data_6H5K # _entry.id 6H5K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6H5K pdb_00006h5k 10.2210/pdb6h5k/pdb WWPDB D_1200011076 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-08-07 2 'Structure model' 1 1 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' pdbx_struct_conn_angle 6 2 'Structure model' struct_conn 7 2 'Structure model' struct_conn_type # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 19 2 'Structure model' '_pdbx_struct_conn_angle.value' 20 2 'Structure model' '_struct_conn.conn_type_id' 21 2 'Structure model' '_struct_conn.id' 22 2 'Structure model' '_struct_conn.pdbx_dist_value' 23 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 24 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 25 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 26 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 27 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 28 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 29 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 30 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 31 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 32 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 33 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 34 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 35 2 'Structure model' '_struct_conn.ptnr2_symmetry' 36 2 'Structure model' '_struct_conn_type.id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6H5K _pdbx_database_status.recvd_initial_deposition_date 2018-07-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Barber-Zucker, S.' 1 0000-0003-1835-730X 'Zarivach, R.' 2 0000-0001-6543-0296 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'MamM CTD D249E - Zinc form' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barber-Zucker, S.' 1 ? primary 'Zarivach, R.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Magnetosome protein MamM, Cation efflux protein family' 11924.424 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 3 non-polymer syn BETA-MERCAPTOETHANOL 78.133 1 ? ? ? ? 4 water nat water 18.015 78 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MamM protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMEAVQNRIVEAAERVPGVRGVIHLRARYVGQDIWAEMIIGVDPENTVEQAHEICEAVQAAVCGKIRRIESLHVSAEA REIGDTTKPSFSDQPLSFDEVMLSKVDN ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMEAVQNRIVEAAERVPGVRGVIHLRARYVGQDIWAEMIIGVDPENTVEQAHEICEAVQAAVCGKIRRIESLHVSAEA REIGDTTKPSFSDQPLSFDEVMLSKVDN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 BETA-MERCAPTOETHANOL BME 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLU n 1 6 ALA n 1 7 VAL n 1 8 GLN n 1 9 ASN n 1 10 ARG n 1 11 ILE n 1 12 VAL n 1 13 GLU n 1 14 ALA n 1 15 ALA n 1 16 GLU n 1 17 ARG n 1 18 VAL n 1 19 PRO n 1 20 GLY n 1 21 VAL n 1 22 ARG n 1 23 GLY n 1 24 VAL n 1 25 ILE n 1 26 HIS n 1 27 LEU n 1 28 ARG n 1 29 ALA n 1 30 ARG n 1 31 TYR n 1 32 VAL n 1 33 GLY n 1 34 GLN n 1 35 ASP n 1 36 ILE n 1 37 TRP n 1 38 ALA n 1 39 GLU n 1 40 MET n 1 41 ILE n 1 42 ILE n 1 43 GLY n 1 44 VAL n 1 45 ASP n 1 46 PRO n 1 47 GLU n 1 48 ASN n 1 49 THR n 1 50 VAL n 1 51 GLU n 1 52 GLN n 1 53 ALA n 1 54 HIS n 1 55 GLU n 1 56 ILE n 1 57 CYS n 1 58 GLU n 1 59 ALA n 1 60 VAL n 1 61 GLN n 1 62 ALA n 1 63 ALA n 1 64 VAL n 1 65 CYS n 1 66 GLY n 1 67 LYS n 1 68 ILE n 1 69 ARG n 1 70 ARG n 1 71 ILE n 1 72 GLU n 1 73 SER n 1 74 LEU n 1 75 HIS n 1 76 VAL n 1 77 SER n 1 78 ALA n 1 79 GLU n 1 80 ALA n 1 81 ARG n 1 82 GLU n 1 83 ILE n 1 84 GLY n 1 85 ASP n 1 86 THR n 1 87 THR n 1 88 LYS n 1 89 PRO n 1 90 SER n 1 91 PHE n 1 92 SER n 1 93 ASP n 1 94 GLN n 1 95 PRO n 1 96 LEU n 1 97 SER n 1 98 PHE n 1 99 ASP n 1 100 GLU n 1 101 VAL n 1 102 MET n 1 103 LEU n 1 104 SER n 1 105 LYS n 1 106 VAL n 1 107 ASP n 1 108 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 108 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'mamM, mgI491, MGR_4095' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Magnetospirillum gryphiswaldense' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 55518 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Rosetta _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BME non-polymer . BETA-MERCAPTOETHANOL ? 'C2 H6 O S' 78.133 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 211 211 GLY GLY A . n A 1 2 SER 2 212 212 SER SER A . n A 1 3 HIS 3 213 213 HIS HIS A . n A 1 4 MET 4 214 214 MET MET A . n A 1 5 GLU 5 215 215 GLU GLU A . n A 1 6 ALA 6 216 216 ALA ALA A . n A 1 7 VAL 7 217 217 VAL VAL A . n A 1 8 GLN 8 218 218 GLN GLN A . n A 1 9 ASN 9 219 219 ASN ASN A . n A 1 10 ARG 10 220 220 ARG ARG A . n A 1 11 ILE 11 221 221 ILE ILE A . n A 1 12 VAL 12 222 222 VAL VAL A . n A 1 13 GLU 13 223 223 GLU GLU A . n A 1 14 ALA 14 224 224 ALA ALA A . n A 1 15 ALA 15 225 225 ALA ALA A . n A 1 16 GLU 16 226 226 GLU GLU A . n A 1 17 ARG 17 227 227 ARG ARG A . n A 1 18 VAL 18 228 228 VAL VAL A . n A 1 19 PRO 19 229 229 PRO PRO A . n A 1 20 GLY 20 230 230 GLY GLY A . n A 1 21 VAL 21 231 231 VAL VAL A . n A 1 22 ARG 22 232 232 ARG ARG A . n A 1 23 GLY 23 233 233 GLY GLY A . n A 1 24 VAL 24 234 234 VAL VAL A . n A 1 25 ILE 25 235 235 ILE ILE A . n A 1 26 HIS 26 236 236 HIS HIS A . n A 1 27 LEU 27 237 237 LEU LEU A . n A 1 28 ARG 28 238 238 ARG ARG A . n A 1 29 ALA 29 239 239 ALA ALA A . n A 1 30 ARG 30 240 240 ARG ARG A . n A 1 31 TYR 31 241 241 TYR TYR A . n A 1 32 VAL 32 242 242 VAL VAL A . n A 1 33 GLY 33 243 243 GLY GLY A . n A 1 34 GLN 34 244 244 GLN GLN A . n A 1 35 ASP 35 245 245 ASP ASP A . n A 1 36 ILE 36 246 246 ILE ILE A . n A 1 37 TRP 37 247 247 TRP TRP A . n A 1 38 ALA 38 248 248 ALA ALA A . n A 1 39 GLU 39 249 249 GLU GLU A . n A 1 40 MET 40 250 250 MET MET A . n A 1 41 ILE 41 251 251 ILE ILE A . n A 1 42 ILE 42 252 252 ILE ILE A . n A 1 43 GLY 43 253 253 GLY GLY A . n A 1 44 VAL 44 254 254 VAL VAL A . n A 1 45 ASP 45 255 255 ASP ASP A . n A 1 46 PRO 46 256 256 PRO PRO A . n A 1 47 GLU 47 257 257 GLU GLU A . n A 1 48 ASN 48 258 258 ASN ASN A . n A 1 49 THR 49 259 259 THR THR A . n A 1 50 VAL 50 260 260 VAL VAL A . n A 1 51 GLU 51 261 261 GLU GLU A . n A 1 52 GLN 52 262 262 GLN GLN A . n A 1 53 ALA 53 263 263 ALA ALA A . n A 1 54 HIS 54 264 264 HIS HIS A . n A 1 55 GLU 55 265 265 GLU GLU A . n A 1 56 ILE 56 266 266 ILE ILE A . n A 1 57 CYS 57 267 267 CYS CYS A . n A 1 58 GLU 58 268 268 GLU GLU A . n A 1 59 ALA 59 269 269 ALA ALA A . n A 1 60 VAL 60 270 270 VAL VAL A . n A 1 61 GLN 61 271 271 GLN GLN A . n A 1 62 ALA 62 272 272 ALA ALA A . n A 1 63 ALA 63 273 273 ALA ALA A . n A 1 64 VAL 64 274 274 VAL VAL A . n A 1 65 CYS 65 275 275 CYS CYS A . n A 1 66 GLY 66 276 276 GLY GLY A . n A 1 67 LYS 67 277 277 LYS LYS A . n A 1 68 ILE 68 278 278 ILE ILE A . n A 1 69 ARG 69 279 279 ARG ARG A . n A 1 70 ARG 70 280 280 ARG ARG A . n A 1 71 ILE 71 281 281 ILE ILE A . n A 1 72 GLU 72 282 282 GLU GLU A . n A 1 73 SER 73 283 283 SER SER A . n A 1 74 LEU 74 284 284 LEU LEU A . n A 1 75 HIS 75 285 285 HIS HIS A . n A 1 76 VAL 76 286 286 VAL VAL A . n A 1 77 SER 77 287 287 SER SER A . n A 1 78 ALA 78 288 288 ALA ALA A . n A 1 79 GLU 79 289 289 GLU GLU A . n A 1 80 ALA 80 290 290 ALA ALA A . n A 1 81 ARG 81 291 291 ARG ARG A . n A 1 82 GLU 82 292 292 GLU GLU A . n A 1 83 ILE 83 293 ? ? ? A . n A 1 84 GLY 84 294 294 GLY GLY A . n A 1 85 ASP 85 295 295 ASP ASP A . n A 1 86 THR 86 296 296 THR THR A . n A 1 87 THR 87 297 297 THR THR A . n A 1 88 LYS 88 298 298 LYS LYS A . n A 1 89 PRO 89 299 299 PRO PRO A . n A 1 90 SER 90 300 300 SER SER A . n A 1 91 PHE 91 301 301 PHE PHE A . n A 1 92 SER 92 302 302 SER SER A . n A 1 93 ASP 93 303 ? ? ? A . n A 1 94 GLN 94 304 ? ? ? A . n A 1 95 PRO 95 305 ? ? ? A . n A 1 96 LEU 96 306 ? ? ? A . n A 1 97 SER 97 307 ? ? ? A . n A 1 98 PHE 98 308 ? ? ? A . n A 1 99 ASP 99 309 ? ? ? A . n A 1 100 GLU 100 310 ? ? ? A . n A 1 101 VAL 101 311 ? ? ? A . n A 1 102 MET 102 312 ? ? ? A . n A 1 103 LEU 103 313 ? ? ? A . n A 1 104 SER 104 314 ? ? ? A . n A 1 105 LYS 105 315 ? ? ? A . n A 1 106 VAL 106 316 ? ? ? A . n A 1 107 ASP 107 317 ? ? ? A . n A 1 108 ASN 108 318 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 1 ZN ZN A . C 2 ZN 1 402 2 ZN ZN A . D 2 ZN 1 403 3 ZN ZN A . E 3 BME 1 404 1 BME BME A . F 4 HOH 1 501 53 HOH HOH A . F 4 HOH 2 502 63 HOH HOH A . F 4 HOH 3 503 4 HOH HOH A . F 4 HOH 4 504 52 HOH HOH A . F 4 HOH 5 505 32 HOH HOH A . F 4 HOH 6 506 39 HOH HOH A . F 4 HOH 7 507 5 HOH HOH A . F 4 HOH 8 508 37 HOH HOH A . F 4 HOH 9 509 21 HOH HOH A . F 4 HOH 10 510 36 HOH HOH A . F 4 HOH 11 511 2 HOH HOH A . F 4 HOH 12 512 38 HOH HOH A . F 4 HOH 13 513 23 HOH HOH A . F 4 HOH 14 514 84 HOH HOH A . F 4 HOH 15 515 6 HOH HOH A . F 4 HOH 16 516 69 HOH HOH A . F 4 HOH 17 517 10 HOH HOH A . F 4 HOH 18 518 67 HOH HOH A . F 4 HOH 19 519 24 HOH HOH A . F 4 HOH 20 520 12 HOH HOH A . F 4 HOH 21 521 70 HOH HOH A . F 4 HOH 22 522 56 HOH HOH A . F 4 HOH 23 523 20 HOH HOH A . F 4 HOH 24 524 17 HOH HOH A . F 4 HOH 25 525 41 HOH HOH A . F 4 HOH 26 526 27 HOH HOH A . F 4 HOH 27 527 13 HOH HOH A . F 4 HOH 28 528 11 HOH HOH A . F 4 HOH 29 529 71 HOH HOH A . F 4 HOH 30 530 31 HOH HOH A . F 4 HOH 31 531 22 HOH HOH A . F 4 HOH 32 532 26 HOH HOH A . F 4 HOH 33 533 60 HOH HOH A . F 4 HOH 34 534 16 HOH HOH A . F 4 HOH 35 535 9 HOH HOH A . F 4 HOH 36 536 42 HOH HOH A . F 4 HOH 37 537 15 HOH HOH A . F 4 HOH 38 538 66 HOH HOH A . F 4 HOH 39 539 30 HOH HOH A . F 4 HOH 40 540 64 HOH HOH A . F 4 HOH 41 541 65 HOH HOH A . F 4 HOH 42 542 35 HOH HOH A . F 4 HOH 43 543 19 HOH HOH A . F 4 HOH 44 544 7 HOH HOH A . F 4 HOH 45 545 79 HOH HOH A . F 4 HOH 46 546 55 HOH HOH A . F 4 HOH 47 547 47 HOH HOH A . F 4 HOH 48 548 8 HOH HOH A . F 4 HOH 49 549 81 HOH HOH A . F 4 HOH 50 550 75 HOH HOH A . F 4 HOH 51 551 57 HOH HOH A . F 4 HOH 52 552 54 HOH HOH A . F 4 HOH 53 553 3 HOH HOH A . F 4 HOH 54 554 14 HOH HOH A . F 4 HOH 55 555 59 HOH HOH A . F 4 HOH 56 556 1 HOH HOH A . F 4 HOH 57 557 18 HOH HOH A . F 4 HOH 58 558 50 HOH HOH A . F 4 HOH 59 559 58 HOH HOH A . F 4 HOH 60 560 29 HOH HOH A . F 4 HOH 61 561 61 HOH HOH A . F 4 HOH 62 562 49 HOH HOH A . F 4 HOH 63 563 33 HOH HOH A . F 4 HOH 64 564 74 HOH HOH A . F 4 HOH 65 565 83 HOH HOH A . F 4 HOH 66 566 77 HOH HOH A . F 4 HOH 67 567 43 HOH HOH A . F 4 HOH 68 568 76 HOH HOH A . F 4 HOH 69 569 62 HOH HOH A . F 4 HOH 70 570 46 HOH HOH A . F 4 HOH 71 571 25 HOH HOH A . F 4 HOH 72 572 48 HOH HOH A . F 4 HOH 73 573 28 HOH HOH A . F 4 HOH 74 574 72 HOH HOH A . F 4 HOH 75 575 44 HOH HOH A . F 4 HOH 76 576 73 HOH HOH A . F 4 HOH 77 577 45 HOH HOH A . F 4 HOH 78 578 34 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0230 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6H5K _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.151 _cell.length_a_esd ? _cell.length_b 53.151 _cell.length_b_esd ? _cell.length_c 63.862 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6H5K _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6H5K _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.18 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.68 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.3M MgFormate, 0.1M Tris pH=8.5, 1.7 mM ZnCl2 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-05-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97626 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97626 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6H5K _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.54 _reflns.d_resolution_low 46.03 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15927 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.8 _reflns.pdbx_Rmerge_I_obs 0.115 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.54 _reflns_shell.d_res_low 1.57 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 11.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 98.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.990 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.55 _refine.aniso_B[1][2] -0.28 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.55 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 1.80 _refine.B_iso_max ? _refine.B_iso_mean 20.601 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.963 _refine.correlation_coeff_Fo_to_Fc_free 0.955 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6H5K _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.54 _refine.ls_d_res_low 46.03 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15070 _refine.ls_number_reflns_R_free 830 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.89 _refine.ls_percent_reflns_R_free 5.2 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.14957 _refine.ls_R_factor_R_free 0.18618 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.14756 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3W5X _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.074 _refine.pdbx_overall_ESU_R_Free 0.067 _refine.pdbx_solvent_vdw_probe_radii 1.00 _refine.pdbx_solvent_ion_probe_radii 0.90 _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.780 _refine.overall_SU_ML 0.031 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 698 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 78 _refine_hist.number_atoms_total 783 _refine_hist.d_res_high 1.54 _refine_hist.d_res_low 46.03 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.014 731 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 650 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.511 1.651 989 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.096 1.639 1526 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.696 5.000 93 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.370 21.111 45 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.653 15.000 124 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.934 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.086 0.200 97 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 839 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 125 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.758 1.766 366 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.741 1.760 365 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.390 2.640 455 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.391 2.645 456 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.916 2.342 365 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.871 2.343 365 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.412 3.307 533 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 4.103 22.608 802 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 4.102 22.636 803 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 2.414 3.000 1381 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 29.509 5.000 55 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 12.912 5.000 1395 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.540 _refine_ls_shell.d_res_low 1.580 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 67 _refine_ls_shell.number_reflns_R_work 1072 _refine_ls_shell.percent_reflns_obs 99.30 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.159 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.107 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6H5K _struct.title 'MamM CTD D249E - Zinc form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6H5K _struct_keywords.text 'Cation diffusion facilitator, magnetotactic bacteria, METAL TRANSPORT' _struct_keywords.pdbx_keywords 'METAL TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6NE57_9PROT _struct_ref.pdbx_db_accession Q6NE57 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EAVQNRIVEAAERVPGVRGVIHLRARYVGQDIWADMIIGVDPENTVEQAHEICEAVQAAVCGKIRRIESLHVSAEAREIG DTTKPSFSDQPLSFDEVMLSKVDN ; _struct_ref.pdbx_align_begin 215 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6H5K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6NE57 _struct_ref_seq.db_align_beg 215 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 318 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 215 _struct_ref_seq.pdbx_auth_seq_align_end 318 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6H5K GLY A 1 ? UNP Q6NE57 ? ? 'expression tag' 211 1 1 6H5K SER A 2 ? UNP Q6NE57 ? ? 'expression tag' 212 2 1 6H5K HIS A 3 ? UNP Q6NE57 ? ? 'expression tag' 213 3 1 6H5K MET A 4 ? UNP Q6NE57 ? ? 'expression tag' 214 4 1 6H5K GLU A 39 ? UNP Q6NE57 ASP 249 'engineered mutation' 249 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2420 ? 1 MORE -185 ? 1 'SSA (A^2)' 10130 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_554 x-y,-y,-z-1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -21.2873333333 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? ARG A 17 ? GLY A 211 ARG A 227 1 ? 17 HELX_P HELX_P2 AA2 THR A 49 ? ILE A 68 ? THR A 259 ILE A 278 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 65 SG ? ? ? 1_555 E BME . S2 ? ? A CYS 275 A BME 404 1_555 ? ? ? ? ? ? ? 1.964 ? ? metalc1 metalc ? ? A GLY 1 N ? ? ? 1_555 C ZN . ZN ? ? A GLY 211 A ZN 402 2_455 ? ? ? ? ? ? ? 2.155 ? ? metalc2 metalc ? ? A SER 2 N ? ? ? 1_555 C ZN . ZN ? ? A SER 212 A ZN 402 2_455 ? ? ? ? ? ? ? 2.026 ? ? metalc3 metalc ? ? A SER 2 OG ? ? ? 1_555 C ZN . ZN ? ? A SER 212 A ZN 402 2_455 ? ? ? ? ? ? ? 2.381 ? ? metalc4 metalc ? ? A HIS 3 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 213 A ZN 401 4_455 ? ? ? ? ? ? ? 2.009 ? ? metalc5 metalc ? ? A HIS 26 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 236 A ZN 401 1_555 ? ? ? ? ? ? ? 2.042 ? ? metalc6 metalc ? ? A HIS 54 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 264 A ZN 402 1_555 ? ? ? ? ? ? ? 1.992 ? ? metalc7 metalc ? ? A HIS 54 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 264 A ZN 403 1_555 ? ? ? ? ? ? ? 2.068 ? ? metalc8 metalc ? ? A CYS 57 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 267 A ZN 403 1_555 ? ? ? ? ? ? ? 2.399 ? ? metalc9 metalc ? ? A GLU 58 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 268 A ZN 402 1_555 ? ? ? ? ? ? ? 2.056 ? ? metalc10 metalc ? ? A HIS 75 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 285 A ZN 401 5_554 ? ? ? ? ? ? ? 2.031 ? ? metalc11 metalc ? ? A GLU 79 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 289 A ZN 401 1_555 ? ? ? ? ? ? ? 1.975 ? ? metalc12 metalc ? ? C ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 402 A HOH 501 3_444 ? ? ? ? ? ? ? 2.135 ? ? metalc13 metalc ? ? D ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 403 A HOH 511 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc14 metalc ? ? D ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 403 A HOH 556 1_555 ? ? ? ? ? ? ? 2.220 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N ? A GLY 1 ? A GLY 211 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 N ? A SER 2 ? A SER 212 ? 1_555 82.1 ? 2 N ? A GLY 1 ? A GLY 211 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 OG ? A SER 2 ? A SER 212 ? 1_555 158.3 ? 3 N ? A SER 2 ? A SER 212 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 OG ? A SER 2 ? A SER 212 ? 1_555 76.4 ? 4 N ? A GLY 1 ? A GLY 211 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 NE2 ? A HIS 54 ? A HIS 264 ? 1_555 72.1 ? 5 N ? A SER 2 ? A SER 212 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 NE2 ? A HIS 54 ? A HIS 264 ? 1_555 14.2 ? 6 OG ? A SER 2 ? A SER 212 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 NE2 ? A HIS 54 ? A HIS 264 ? 1_555 86.3 ? 7 N ? A GLY 1 ? A GLY 211 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 OE2 ? A GLU 58 ? A GLU 268 ? 1_555 76.2 ? 8 N ? A SER 2 ? A SER 212 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 OE2 ? A GLU 58 ? A GLU 268 ? 1_555 9.2 ? 9 OG ? A SER 2 ? A SER 212 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 OE2 ? A GLU 58 ? A GLU 268 ? 1_555 82.2 ? 10 NE2 ? A HIS 54 ? A HIS 264 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 OE2 ? A GLU 58 ? A GLU 268 ? 1_555 5.2 ? 11 N ? A GLY 1 ? A GLY 211 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 O ? F HOH . ? A HOH 501 ? 3_444 69.5 ? 12 N ? A SER 2 ? A SER 212 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 O ? F HOH . ? A HOH 501 ? 3_444 14.4 ? 13 OG ? A SER 2 ? A SER 212 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 O ? F HOH . ? A HOH 501 ? 3_444 88.8 ? 14 NE2 ? A HIS 54 ? A HIS 264 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 O ? F HOH . ? A HOH 501 ? 3_444 3.8 ? 15 OE2 ? A GLU 58 ? A GLU 268 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 2_455 O ? F HOH . ? A HOH 501 ? 3_444 6.7 ? 16 NE2 ? A HIS 3 ? A HIS 213 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 4_455 NE2 ? A HIS 26 ? A HIS 236 ? 1_555 10.1 ? 17 NE2 ? A HIS 3 ? A HIS 213 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 4_455 NE2 ? A HIS 75 ? A HIS 285 ? 1_555 33.3 ? 18 NE2 ? A HIS 26 ? A HIS 236 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 4_455 NE2 ? A HIS 75 ? A HIS 285 ? 1_555 25.9 ? 19 NE2 ? A HIS 3 ? A HIS 213 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 4_455 OE1 ? A GLU 79 ? A GLU 289 ? 1_555 14.2 ? 20 NE2 ? A HIS 26 ? A HIS 236 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 4_455 OE1 ? A GLU 79 ? A GLU 289 ? 1_555 4.1 ? 21 NE2 ? A HIS 75 ? A HIS 285 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 4_455 OE1 ? A GLU 79 ? A GLU 289 ? 1_555 22.8 ? 22 ND1 ? A HIS 54 ? A HIS 264 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 SG ? A CYS 57 ? A CYS 267 ? 1_555 120.6 ? 23 ND1 ? A HIS 54 ? A HIS 264 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 98.7 ? 24 SG ? A CYS 57 ? A CYS 267 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 107.2 ? 25 ND1 ? A HIS 54 ? A HIS 264 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 O ? F HOH . ? A HOH 556 ? 1_555 101.9 ? 26 SG ? A CYS 57 ? A CYS 267 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 O ? F HOH . ? A HOH 556 ? 1_555 120.4 ? 27 O ? F HOH . ? A HOH 511 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 O ? F HOH . ? A HOH 556 ? 1_555 105.1 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 24 ? VAL A 32 ? VAL A 234 VAL A 242 AA1 2 ASP A 35 ? VAL A 44 ? ASP A 245 VAL A 254 AA1 3 ILE A 71 ? ALA A 80 ? ILE A 281 ALA A 290 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 32 ? N VAL A 242 O ASP A 35 ? O ASP A 245 AA1 2 3 N MET A 40 ? N MET A 250 O HIS A 75 ? O HIS A 285 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 401 ? 4 'binding site for residue ZN A 401' AC2 Software A ZN 402 ? 5 'binding site for residue ZN A 402' AC3 Software A ZN 403 ? 4 'binding site for residue ZN A 403' AC4 Software A BME 404 ? 7 'binding site for residue BME A 404' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 3 ? HIS A 213 . ? 4_565 ? 2 AC1 4 HIS A 26 ? HIS A 236 . ? 1_555 ? 3 AC1 4 HIS A 75 ? HIS A 285 . ? 5_554 ? 4 AC1 4 GLU A 79 ? GLU A 289 . ? 1_555 ? 5 AC2 5 GLY A 1 ? GLY A 211 . ? 3_444 ? 6 AC2 5 SER A 2 ? SER A 212 . ? 3_444 ? 7 AC2 5 HIS A 54 ? HIS A 264 . ? 1_555 ? 8 AC2 5 GLU A 58 ? GLU A 268 . ? 1_555 ? 9 AC2 5 HOH F . ? HOH A 501 . ? 3_444 ? 10 AC3 4 HIS A 54 ? HIS A 264 . ? 1_555 ? 11 AC3 4 CYS A 57 ? CYS A 267 . ? 1_555 ? 12 AC3 4 HOH F . ? HOH A 511 . ? 1_555 ? 13 AC3 4 HOH F . ? HOH A 556 . ? 1_555 ? 14 AC4 7 GLN A 61 ? GLN A 271 . ? 1_555 ? 15 AC4 7 CYS A 65 ? CYS A 275 . ? 1_555 ? 16 AC4 7 ILE A 71 ? ILE A 281 . ? 1_555 ? 17 AC4 7 GLU A 72 ? GLU A 282 . ? 1_555 ? 18 AC4 7 SER A 73 ? SER A 283 . ? 1_555 ? 19 AC4 7 LEU A 74 ? LEU A 284 . ? 1_555 ? 20 AC4 7 HOH F . ? HOH A 536 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 567 ? ? O A HOH 569 ? ? 2.02 2 1 N A GLY 211 ? ? O A HOH 501 ? ? 2.02 3 1 O A HOH 533 ? ? O A HOH 568 ? ? 2.08 4 1 O A HOH 501 ? ? O A HOH 504 ? ? 2.10 5 1 NH1 A ARG 240 ? ? O A HOH 502 ? ? 2.11 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 508 ? ? 1_555 O A HOH 508 ? ? 4_555 1.19 2 1 O A HOH 576 ? ? 1_555 O A HOH 576 ? ? 5_554 1.99 3 1 O A HOH 513 ? ? 1_555 O A HOH 556 ? ? 5_554 2.16 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 232 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -113.93 _pdbx_validate_torsion.psi 67.83 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 545 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 578 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.34 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 293 ? A ILE 83 2 1 Y 1 A ASP 303 ? A ASP 93 3 1 Y 1 A GLN 304 ? A GLN 94 4 1 Y 1 A PRO 305 ? A PRO 95 5 1 Y 1 A LEU 306 ? A LEU 96 6 1 Y 1 A SER 307 ? A SER 97 7 1 Y 1 A PHE 308 ? A PHE 98 8 1 Y 1 A ASP 309 ? A ASP 99 9 1 Y 1 A GLU 310 ? A GLU 100 10 1 Y 1 A VAL 311 ? A VAL 101 11 1 Y 1 A MET 312 ? A MET 102 12 1 Y 1 A LEU 313 ? A LEU 103 13 1 Y 1 A SER 314 ? A SER 104 14 1 Y 1 A LYS 315 ? A LYS 105 15 1 Y 1 A VAL 316 ? A VAL 106 16 1 Y 1 A ASP 317 ? A ASP 107 17 1 Y 1 A ASN 318 ? A ASN 108 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BME C1 C N N 74 BME C2 C N N 75 BME O1 O N N 76 BME S2 S N N 77 BME H11 H N N 78 BME H12 H N N 79 BME H21 H N N 80 BME H22 H N N 81 BME HO1 H N N 82 BME HS2 H N N 83 CYS N N N N 84 CYS CA C N R 85 CYS C C N N 86 CYS O O N N 87 CYS CB C N N 88 CYS SG S N N 89 CYS OXT O N N 90 CYS H H N N 91 CYS H2 H N N 92 CYS HA H N N 93 CYS HB2 H N N 94 CYS HB3 H N N 95 CYS HG H N N 96 CYS HXT H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TRP N N N N 331 TRP CA C N S 332 TRP C C N N 333 TRP O O N N 334 TRP CB C N N 335 TRP CG C Y N 336 TRP CD1 C Y N 337 TRP CD2 C Y N 338 TRP NE1 N Y N 339 TRP CE2 C Y N 340 TRP CE3 C Y N 341 TRP CZ2 C Y N 342 TRP CZ3 C Y N 343 TRP CH2 C Y N 344 TRP OXT O N N 345 TRP H H N N 346 TRP H2 H N N 347 TRP HA H N N 348 TRP HB2 H N N 349 TRP HB3 H N N 350 TRP HD1 H N N 351 TRP HE1 H N N 352 TRP HE3 H N N 353 TRP HZ2 H N N 354 TRP HZ3 H N N 355 TRP HH2 H N N 356 TRP HXT H N N 357 TYR N N N N 358 TYR CA C N S 359 TYR C C N N 360 TYR O O N N 361 TYR CB C N N 362 TYR CG C Y N 363 TYR CD1 C Y N 364 TYR CD2 C Y N 365 TYR CE1 C Y N 366 TYR CE2 C Y N 367 TYR CZ C Y N 368 TYR OH O N N 369 TYR OXT O N N 370 TYR H H N N 371 TYR H2 H N N 372 TYR HA H N N 373 TYR HB2 H N N 374 TYR HB3 H N N 375 TYR HD1 H N N 376 TYR HD2 H N N 377 TYR HE1 H N N 378 TYR HE2 H N N 379 TYR HH H N N 380 TYR HXT H N N 381 VAL N N N N 382 VAL CA C N S 383 VAL C C N N 384 VAL O O N N 385 VAL CB C N N 386 VAL CG1 C N N 387 VAL CG2 C N N 388 VAL OXT O N N 389 VAL H H N N 390 VAL H2 H N N 391 VAL HA H N N 392 VAL HB H N N 393 VAL HG11 H N N 394 VAL HG12 H N N 395 VAL HG13 H N N 396 VAL HG21 H N N 397 VAL HG22 H N N 398 VAL HG23 H N N 399 VAL HXT H N N 400 ZN ZN ZN N N 401 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BME C1 C2 sing N N 70 BME C1 O1 sing N N 71 BME C1 H11 sing N N 72 BME C1 H12 sing N N 73 BME C2 S2 sing N N 74 BME C2 H21 sing N N 75 BME C2 H22 sing N N 76 BME O1 HO1 sing N N 77 BME S2 HS2 sing N N 78 CYS N CA sing N N 79 CYS N H sing N N 80 CYS N H2 sing N N 81 CYS CA C sing N N 82 CYS CA CB sing N N 83 CYS CA HA sing N N 84 CYS C O doub N N 85 CYS C OXT sing N N 86 CYS CB SG sing N N 87 CYS CB HB2 sing N N 88 CYS CB HB3 sing N N 89 CYS SG HG sing N N 90 CYS OXT HXT sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal ? Israel 'Israel Science Foundation 167/16' 1 ? Israel 'Israel Ministry of Science, Technology and Space' 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3W5X _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6H5K _atom_sites.fract_transf_matrix[1][1] 0.018814 _atom_sites.fract_transf_matrix[1][2] 0.010862 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021725 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015659 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_