data_6GCR # _entry.id 6GCR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6GCR WWPDB D_1200008723 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6GCX unspecified PDB . 6GCW unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6GCR _pdbx_database_status.recvd_initial_deposition_date 2018-04-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yen-Pon, E.' 1 ? 'Li, B.' 2 ? 'Acebron-Garcia de Eulate, M.' 3 0000-0002-6035-7525 'Tomkiewicz-Raulet, C.' 4 ? 'Dawson, J.' 5 ? 'Lietha, D.' 6 ? 'Frame, M.C.' 7 ? 'Coumoul, X.' 8 ? 'Garbay, C.' 9 ? 'Etheve-Quelquejeu, M.' 10 ? 'Chen, H.' 11 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Chem.Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1554-8937 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 2067 _citation.page_last 2073 _citation.title 'Structure-Based Design, Synthesis, and Characterization of the First Irreversible Inhibitor of Focal Adhesion Kinase.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acschembio.8b00250 _citation.pdbx_database_id_PubMed 29897729 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yen-Pon, E.' 1 ? primary 'Li, B.' 2 ? primary 'Acebron-Garcia-de-Eulate, M.' 3 ? primary 'Tomkiewicz-Raulet, C.' 4 ? primary 'Dawson, J.' 5 ? primary 'Lietha, D.' 6 ? primary 'Frame, M.C.' 7 ? primary 'Coumoul, X.' 8 ? primary 'Garbay, C.' 9 ? primary 'Etheve-Quelquejeu, M.' 10 ? primary 'Chen, H.' 11 0000-0001-7676-1584 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 94.81 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6GCR _cell.details ? _cell.formula_units_Z ? _cell.length_a 46.088 _cell.length_a_esd ? _cell.length_b 44.900 _cell.length_b_esd ? _cell.length_c 66.400 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6GCR _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Focal adhesion kinase 1' 31731.805 1 2.7.10.2 ? ? ? 2 non-polymer syn ;2-[[2-[[4-[[[3,4-bis(oxidanylidene)-2-[2-(propanoylamino)ethylamino]cyclobuten-1-yl]amino]methyl]phenyl]amino]-5-chloranyl-pyrimidin-4-yl]amino]-~{N}-methyl-benzamide ; 577.034 1 ? ? ? ? 3 water nat water 18.015 66 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FADK 1,Focal adhesion kinase-related nonkinase,p41/p43FRNK,Protein-tyrosine kinase 2,p125FAK,pp125FAK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;STRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVI TENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRY MEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPT LYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ ; _entity_poly.pdbx_seq_one_letter_code_can ;STRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVI TENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRY MEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPT LYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 THR n 1 3 ARG n 1 4 ASP n 1 5 TYR n 1 6 GLU n 1 7 ILE n 1 8 GLN n 1 9 ARG n 1 10 GLU n 1 11 ARG n 1 12 ILE n 1 13 GLU n 1 14 LEU n 1 15 GLY n 1 16 ARG n 1 17 CYS n 1 18 ILE n 1 19 GLY n 1 20 GLU n 1 21 GLY n 1 22 GLN n 1 23 PHE n 1 24 GLY n 1 25 ASP n 1 26 VAL n 1 27 HIS n 1 28 GLN n 1 29 GLY n 1 30 ILE n 1 31 TYR n 1 32 MET n 1 33 SER n 1 34 PRO n 1 35 GLU n 1 36 ASN n 1 37 PRO n 1 38 ALA n 1 39 MET n 1 40 ALA n 1 41 VAL n 1 42 ALA n 1 43 ILE n 1 44 LYS n 1 45 THR n 1 46 CYS n 1 47 LYS n 1 48 ASN n 1 49 CYS n 1 50 THR n 1 51 SER n 1 52 ASP n 1 53 SER n 1 54 VAL n 1 55 ARG n 1 56 GLU n 1 57 LYS n 1 58 PHE n 1 59 LEU n 1 60 GLN n 1 61 GLU n 1 62 ALA n 1 63 LEU n 1 64 THR n 1 65 MET n 1 66 ARG n 1 67 GLN n 1 68 PHE n 1 69 ASP n 1 70 HIS n 1 71 PRO n 1 72 HIS n 1 73 ILE n 1 74 VAL n 1 75 LYS n 1 76 LEU n 1 77 ILE n 1 78 GLY n 1 79 VAL n 1 80 ILE n 1 81 THR n 1 82 GLU n 1 83 ASN n 1 84 PRO n 1 85 VAL n 1 86 TRP n 1 87 ILE n 1 88 ILE n 1 89 MET n 1 90 GLU n 1 91 LEU n 1 92 CYS n 1 93 THR n 1 94 LEU n 1 95 GLY n 1 96 GLU n 1 97 LEU n 1 98 ARG n 1 99 SER n 1 100 PHE n 1 101 LEU n 1 102 GLN n 1 103 VAL n 1 104 ARG n 1 105 LYS n 1 106 PHE n 1 107 SER n 1 108 LEU n 1 109 ASP n 1 110 LEU n 1 111 ALA n 1 112 SER n 1 113 LEU n 1 114 ILE n 1 115 LEU n 1 116 TYR n 1 117 ALA n 1 118 TYR n 1 119 GLN n 1 120 LEU n 1 121 SER n 1 122 THR n 1 123 ALA n 1 124 LEU n 1 125 ALA n 1 126 TYR n 1 127 LEU n 1 128 GLU n 1 129 SER n 1 130 LYS n 1 131 ARG n 1 132 PHE n 1 133 VAL n 1 134 HIS n 1 135 ARG n 1 136 ASP n 1 137 ILE n 1 138 ALA n 1 139 ALA n 1 140 ARG n 1 141 ASN n 1 142 VAL n 1 143 LEU n 1 144 VAL n 1 145 SER n 1 146 ALA n 1 147 THR n 1 148 ASP n 1 149 CYS n 1 150 VAL n 1 151 LYS n 1 152 LEU n 1 153 GLY n 1 154 ASP n 1 155 PHE n 1 156 GLY n 1 157 LEU n 1 158 SER n 1 159 ARG n 1 160 TYR n 1 161 MET n 1 162 GLU n 1 163 ASP n 1 164 SER n 1 165 THR n 1 166 TYR n 1 167 TYR n 1 168 LYS n 1 169 ALA n 1 170 SER n 1 171 LYS n 1 172 GLY n 1 173 LYS n 1 174 LEU n 1 175 PRO n 1 176 ILE n 1 177 LYS n 1 178 TRP n 1 179 MET n 1 180 ALA n 1 181 PRO n 1 182 GLU n 1 183 SER n 1 184 ILE n 1 185 ASN n 1 186 PHE n 1 187 ARG n 1 188 ARG n 1 189 PHE n 1 190 THR n 1 191 SER n 1 192 ALA n 1 193 SER n 1 194 ASP n 1 195 VAL n 1 196 TRP n 1 197 MET n 1 198 PHE n 1 199 GLY n 1 200 VAL n 1 201 CYS n 1 202 MET n 1 203 TRP n 1 204 GLU n 1 205 ILE n 1 206 LEU n 1 207 MET n 1 208 HIS n 1 209 GLY n 1 210 VAL n 1 211 LYS n 1 212 PRO n 1 213 PHE n 1 214 GLN n 1 215 GLY n 1 216 VAL n 1 217 LYS n 1 218 ASN n 1 219 ASN n 1 220 ASP n 1 221 VAL n 1 222 ILE n 1 223 GLY n 1 224 ARG n 1 225 ILE n 1 226 GLU n 1 227 ASN n 1 228 GLY n 1 229 GLU n 1 230 ARG n 1 231 LEU n 1 232 PRO n 1 233 MET n 1 234 PRO n 1 235 PRO n 1 236 ASN n 1 237 CYS n 1 238 PRO n 1 239 PRO n 1 240 THR n 1 241 LEU n 1 242 TYR n 1 243 SER n 1 244 LEU n 1 245 MET n 1 246 THR n 1 247 LYS n 1 248 CYS n 1 249 TRP n 1 250 ALA n 1 251 TYR n 1 252 ASP n 1 253 PRO n 1 254 SER n 1 255 ARG n 1 256 ARG n 1 257 PRO n 1 258 ARG n 1 259 PHE n 1 260 THR n 1 261 GLU n 1 262 LEU n 1 263 LYS n 1 264 ALA n 1 265 GLN n 1 266 LEU n 1 267 SER n 1 268 THR n 1 269 ILE n 1 270 LEU n 1 271 GLU n 1 272 GLU n 1 273 GLU n 1 274 LYS n 1 275 LEU n 1 276 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 276 _entity_src_gen.gene_src_common_name Chicken _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PTK2, FAK, FAK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'unidentified baculovirus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10469 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FAK1_CHICK _struct_ref.pdbx_db_accession Q00944 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;STRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVI TENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRY MEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPT LYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ ; _struct_ref.pdbx_align_begin 411 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6GCR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 276 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q00944 _struct_ref_seq.db_align_beg 411 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 686 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 411 _struct_ref_seq.pdbx_auth_seq_align_end 686 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EUW non-polymer . ;2-[[2-[[4-[[[3,4-bis(oxidanylidene)-2-[2-(propanoylamino)ethylamino]cyclobuten-1-yl]amino]methyl]phenyl]amino]-5-chloranyl-pyrimidin-4-yl]amino]-~{N}-methyl-benzamide ; ? 'C28 H29 Cl N8 O4' 577.034 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GCR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.16 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.99 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.1 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;TRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVI TENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRY MEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPT LYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-11-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.97 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6GCR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 45.93 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18111 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.64 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.8 _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.117 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.3 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.574 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.708 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.67 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6GCR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.300 _refine.ls_d_res_low 45.926 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11701 _refine.ls_number_reflns_R_free 621 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.64 _refine.ls_percent_reflns_R_free 5.31 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2144 _refine.ls_R_factor_R_free 0.2618 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work .2231 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.74 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.23 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2066 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 41 _refine_hist.number_atoms_solvent 66 _refine_hist.number_atoms_total 2173 _refine_hist.d_res_high 2.300 _refine_hist.d_res_low 45.926 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 2158 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.061 ? 2917 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 7.076 ? 1329 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.055 ? 316 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 370 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3000 2.5315 . . 162 2810 99.00 . . . 0.3126 . 0.2626 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5315 2.8977 . . 165 2730 95.00 . . . 0.3718 . 0.2732 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8977 3.6506 . . 145 2727 94.00 . . . 0.3015 . 0.2310 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6506 45.9348 . . 149 2813 95.00 . . . 0.2147 . 0.1717 . . . . . . . . . . # _struct.entry_id 6GCR _struct.title 'Focal Adhesion Kinase catalytic domain in complex with irreversible inhibitor' _struct.pdbx_descriptor 'Focal adhesion kinase 1 (E.C.2.7.10.2)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GCR _struct_keywords.text 'Focal Adhesion Kinase Cell Adhesion Signalling Irreversible inhibitor 2, 4-pyrimidine derivatives, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 8 ? GLU A 10 ? GLN A 418 GLU A 420 5 ? 3 HELX_P HELX_P2 AA2 SER A 51 ? GLN A 67 ? SER A 461 GLN A 477 1 ? 17 HELX_P HELX_P3 AA3 LEU A 97 ? ARG A 104 ? LEU A 507 ARG A 514 1 ? 8 HELX_P HELX_P4 AA4 LYS A 105 ? LEU A 108 ? LYS A 515 LEU A 518 5 ? 4 HELX_P HELX_P5 AA5 ASP A 109 ? LYS A 130 ? ASP A 519 LYS A 540 1 ? 22 HELX_P HELX_P6 AA6 ALA A 138 ? ARG A 140 ? ALA A 548 ARG A 550 5 ? 3 HELX_P HELX_P7 AA7 PRO A 175 ? MET A 179 ? PRO A 585 MET A 589 5 ? 5 HELX_P HELX_P8 AA8 ALA A 180 ? ARG A 187 ? ALA A 590 ARG A 597 1 ? 8 HELX_P HELX_P9 AA9 THR A 190 ? MET A 207 ? THR A 600 MET A 617 1 ? 18 HELX_P HELX_P10 AB1 LYS A 217 ? GLY A 228 ? LYS A 627 GLY A 638 1 ? 12 HELX_P HELX_P11 AB2 PRO A 238 ? TRP A 249 ? PRO A 648 TRP A 659 1 ? 12 HELX_P HELX_P12 AB3 ASP A 252 ? ARG A 256 ? ASP A 662 ARG A 666 5 ? 5 HELX_P HELX_P13 AB4 ARG A 258 ? LYS A 274 ? ARG A 668 LYS A 684 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 17 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id EUW _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id CBB _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 427 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id EUW _struct_conn.ptnr2_auth_seq_id 701 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.766 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 83 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 493 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 84 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 494 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 12 ? GLY A 21 ? ILE A 422 GLY A 431 AA1 2 GLY A 24 ? SER A 33 ? GLY A 434 SER A 443 AA1 3 ASN A 36 ? THR A 45 ? ASN A 446 THR A 455 AA1 4 TRP A 86 ? GLU A 90 ? TRP A 496 GLU A 500 AA1 5 LEU A 76 ? ILE A 80 ? LEU A 486 ILE A 490 AA2 1 GLY A 95 ? GLU A 96 ? GLY A 505 GLU A 506 AA2 2 VAL A 142 ? ALA A 146 ? VAL A 552 ALA A 556 AA2 3 CYS A 149 ? LEU A 152 ? CYS A 559 LEU A 562 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 18 ? N ILE A 428 O VAL A 26 ? O VAL A 436 AA1 2 3 N HIS A 27 ? N HIS A 437 O ILE A 43 ? O ILE A 453 AA1 3 4 N ALA A 42 ? N ALA A 452 O MET A 89 ? O MET A 499 AA1 4 5 O ILE A 88 ? O ILE A 498 N ILE A 77 ? N ILE A 487 AA2 1 2 N GLY A 95 ? N GLY A 505 O VAL A 144 ? O VAL A 554 AA2 2 3 N LEU A 143 ? N LEU A 553 O LYS A 151 ? O LYS A 561 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id EUW _struct_site.pdbx_auth_seq_id 701 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 14 _struct_site.details 'binding site for residue EUW A 701' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 ARG A 16 ? ARG A 426 . ? 1_555 ? 2 AC1 14 CYS A 17 ? CYS A 427 . ? 1_555 ? 3 AC1 14 ILE A 18 ? ILE A 428 . ? 1_555 ? 4 AC1 14 GLY A 19 ? GLY A 429 . ? 1_555 ? 5 AC1 14 GLU A 90 ? GLU A 500 . ? 1_555 ? 6 AC1 14 LEU A 91 ? LEU A 501 . ? 1_555 ? 7 AC1 14 CYS A 92 ? CYS A 502 . ? 1_555 ? 8 AC1 14 GLY A 95 ? GLY A 505 . ? 1_555 ? 9 AC1 14 GLU A 96 ? GLU A 506 . ? 1_555 ? 10 AC1 14 ASN A 141 ? ASN A 551 . ? 1_555 ? 11 AC1 14 LEU A 143 ? LEU A 553 . ? 1_555 ? 12 AC1 14 ASP A 154 ? ASP A 564 . ? 1_555 ? 13 AC1 14 LEU A 157 ? LEU A 567 . ? 1_555 ? 14 AC1 14 SER A 158 ? SER A 568 . ? 1_555 ? # _atom_sites.entry_id 6GCR _atom_sites.fract_transf_matrix[1][1] 0.021698 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001826 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022272 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015113 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 411 ? ? ? A . n A 1 2 THR 2 412 ? ? ? A . n A 1 3 ARG 3 413 413 ARG ARG A . n A 1 4 ASP 4 414 414 ASP ASP A . n A 1 5 TYR 5 415 415 TYR TYR A . n A 1 6 GLU 6 416 416 GLU GLU A . n A 1 7 ILE 7 417 417 ILE ILE A . n A 1 8 GLN 8 418 418 GLN GLN A . n A 1 9 ARG 9 419 419 ARG ARG A . n A 1 10 GLU 10 420 420 GLU GLU A . n A 1 11 ARG 11 421 421 ARG ARG A . n A 1 12 ILE 12 422 422 ILE ILE A . n A 1 13 GLU 13 423 423 GLU GLU A . n A 1 14 LEU 14 424 424 LEU LEU A . n A 1 15 GLY 15 425 425 GLY GLY A . n A 1 16 ARG 16 426 426 ARG ARG A . n A 1 17 CYS 17 427 427 CYS CYS A . n A 1 18 ILE 18 428 428 ILE ILE A . n A 1 19 GLY 19 429 429 GLY GLY A . n A 1 20 GLU 20 430 430 GLU GLU A . n A 1 21 GLY 21 431 431 GLY GLY A . n A 1 22 GLN 22 432 432 GLN GLN A . n A 1 23 PHE 23 433 433 PHE PHE A . n A 1 24 GLY 24 434 434 GLY GLY A . n A 1 25 ASP 25 435 435 ASP ASP A . n A 1 26 VAL 26 436 436 VAL VAL A . n A 1 27 HIS 27 437 437 HIS HIS A . n A 1 28 GLN 28 438 438 GLN GLN A . n A 1 29 GLY 29 439 439 GLY GLY A . n A 1 30 ILE 30 440 440 ILE ILE A . n A 1 31 TYR 31 441 441 TYR TYR A . n A 1 32 MET 32 442 442 MET MET A . n A 1 33 SER 33 443 443 SER SER A . n A 1 34 PRO 34 444 444 PRO PRO A . n A 1 35 GLU 35 445 445 GLU GLU A . n A 1 36 ASN 36 446 446 ASN ASN A . n A 1 37 PRO 37 447 447 PRO PRO A . n A 1 38 ALA 38 448 448 ALA ALA A . n A 1 39 MET 39 449 449 MET MET A . n A 1 40 ALA 40 450 450 ALA ALA A . n A 1 41 VAL 41 451 451 VAL VAL A . n A 1 42 ALA 42 452 452 ALA ALA A . n A 1 43 ILE 43 453 453 ILE ILE A . n A 1 44 LYS 44 454 454 LYS LYS A . n A 1 45 THR 45 455 455 THR THR A . n A 1 46 CYS 46 456 456 CYS CYS A . n A 1 47 LYS 47 457 457 LYS LYS A . n A 1 48 ASN 48 458 458 ASN ASN A . n A 1 49 CYS 49 459 459 CYS CYS A . n A 1 50 THR 50 460 460 THR THR A . n A 1 51 SER 51 461 461 SER SER A . n A 1 52 ASP 52 462 462 ASP ASP A . n A 1 53 SER 53 463 463 SER SER A . n A 1 54 VAL 54 464 464 VAL VAL A . n A 1 55 ARG 55 465 465 ARG ARG A . n A 1 56 GLU 56 466 466 GLU GLU A . n A 1 57 LYS 57 467 467 LYS LYS A . n A 1 58 PHE 58 468 468 PHE PHE A . n A 1 59 LEU 59 469 469 LEU LEU A . n A 1 60 GLN 60 470 470 GLN GLN A . n A 1 61 GLU 61 471 471 GLU GLU A . n A 1 62 ALA 62 472 472 ALA ALA A . n A 1 63 LEU 63 473 473 LEU LEU A . n A 1 64 THR 64 474 474 THR THR A . n A 1 65 MET 65 475 475 MET MET A . n A 1 66 ARG 66 476 476 ARG ARG A . n A 1 67 GLN 67 477 477 GLN GLN A . n A 1 68 PHE 68 478 478 PHE PHE A . n A 1 69 ASP 69 479 479 ASP ASP A . n A 1 70 HIS 70 480 480 HIS HIS A . n A 1 71 PRO 71 481 481 PRO PRO A . n A 1 72 HIS 72 482 482 HIS HIS A . n A 1 73 ILE 73 483 483 ILE ILE A . n A 1 74 VAL 74 484 484 VAL VAL A . n A 1 75 LYS 75 485 485 LYS LYS A . n A 1 76 LEU 76 486 486 LEU LEU A . n A 1 77 ILE 77 487 487 ILE ILE A . n A 1 78 GLY 78 488 488 GLY GLY A . n A 1 79 VAL 79 489 489 VAL VAL A . n A 1 80 ILE 80 490 490 ILE ILE A . n A 1 81 THR 81 491 491 THR THR A . n A 1 82 GLU 82 492 492 GLU GLU A . n A 1 83 ASN 83 493 493 ASN ASN A . n A 1 84 PRO 84 494 494 PRO PRO A . n A 1 85 VAL 85 495 495 VAL VAL A . n A 1 86 TRP 86 496 496 TRP TRP A . n A 1 87 ILE 87 497 497 ILE ILE A . n A 1 88 ILE 88 498 498 ILE ILE A . n A 1 89 MET 89 499 499 MET MET A . n A 1 90 GLU 90 500 500 GLU GLU A . n A 1 91 LEU 91 501 501 LEU LEU A . n A 1 92 CYS 92 502 502 CYS CYS A . n A 1 93 THR 93 503 503 THR THR A . n A 1 94 LEU 94 504 504 LEU LEU A . n A 1 95 GLY 95 505 505 GLY GLY A . n A 1 96 GLU 96 506 506 GLU GLU A . n A 1 97 LEU 97 507 507 LEU LEU A . n A 1 98 ARG 98 508 508 ARG ARG A . n A 1 99 SER 99 509 509 SER SER A . n A 1 100 PHE 100 510 510 PHE PHE A . n A 1 101 LEU 101 511 511 LEU LEU A . n A 1 102 GLN 102 512 512 GLN GLN A . n A 1 103 VAL 103 513 513 VAL VAL A . n A 1 104 ARG 104 514 514 ARG ARG A . n A 1 105 LYS 105 515 515 LYS LYS A . n A 1 106 PHE 106 516 516 PHE PHE A . n A 1 107 SER 107 517 517 SER SER A . n A 1 108 LEU 108 518 518 LEU LEU A . n A 1 109 ASP 109 519 519 ASP ASP A . n A 1 110 LEU 110 520 520 LEU LEU A . n A 1 111 ALA 111 521 521 ALA ALA A . n A 1 112 SER 112 522 522 SER SER A . n A 1 113 LEU 113 523 523 LEU LEU A . n A 1 114 ILE 114 524 524 ILE ILE A . n A 1 115 LEU 115 525 525 LEU LEU A . n A 1 116 TYR 116 526 526 TYR TYR A . n A 1 117 ALA 117 527 527 ALA ALA A . n A 1 118 TYR 118 528 528 TYR TYR A . n A 1 119 GLN 119 529 529 GLN GLN A . n A 1 120 LEU 120 530 530 LEU LEU A . n A 1 121 SER 121 531 531 SER SER A . n A 1 122 THR 122 532 532 THR THR A . n A 1 123 ALA 123 533 533 ALA ALA A . n A 1 124 LEU 124 534 534 LEU LEU A . n A 1 125 ALA 125 535 535 ALA ALA A . n A 1 126 TYR 126 536 536 TYR TYR A . n A 1 127 LEU 127 537 537 LEU LEU A . n A 1 128 GLU 128 538 538 GLU GLU A . n A 1 129 SER 129 539 539 SER SER A . n A 1 130 LYS 130 540 540 LYS LYS A . n A 1 131 ARG 131 541 541 ARG ARG A . n A 1 132 PHE 132 542 542 PHE PHE A . n A 1 133 VAL 133 543 543 VAL VAL A . n A 1 134 HIS 134 544 544 HIS HIS A . n A 1 135 ARG 135 545 545 ARG ARG A . n A 1 136 ASP 136 546 546 ASP ASP A . n A 1 137 ILE 137 547 547 ILE ILE A . n A 1 138 ALA 138 548 548 ALA ALA A . n A 1 139 ALA 139 549 549 ALA ALA A . n A 1 140 ARG 140 550 550 ARG ARG A . n A 1 141 ASN 141 551 551 ASN ASN A . n A 1 142 VAL 142 552 552 VAL VAL A . n A 1 143 LEU 143 553 553 LEU LEU A . n A 1 144 VAL 144 554 554 VAL VAL A . n A 1 145 SER 145 555 555 SER SER A . n A 1 146 ALA 146 556 556 ALA ALA A . n A 1 147 THR 147 557 557 THR THR A . n A 1 148 ASP 148 558 558 ASP ASP A . n A 1 149 CYS 149 559 559 CYS CYS A . n A 1 150 VAL 150 560 560 VAL VAL A . n A 1 151 LYS 151 561 561 LYS LYS A . n A 1 152 LEU 152 562 562 LEU LEU A . n A 1 153 GLY 153 563 563 GLY GLY A . n A 1 154 ASP 154 564 564 ASP ASP A . n A 1 155 PHE 155 565 565 PHE PHE A . n A 1 156 GLY 156 566 566 GLY GLY A . n A 1 157 LEU 157 567 567 LEU LEU A . n A 1 158 SER 158 568 568 SER SER A . n A 1 159 ARG 159 569 569 ARG ARG A . n A 1 160 TYR 160 570 ? ? ? A . n A 1 161 MET 161 571 ? ? ? A . n A 1 162 GLU 162 572 ? ? ? A . n A 1 163 ASP 163 573 ? ? ? A . n A 1 164 SER 164 574 ? ? ? A . n A 1 165 THR 165 575 ? ? ? A . n A 1 166 TYR 166 576 ? ? ? A . n A 1 167 TYR 167 577 ? ? ? A . n A 1 168 LYS 168 578 ? ? ? A . n A 1 169 ALA 169 579 ? ? ? A . n A 1 170 SER 170 580 ? ? ? A . n A 1 171 LYS 171 581 ? ? ? A . n A 1 172 GLY 172 582 ? ? ? A . n A 1 173 LYS 173 583 ? ? ? A . n A 1 174 LEU 174 584 584 LEU LEU A . n A 1 175 PRO 175 585 585 PRO PRO A . n A 1 176 ILE 176 586 586 ILE ILE A . n A 1 177 LYS 177 587 587 LYS LYS A . n A 1 178 TRP 178 588 588 TRP TRP A . n A 1 179 MET 179 589 589 MET MET A . n A 1 180 ALA 180 590 590 ALA ALA A . n A 1 181 PRO 181 591 591 PRO PRO A . n A 1 182 GLU 182 592 592 GLU GLU A . n A 1 183 SER 183 593 593 SER SER A . n A 1 184 ILE 184 594 594 ILE ILE A . n A 1 185 ASN 185 595 595 ASN ASN A . n A 1 186 PHE 186 596 596 PHE PHE A . n A 1 187 ARG 187 597 597 ARG ARG A . n A 1 188 ARG 188 598 598 ARG ARG A . n A 1 189 PHE 189 599 599 PHE PHE A . n A 1 190 THR 190 600 600 THR THR A . n A 1 191 SER 191 601 601 SER SER A . n A 1 192 ALA 192 602 602 ALA ALA A . n A 1 193 SER 193 603 603 SER SER A . n A 1 194 ASP 194 604 604 ASP ASP A . n A 1 195 VAL 195 605 605 VAL VAL A . n A 1 196 TRP 196 606 606 TRP TRP A . n A 1 197 MET 197 607 607 MET MET A . n A 1 198 PHE 198 608 608 PHE PHE A . n A 1 199 GLY 199 609 609 GLY GLY A . n A 1 200 VAL 200 610 610 VAL VAL A . n A 1 201 CYS 201 611 611 CYS CYS A . n A 1 202 MET 202 612 612 MET MET A . n A 1 203 TRP 203 613 613 TRP TRP A . n A 1 204 GLU 204 614 614 GLU GLU A . n A 1 205 ILE 205 615 615 ILE ILE A . n A 1 206 LEU 206 616 616 LEU LEU A . n A 1 207 MET 207 617 617 MET MET A . n A 1 208 HIS 208 618 618 HIS HIS A . n A 1 209 GLY 209 619 619 GLY GLY A . n A 1 210 VAL 210 620 620 VAL VAL A . n A 1 211 LYS 211 621 621 LYS LYS A . n A 1 212 PRO 212 622 622 PRO PRO A . n A 1 213 PHE 213 623 623 PHE PHE A . n A 1 214 GLN 214 624 624 GLN GLN A . n A 1 215 GLY 215 625 625 GLY GLY A . n A 1 216 VAL 216 626 626 VAL VAL A . n A 1 217 LYS 217 627 627 LYS LYS A . n A 1 218 ASN 218 628 628 ASN ASN A . n A 1 219 ASN 219 629 629 ASN ASN A . n A 1 220 ASP 220 630 630 ASP ASP A . n A 1 221 VAL 221 631 631 VAL VAL A . n A 1 222 ILE 222 632 632 ILE ILE A . n A 1 223 GLY 223 633 633 GLY GLY A . n A 1 224 ARG 224 634 634 ARG ARG A . n A 1 225 ILE 225 635 635 ILE ILE A . n A 1 226 GLU 226 636 636 GLU GLU A . n A 1 227 ASN 227 637 637 ASN ASN A . n A 1 228 GLY 228 638 638 GLY GLY A . n A 1 229 GLU 229 639 639 GLU GLU A . n A 1 230 ARG 230 640 640 ARG ARG A . n A 1 231 LEU 231 641 641 LEU LEU A . n A 1 232 PRO 232 642 642 PRO PRO A . n A 1 233 MET 233 643 643 MET MET A . n A 1 234 PRO 234 644 644 PRO PRO A . n A 1 235 PRO 235 645 645 PRO PRO A . n A 1 236 ASN 236 646 646 ASN ASN A . n A 1 237 CYS 237 647 647 CYS CYS A . n A 1 238 PRO 238 648 648 PRO PRO A . n A 1 239 PRO 239 649 649 PRO PRO A . n A 1 240 THR 240 650 650 THR THR A . n A 1 241 LEU 241 651 651 LEU LEU A . n A 1 242 TYR 242 652 652 TYR TYR A . n A 1 243 SER 243 653 653 SER SER A . n A 1 244 LEU 244 654 654 LEU LEU A . n A 1 245 MET 245 655 655 MET MET A . n A 1 246 THR 246 656 656 THR THR A . n A 1 247 LYS 247 657 657 LYS LYS A . n A 1 248 CYS 248 658 658 CYS CYS A . n A 1 249 TRP 249 659 659 TRP TRP A . n A 1 250 ALA 250 660 660 ALA ALA A . n A 1 251 TYR 251 661 661 TYR TYR A . n A 1 252 ASP 252 662 662 ASP ASP A . n A 1 253 PRO 253 663 663 PRO PRO A . n A 1 254 SER 254 664 664 SER SER A . n A 1 255 ARG 255 665 665 ARG ARG A . n A 1 256 ARG 256 666 666 ARG ARG A . n A 1 257 PRO 257 667 667 PRO PRO A . n A 1 258 ARG 258 668 668 ARG ARG A . n A 1 259 PHE 259 669 669 PHE PHE A . n A 1 260 THR 260 670 670 THR THR A . n A 1 261 GLU 261 671 671 GLU GLU A . n A 1 262 LEU 262 672 672 LEU LEU A . n A 1 263 LYS 263 673 673 LYS LYS A . n A 1 264 ALA 264 674 674 ALA ALA A . n A 1 265 GLN 265 675 675 GLN GLN A . n A 1 266 LEU 266 676 676 LEU LEU A . n A 1 267 SER 267 677 677 SER SER A . n A 1 268 THR 268 678 678 THR THR A . n A 1 269 ILE 269 679 679 ILE ILE A . n A 1 270 LEU 270 680 680 LEU LEU A . n A 1 271 GLU 271 681 681 GLU GLU A . n A 1 272 GLU 272 682 682 GLU GLU A . n A 1 273 GLU 273 683 683 GLU GLU A . n A 1 274 LYS 274 684 684 LYS LYS A . n A 1 275 LEU 275 685 ? ? ? A . n A 1 276 GLN 276 686 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EUW 1 701 1 EUW DRG A . C 3 HOH 1 801 29 HOH HOH A . C 3 HOH 2 802 65 HOH HOH A . C 3 HOH 3 803 46 HOH HOH A . C 3 HOH 4 804 53 HOH HOH A . C 3 HOH 5 805 23 HOH HOH A . C 3 HOH 6 806 6 HOH HOH A . C 3 HOH 7 807 50 HOH HOH A . C 3 HOH 8 808 16 HOH HOH A . C 3 HOH 9 809 27 HOH HOH A . C 3 HOH 10 810 58 HOH HOH A . C 3 HOH 11 811 55 HOH HOH A . C 3 HOH 12 812 15 HOH HOH A . C 3 HOH 13 813 34 HOH HOH A . C 3 HOH 14 814 52 HOH HOH A . C 3 HOH 15 815 22 HOH HOH A . C 3 HOH 16 816 4 HOH HOH A . C 3 HOH 17 817 32 HOH HOH A . C 3 HOH 18 818 36 HOH HOH A . C 3 HOH 19 819 20 HOH HOH A . C 3 HOH 20 820 13 HOH HOH A . C 3 HOH 21 821 62 HOH HOH A . C 3 HOH 22 822 10 HOH HOH A . C 3 HOH 23 823 21 HOH HOH A . C 3 HOH 24 824 31 HOH HOH A . C 3 HOH 25 825 67 HOH HOH A . C 3 HOH 26 826 54 HOH HOH A . C 3 HOH 27 827 17 HOH HOH A . C 3 HOH 28 828 18 HOH HOH A . C 3 HOH 29 829 1 HOH HOH A . C 3 HOH 30 830 14 HOH HOH A . C 3 HOH 31 831 30 HOH HOH A . C 3 HOH 32 832 64 HOH HOH A . C 3 HOH 33 833 5 HOH HOH A . C 3 HOH 34 834 8 HOH HOH A . C 3 HOH 35 835 43 HOH HOH A . C 3 HOH 36 836 61 HOH HOH A . C 3 HOH 37 837 2 HOH HOH A . C 3 HOH 38 838 19 HOH HOH A . C 3 HOH 39 839 39 HOH HOH A . C 3 HOH 40 840 9 HOH HOH A . C 3 HOH 41 841 7 HOH HOH A . C 3 HOH 42 842 51 HOH HOH A . C 3 HOH 43 843 3 HOH HOH A . C 3 HOH 44 844 59 HOH HOH A . C 3 HOH 45 845 41 HOH HOH A . C 3 HOH 46 846 12 HOH HOH A . C 3 HOH 47 847 44 HOH HOH A . C 3 HOH 48 848 33 HOH HOH A . C 3 HOH 49 849 42 HOH HOH A . C 3 HOH 50 850 47 HOH HOH A . C 3 HOH 51 851 37 HOH HOH A . C 3 HOH 52 852 38 HOH HOH A . C 3 HOH 53 853 24 HOH HOH A . C 3 HOH 54 854 45 HOH HOH A . C 3 HOH 55 855 48 HOH HOH A . C 3 HOH 56 856 26 HOH HOH A . C 3 HOH 57 857 57 HOH HOH A . C 3 HOH 58 858 66 HOH HOH A . C 3 HOH 59 859 35 HOH HOH A . C 3 HOH 60 860 63 HOH HOH A . C 3 HOH 61 861 40 HOH HOH A . C 3 HOH 62 862 60 HOH HOH A . C 3 HOH 63 863 28 HOH HOH A . C 3 HOH 64 864 25 HOH HOH A . C 3 HOH 65 865 11 HOH HOH A . C 3 HOH 66 866 49 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12670 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-01 2 'Structure model' 1 1 2019-10-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.12_2829: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 516 ? ? -67.68 0.07 2 1 ARG A 545 ? ? 81.04 -5.76 3 1 ASP A 546 ? ? -144.92 51.53 4 1 ALA A 548 ? ? -177.06 145.73 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 458 ? CG ? A ASN 48 CG 2 1 Y 1 A ASN 458 ? OD1 ? A ASN 48 OD1 3 1 Y 1 A ASN 458 ? ND2 ? A ASN 48 ND2 4 1 Y 1 A ARG 597 ? CG ? A ARG 187 CG 5 1 Y 1 A ARG 597 ? CD ? A ARG 187 CD 6 1 Y 1 A ARG 597 ? NE ? A ARG 187 NE 7 1 Y 1 A ARG 597 ? CZ ? A ARG 187 CZ 8 1 Y 1 A ARG 597 ? NH1 ? A ARG 187 NH1 9 1 Y 1 A ARG 597 ? NH2 ? A ARG 187 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 411 ? A SER 1 2 1 Y 1 A THR 412 ? A THR 2 3 1 Y 1 A TYR 570 ? A TYR 160 4 1 Y 1 A MET 571 ? A MET 161 5 1 Y 1 A GLU 572 ? A GLU 162 6 1 Y 1 A ASP 573 ? A ASP 163 7 1 Y 1 A SER 574 ? A SER 164 8 1 Y 1 A THR 575 ? A THR 165 9 1 Y 1 A TYR 576 ? A TYR 166 10 1 Y 1 A TYR 577 ? A TYR 167 11 1 Y 1 A LYS 578 ? A LYS 168 12 1 Y 1 A ALA 579 ? A ALA 169 13 1 Y 1 A SER 580 ? A SER 170 14 1 Y 1 A LYS 581 ? A LYS 171 15 1 Y 1 A GLY 582 ? A GLY 172 16 1 Y 1 A LYS 583 ? A LYS 173 17 1 Y 1 A LEU 685 ? A LEU 275 18 1 Y 1 A GLN 686 ? A GLN 276 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id EUW _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id EUW _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;2-[[2-[[4-[[[3,4-bis(oxidanylidene)-2-[2-(propanoylamino)ethylamino]cyclobuten-1-yl]amino]methyl]phenyl]amino]-5-chloranyl-pyrimidin-4-yl]amino]-~{N}-methyl-benzamide ; EUW 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #