.0000000000 0.0000000000 -64.0304542542 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-16 2 'Structure model' 1 1 2018-05-30 3 'Structure model' 1 2 2018-10-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.title' 2 3 'Structure model' '_citation.journal_volume' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' 5 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 96 ? ? -92.28 -63.48 2 1 LYS A 105 ? ? -126.72 -64.28 3 1 VAL A 155 ? ? -81.48 33.55 4 1 ALA A 198 ? ? -69.51 58.10 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 105 ? CG ? A LYS 105 CG 2 1 Y 1 A LYS 105 ? CD ? A LYS 105 CD 3 1 Y 1 A LYS 105 ? CE ? A LYS 105 CE 4 1 Y 1 A LYS 105 ? NZ ? A LYS 105 NZ 5 1 Y 1 A GLU 112 ? CG ? A GLU 112 CG 6 1 Y 1 A GLU 112 ? CD ? A GLU 112 CD 7 1 Y 1 A GLU 112 ? OE1 ? A GLU 112 OE1 8 1 Y 1 A GLU 112 ? OE2 ? A GLU 112 OE2 9 1 Y 1 A LYS 126 ? CG ? A LYS 126 CG 10 1 Y 1 A LYS 126 ? CD ? A LYS 126 CD 11 1 Y 1 A LYS 126 ? CE ? A LYS 126 CE 12 1 Y 1 A LYS 126 ? NZ ? A LYS 126 NZ 13 1 Y 1 A LYS 154 ? CG ? A LYS 154 CG 14 1 Y 1 A LYS 154 ? CD ? A LYS 154 CD 15 1 Y 1 A LYS 154 ? CE ? A LYS 154 CE 16 1 Y 1 A LYS 154 ? NZ ? A LYS 154 NZ 17 1 Y 1 A GLU 163 ? CG ? A GLU 163 CG 18 1 Y 1 A GLU 163 ? CD ? A GLU 163 CD 19 1 Y 1 A GLU 163 ? OE1 ? A GLU 163 OE1 20 1 Y 1 A GLU 163 ? OE2 ? A GLU 163 OE2 21 1 Y 1 A LYS 164 ? CG ? A LYS 164 CG 22 1 Y 1 A LYS 164 ? CD ? A LYS 164 CD 23 1 Y 1 A LYS 164 ? CE ? A LYS 164 CE 24 1 Y 1 A LYS 164 ? NZ ? A LYS 164 NZ 25 1 Y 1 A LYS 167 ? CG ? A LYS 167 CG 26 1 Y 1 A LYS 167 ? CD ? A LYS 167 CD 27 1 Y 1 A LYS 167 ? CE ? A LYS 167 CE 28 1 Y 1 A LYS 167 ? NZ ? A LYS 167 NZ 29 1 Y 1 A LYS 182 ? CG ? A LYS 182 CG 30 1 Y 1 A LYS 182 ? CD ? A LYS 182 CD 31 1 Y 1 A LYS 182 ? CE ? A LYS 182 CE 32 1 Y 1 A LYS 182 ? NZ ? A LYS 182 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A ALA 4 ? A ALA 4 5 1 Y 1 A GLU 158 ? A GLU 158 6 1 Y 1 A ALA 159 ? A ALA 159 7 1 Y 1 A THR 160 ? A THR 160 8 1 Y 1 A ASP 161 ? A ASP 161 9 1 Y 1 A ALA 200 ? A ALA 200 10 1 Y 1 A LEU 201 ? A LEU 201 11 1 Y 1 A GLU 202 ? A GLU 202 12 1 Y 1 A HIS 203 ? A HIS 203 13 1 Y 1 A HIS 204 ? A HIS 204 14 1 Y 1 A HIS 205 ? A HIS 205 15 1 Y 1 A HIS 206 ? A HIS 206 16 1 Y 1 A HIS 207 ? A HIS 207 17 1 Y 1 A HIS 208 ? A HIS 208 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SODIUM ION' NA 3 1,2-ETHANEDIOL EDO 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'equilibrium centrifugation' _pdbx_struct_assembly_auth_evidence.details ? #