data_6IB7 # _entry.id 6IB7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6IB7 pdb_00006ib7 10.2210/pdb6ib7/pdb WWPDB D_1200013147 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-04-17 2 'Structure model' 1 1 2020-04-29 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_citation_author.identifier_ORCID' 14 3 'Structure model' '_database_2.pdbx_DOI' 15 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6IB7 _pdbx_database_status.recvd_initial_deposition_date 2018-11-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Huang, Y.H.' 1 ? 'Loll, B.' 2 ? 'Wahl, M.C.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 47 _citation.language ? _citation.page_first 6488 _citation.page_last 6503 _citation.title 'Structural basis for the function of SuhB as a transcription factor in ribosomal RNA synthesis.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkz290 _citation.pdbx_database_id_PubMed 31020314 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, Y.H.' 1 ? primary 'Said, N.' 2 ? primary 'Loll, B.' 3 ? primary 'Wahl, M.C.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Inositol-1-monophosphatase 29537.502 1 3.1.3.25 ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 4 water nat water 18.015 30 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Inositol-1-phosphatase # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMAMHPMLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYPQHTIITEESGELEGTD QDVQWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATG FPFKAKQYATTYINIVGKLFNECADFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVREAGGIVSDFTGGHNY MLTGNIVAGNPRVVKAMLANMRDELSDALKR ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMAMHPMLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYPQHTIITEESGELEGTD QDVQWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATG FPFKAKQYATTYINIVGKLFNECADFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVREAGGIVSDFTGGHNY MLTGNIVAGNPRVVKAMLANMRDELSDALKR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 GLYCEROL GOL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ALA n 1 5 MET n 1 6 HIS n 1 7 PRO n 1 8 MET n 1 9 LEU n 1 10 ASN n 1 11 ILE n 1 12 ALA n 1 13 VAL n 1 14 ARG n 1 15 ALA n 1 16 ALA n 1 17 ARG n 1 18 LYS n 1 19 ALA n 1 20 GLY n 1 21 ASN n 1 22 LEU n 1 23 ILE n 1 24 ALA n 1 25 LYS n 1 26 ASN n 1 27 TYR n 1 28 GLU n 1 29 THR n 1 30 PRO n 1 31 ASP n 1 32 ALA n 1 33 VAL n 1 34 GLU n 1 35 ALA n 1 36 SER n 1 37 GLN n 1 38 LYS n 1 39 GLY n 1 40 SER n 1 41 ASN n 1 42 ASP n 1 43 PHE n 1 44 VAL n 1 45 THR n 1 46 ASN n 1 47 VAL n 1 48 ASP n 1 49 LYS n 1 50 ALA n 1 51 ALA n 1 52 GLU n 1 53 ALA n 1 54 VAL n 1 55 ILE n 1 56 ILE n 1 57 ASP n 1 58 THR n 1 59 ILE n 1 60 ARG n 1 61 LYS n 1 62 SER n 1 63 TYR n 1 64 PRO n 1 65 GLN n 1 66 HIS n 1 67 THR n 1 68 ILE n 1 69 ILE n 1 70 THR n 1 71 GLU n 1 72 GLU n 1 73 SER n 1 74 GLY n 1 75 GLU n 1 76 LEU n 1 77 GLU n 1 78 GLY n 1 79 THR n 1 80 ASP n 1 81 GLN n 1 82 ASP n 1 83 VAL n 1 84 GLN n 1 85 TRP n 1 86 VAL n 1 87 ILE n 1 88 ASP n 1 89 PRO n 1 90 LEU n 1 91 ASP n 1 92 GLY n 1 93 THR n 1 94 THR n 1 95 ASN n 1 96 PHE n 1 97 ILE n 1 98 LYS n 1 99 ARG n 1 100 LEU n 1 101 PRO n 1 102 HIS n 1 103 PHE n 1 104 ALA n 1 105 VAL n 1 106 SER n 1 107 ILE n 1 108 ALA n 1 109 VAL n 1 110 ARG n 1 111 ILE n 1 112 LYS n 1 113 GLY n 1 114 ARG n 1 115 THR n 1 116 GLU n 1 117 VAL n 1 118 ALA n 1 119 VAL n 1 120 VAL n 1 121 TYR n 1 122 ASP n 1 123 PRO n 1 124 MET n 1 125 ARG n 1 126 ASN n 1 127 GLU n 1 128 LEU n 1 129 PHE n 1 130 THR n 1 131 ALA n 1 132 THR n 1 133 ARG n 1 134 GLY n 1 135 GLN n 1 136 GLY n 1 137 ALA n 1 138 GLN n 1 139 LEU n 1 140 ASN n 1 141 GLY n 1 142 TYR n 1 143 ARG n 1 144 LEU n 1 145 ARG n 1 146 GLY n 1 147 SER n 1 148 THR n 1 149 ALA n 1 150 ARG n 1 151 ASP n 1 152 LEU n 1 153 ASP n 1 154 GLY n 1 155 THR n 1 156 ILE n 1 157 LEU n 1 158 ALA n 1 159 THR n 1 160 GLY n 1 161 PHE n 1 162 PRO n 1 163 PHE n 1 164 LYS n 1 165 ALA n 1 166 LYS n 1 167 GLN n 1 168 TYR n 1 169 ALA n 1 170 THR n 1 171 THR n 1 172 TYR n 1 173 ILE n 1 174 ASN n 1 175 ILE n 1 176 VAL n 1 177 GLY n 1 178 LYS n 1 179 LEU n 1 180 PHE n 1 181 ASN n 1 182 GLU n 1 183 CYS n 1 184 ALA n 1 185 ASP n 1 186 PHE n 1 187 ARG n 1 188 ARG n 1 189 THR n 1 190 GLY n 1 191 SER n 1 192 ALA n 1 193 ALA n 1 194 LEU n 1 195 ASP n 1 196 LEU n 1 197 ALA n 1 198 TYR n 1 199 VAL n 1 200 ALA n 1 201 ALA n 1 202 GLY n 1 203 ARG n 1 204 VAL n 1 205 ASP n 1 206 GLY n 1 207 PHE n 1 208 PHE n 1 209 GLU n 1 210 ILE n 1 211 GLY n 1 212 LEU n 1 213 ARG n 1 214 PRO n 1 215 TRP n 1 216 ASP n 1 217 PHE n 1 218 ALA n 1 219 ALA n 1 220 GLY n 1 221 GLU n 1 222 LEU n 1 223 LEU n 1 224 VAL n 1 225 ARG n 1 226 GLU n 1 227 ALA n 1 228 GLY n 1 229 GLY n 1 230 ILE n 1 231 VAL n 1 232 SER n 1 233 ASP n 1 234 PHE n 1 235 THR n 1 236 GLY n 1 237 GLY n 1 238 HIS n 1 239 ASN n 1 240 TYR n 1 241 MET n 1 242 LEU n 1 243 THR n 1 244 GLY n 1 245 ASN n 1 246 ILE n 1 247 VAL n 1 248 ALA n 1 249 GLY n 1 250 ASN n 1 251 PRO n 1 252 ARG n 1 253 VAL n 1 254 VAL n 1 255 LYS n 1 256 ALA n 1 257 MET n 1 258 LEU n 1 259 ALA n 1 260 ASN n 1 261 MET n 1 262 ARG n 1 263 ASP n 1 264 GLU n 1 265 LEU n 1 266 SER n 1 267 ASP n 1 268 ALA n 1 269 LEU n 1 270 LYS n 1 271 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 271 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'suhB, ssyA, b2533, JW2517' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 ? ? ? A . n A 1 2 ALA 2 -2 ? ? ? A . n A 1 3 MET 3 -1 ? ? ? A . n A 1 4 ALA 4 0 ? ? ? A . n A 1 5 MET 5 1 ? ? ? A . n A 1 6 HIS 6 2 2 HIS HIS A . n A 1 7 PRO 7 3 3 PRO PRO A . n A 1 8 MET 8 4 4 MET MET A . n A 1 9 LEU 9 5 5 LEU LEU A . n A 1 10 ASN 10 6 6 ASN ASN A . n A 1 11 ILE 11 7 7 ILE ILE A . n A 1 12 ALA 12 8 8 ALA ALA A . n A 1 13 VAL 13 9 9 VAL VAL A . n A 1 14 ARG 14 10 10 ARG ARG A . n A 1 15 ALA 15 11 11 ALA ALA A . n A 1 16 ALA 16 12 12 ALA ALA A . n A 1 17 ARG 17 13 13 ARG ARG A . n A 1 18 LYS 18 14 14 LYS LYS A . n A 1 19 ALA 19 15 15 ALA ALA A . n A 1 20 GLY 20 16 16 GLY GLY A . n A 1 21 ASN 21 17 17 ASN ASN A . n A 1 22 LEU 22 18 18 LEU LEU A . n A 1 23 ILE 23 19 19 ILE ILE A . n A 1 24 ALA 24 20 20 ALA ALA A . n A 1 25 LYS 25 21 21 LYS LYS A . n A 1 26 ASN 26 22 22 ASN ASN A . n A 1 27 TYR 27 23 23 TYR TYR A . n A 1 28 GLU 28 24 24 GLU GLU A . n A 1 29 THR 29 25 25 THR THR A . n A 1 30 PRO 30 26 26 PRO PRO A . n A 1 31 ASP 31 27 27 ASP ASP A . n A 1 32 ALA 32 28 28 ALA ALA A . n A 1 33 VAL 33 29 29 VAL VAL A . n A 1 34 GLU 34 30 30 GLU GLU A . n A 1 35 ALA 35 31 31 ALA ALA A . n A 1 36 SER 36 32 32 SER SER A . n A 1 37 GLN 37 33 33 GLN GLN A . n A 1 38 LYS 38 34 34 LYS LYS A . n A 1 39 GLY 39 35 35 GLY GLY A . n A 1 40 SER 40 36 36 SER SER A . n A 1 41 ASN 41 37 37 ASN ASN A . n A 1 42 ASP 42 38 38 ASP ASP A . n A 1 43 PHE 43 39 39 PHE PHE A . n A 1 44 VAL 44 40 40 VAL VAL A . n A 1 45 THR 45 41 41 THR THR A . n A 1 46 ASN 46 42 42 ASN ASN A . n A 1 47 VAL 47 43 43 VAL VAL A . n A 1 48 ASP 48 44 44 ASP ASP A . n A 1 49 LYS 49 45 45 LYS LYS A . n A 1 50 ALA 50 46 46 ALA ALA A . n A 1 51 ALA 51 47 47 ALA ALA A . n A 1 52 GLU 52 48 48 GLU GLU A . n A 1 53 ALA 53 49 49 ALA ALA A . n A 1 54 VAL 54 50 50 VAL VAL A . n A 1 55 ILE 55 51 51 ILE ILE A . n A 1 56 ILE 56 52 52 ILE ILE A . n A 1 57 ASP 57 53 53 ASP ASP A . n A 1 58 THR 58 54 54 THR THR A . n A 1 59 ILE 59 55 55 ILE ILE A . n A 1 60 ARG 60 56 56 ARG ARG A . n A 1 61 LYS 61 57 57 LYS LYS A . n A 1 62 SER 62 58 58 SER SER A . n A 1 63 TYR 63 59 59 TYR TYR A . n A 1 64 PRO 64 60 60 PRO PRO A . n A 1 65 GLN 65 61 61 GLN GLN A . n A 1 66 HIS 66 62 62 HIS HIS A . n A 1 67 THR 67 63 63 THR THR A . n A 1 68 ILE 68 64 64 ILE ILE A . n A 1 69 ILE 69 65 65 ILE ILE A . n A 1 70 THR 70 66 66 THR THR A . n A 1 71 GLU 71 67 67 GLU GLU A . n A 1 72 GLU 72 68 68 GLU GLU A . n A 1 73 SER 73 69 69 SER SER A . n A 1 74 GLY 74 70 70 GLY GLY A . n A 1 75 GLU 75 71 71 GLU GLU A . n A 1 76 LEU 76 72 72 LEU LEU A . n A 1 77 GLU 77 73 73 GLU GLU A . n A 1 78 GLY 78 74 74 GLY GLY A . n A 1 79 THR 79 75 75 THR THR A . n A 1 80 ASP 80 76 76 ASP ASP A . n A 1 81 GLN 81 77 77 GLN GLN A . n A 1 82 ASP 82 78 78 ASP ASP A . n A 1 83 VAL 83 79 79 VAL VAL A . n A 1 84 GLN 84 80 80 GLN GLN A . n A 1 85 TRP 85 81 81 TRP TRP A . n A 1 86 VAL 86 82 82 VAL VAL A . n A 1 87 ILE 87 83 83 ILE ILE A . n A 1 88 ASP 88 84 84 ASP ASP A . n A 1 89 PRO 89 85 85 PRO PRO A . n A 1 90 LEU 90 86 86 LEU LEU A . n A 1 91 ASP 91 87 87 ASP ASP A . n A 1 92 GLY 92 88 88 GLY GLY A . n A 1 93 THR 93 89 89 THR THR A . n A 1 94 THR 94 90 90 THR THR A . n A 1 95 ASN 95 91 91 ASN ASN A . n A 1 96 PHE 96 92 92 PHE PHE A . n A 1 97 ILE 97 93 93 ILE ILE A . n A 1 98 LYS 98 94 94 LYS LYS A . n A 1 99 ARG 99 95 95 ARG ARG A . n A 1 100 LEU 100 96 96 LEU LEU A . n A 1 101 PRO 101 97 97 PRO PRO A . n A 1 102 HIS 102 98 98 HIS HIS A . n A 1 103 PHE 103 99 99 PHE PHE A . n A 1 104 ALA 104 100 100 ALA ALA A . n A 1 105 VAL 105 101 101 VAL VAL A . n A 1 106 SER 106 102 102 SER SER A . n A 1 107 ILE 107 103 103 ILE ILE A . n A 1 108 ALA 108 104 104 ALA ALA A . n A 1 109 VAL 109 105 105 VAL VAL A . n A 1 110 ARG 110 106 106 ARG ARG A . n A 1 111 ILE 111 107 107 ILE ILE A . n A 1 112 LYS 112 108 108 LYS LYS A . n A 1 113 GLY 113 109 109 GLY GLY A . n A 1 114 ARG 114 110 110 ARG ARG A . n A 1 115 THR 115 111 111 THR THR A . n A 1 116 GLU 116 112 112 GLU GLU A . n A 1 117 VAL 117 113 113 VAL VAL A . n A 1 118 ALA 118 114 114 ALA ALA A . n A 1 119 VAL 119 115 115 VAL VAL A . n A 1 120 VAL 120 116 116 VAL VAL A . n A 1 121 TYR 121 117 117 TYR TYR A . n A 1 122 ASP 122 118 118 ASP ASP A . n A 1 123 PRO 123 119 119 PRO PRO A . n A 1 124 MET 124 120 120 MET MET A . n A 1 125 ARG 125 121 121 ARG ARG A . n A 1 126 ASN 126 122 122 ASN ASN A . n A 1 127 GLU 127 123 123 GLU GLU A . n A 1 128 LEU 128 124 124 LEU LEU A . n A 1 129 PHE 129 125 125 PHE PHE A . n A 1 130 THR 130 126 126 THR THR A . n A 1 131 ALA 131 127 127 ALA ALA A . n A 1 132 THR 132 128 128 THR THR A . n A 1 133 ARG 133 129 129 ARG ARG A . n A 1 134 GLY 134 130 130 GLY GLY A . n A 1 135 GLN 135 131 131 GLN GLN A . n A 1 136 GLY 136 132 132 GLY GLY A . n A 1 137 ALA 137 133 133 ALA ALA A . n A 1 138 GLN 138 134 134 GLN GLN A . n A 1 139 LEU 139 135 135 LEU LEU A . n A 1 140 ASN 140 136 136 ASN ASN A . n A 1 141 GLY 141 137 137 GLY GLY A . n A 1 142 TYR 142 138 138 TYR TYR A . n A 1 143 ARG 143 139 139 ARG ARG A . n A 1 144 LEU 144 140 140 LEU LEU A . n A 1 145 ARG 145 141 141 ARG ARG A . n A 1 146 GLY 146 142 142 GLY GLY A . n A 1 147 SER 147 143 143 SER SER A . n A 1 148 THR 148 144 144 THR THR A . n A 1 149 ALA 149 145 145 ALA ALA A . n A 1 150 ARG 150 146 146 ARG ARG A . n A 1 151 ASP 151 147 147 ASP ASP A . n A 1 152 LEU 152 148 148 LEU LEU A . n A 1 153 ASP 153 149 149 ASP ASP A . n A 1 154 GLY 154 150 150 GLY GLY A . n A 1 155 THR 155 151 151 THR THR A . n A 1 156 ILE 156 152 152 ILE ILE A . n A 1 157 LEU 157 153 153 LEU LEU A . n A 1 158 ALA 158 154 154 ALA ALA A . n A 1 159 THR 159 155 155 THR THR A . n A 1 160 GLY 160 156 156 GLY GLY A . n A 1 161 PHE 161 157 157 PHE PHE A . n A 1 162 PRO 162 158 158 PRO PRO A . n A 1 163 PHE 163 159 159 PHE PHE A . n A 1 164 LYS 164 160 160 LYS LYS A . n A 1 165 ALA 165 161 161 ALA ALA A . n A 1 166 LYS 166 162 162 LYS LYS A . n A 1 167 GLN 167 163 163 GLN GLN A . n A 1 168 TYR 168 164 164 TYR TYR A . n A 1 169 ALA 169 165 165 ALA ALA A . n A 1 170 THR 170 166 166 THR THR A . n A 1 171 THR 171 167 167 THR THR A . n A 1 172 TYR 172 168 168 TYR TYR A . n A 1 173 ILE 173 169 169 ILE ILE A . n A 1 174 ASN 174 170 170 ASN ASN A . n A 1 175 ILE 175 171 171 ILE ILE A . n A 1 176 VAL 176 172 172 VAL VAL A . n A 1 177 GLY 177 173 173 GLY GLY A . n A 1 178 LYS 178 174 174 LYS LYS A . n A 1 179 LEU 179 175 175 LEU LEU A . n A 1 180 PHE 180 176 176 PHE PHE A . n A 1 181 ASN 181 177 177 ASN ASN A . n A 1 182 GLU 182 178 178 GLU GLU A . n A 1 183 CYS 183 179 179 CYS CYS A . n A 1 184 ALA 184 180 180 ALA ALA A . n A 1 185 ASP 185 181 181 ASP ASP A . n A 1 186 PHE 186 182 182 PHE PHE A . n A 1 187 ARG 187 183 183 ARG ARG A . n A 1 188 ARG 188 184 184 ARG ARG A . n A 1 189 THR 189 185 185 THR THR A . n A 1 190 GLY 190 186 186 GLY GLY A . n A 1 191 SER 191 187 187 SER SER A . n A 1 192 ALA 192 188 188 ALA ALA A . n A 1 193 ALA 193 189 189 ALA ALA A . n A 1 194 LEU 194 190 190 LEU LEU A . n A 1 195 ASP 195 191 191 ASP ASP A . n A 1 196 LEU 196 192 192 LEU LEU A . n A 1 197 ALA 197 193 193 ALA ALA A . n A 1 198 TYR 198 194 194 TYR TYR A . n A 1 199 VAL 199 195 195 VAL VAL A . n A 1 200 ALA 200 196 196 ALA ALA A . n A 1 201 ALA 201 197 197 ALA ALA A . n A 1 202 GLY 202 198 198 GLY GLY A . n A 1 203 ARG 203 199 199 ARG ARG A . n A 1 204 VAL 204 200 200 VAL VAL A . n A 1 205 ASP 205 201 201 ASP ASP A . n A 1 206 GLY 206 202 202 GLY GLY A . n A 1 207 PHE 207 203 203 PHE PHE A . n A 1 208 PHE 208 204 204 PHE PHE A . n A 1 209 GLU 209 205 205 GLU GLU A . n A 1 210 ILE 210 206 206 ILE ILE A . n A 1 211 GLY 211 207 207 GLY GLY A . n A 1 212 LEU 212 208 208 LEU LEU A . n A 1 213 ARG 213 209 209 ARG ARG A . n A 1 214 PRO 214 210 210 PRO PRO A . n A 1 215 TRP 215 211 211 TRP TRP A . n A 1 216 ASP 216 212 212 ASP ASP A . n A 1 217 PHE 217 213 213 PHE PHE A . n A 1 218 ALA 218 214 214 ALA ALA A . n A 1 219 ALA 219 215 215 ALA ALA A . n A 1 220 GLY 220 216 216 GLY GLY A . n A 1 221 GLU 221 217 217 GLU GLU A . n A 1 222 LEU 222 218 218 LEU LEU A . n A 1 223 LEU 223 219 219 LEU LEU A . n A 1 224 VAL 224 220 220 VAL VAL A . n A 1 225 ARG 225 221 221 ARG ARG A . n A 1 226 GLU 226 222 222 GLU GLU A . n A 1 227 ALA 227 223 223 ALA ALA A . n A 1 228 GLY 228 224 224 GLY GLY A . n A 1 229 GLY 229 225 225 GLY GLY A . n A 1 230 ILE 230 226 226 ILE ILE A . n A 1 231 VAL 231 227 227 VAL VAL A . n A 1 232 SER 232 228 228 SER SER A . n A 1 233 ASP 233 229 229 ASP ASP A . n A 1 234 PHE 234 230 230 PHE PHE A . n A 1 235 THR 235 231 231 THR THR A . n A 1 236 GLY 236 232 232 GLY GLY A . n A 1 237 GLY 237 233 233 GLY GLY A . n A 1 238 HIS 238 234 234 HIS HIS A . n A 1 239 ASN 239 235 235 ASN ASN A . n A 1 240 TYR 240 236 236 TYR TYR A . n A 1 241 MET 241 237 237 MET MET A . n A 1 242 LEU 242 238 238 LEU LEU A . n A 1 243 THR 243 239 239 THR THR A . n A 1 244 GLY 244 240 240 GLY GLY A . n A 1 245 ASN 245 241 241 ASN ASN A . n A 1 246 ILE 246 242 242 ILE ILE A . n A 1 247 VAL 247 243 243 VAL VAL A . n A 1 248 ALA 248 244 244 ALA ALA A . n A 1 249 GLY 249 245 245 GLY GLY A . n A 1 250 ASN 250 246 246 ASN ASN A . n A 1 251 PRO 251 247 247 PRO PRO A . n A 1 252 ARG 252 248 248 ARG ARG A . n A 1 253 VAL 253 249 249 VAL VAL A . n A 1 254 VAL 254 250 250 VAL VAL A . n A 1 255 LYS 255 251 251 LYS LYS A . n A 1 256 ALA 256 252 252 ALA ALA A . n A 1 257 MET 257 253 253 MET MET A . n A 1 258 LEU 258 254 254 LEU LEU A . n A 1 259 ALA 259 255 255 ALA ALA A . n A 1 260 ASN 260 256 256 ASN ASN A . n A 1 261 MET 261 257 257 MET MET A . n A 1 262 ARG 262 258 258 ARG ARG A . n A 1 263 ASP 263 259 ? ? ? A . n A 1 264 GLU 264 260 ? ? ? A . n A 1 265 LEU 265 261 ? ? ? A . n A 1 266 SER 266 262 ? ? ? A . n A 1 267 ASP 267 263 ? ? ? A . n A 1 268 ALA 268 264 ? ? ? A . n A 1 269 LEU 269 265 ? ? ? A . n A 1 270 LYS 270 266 ? ? ? A . n A 1 271 ARG 271 267 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 301 1 MG MG A . C 3 GOL 1 302 401 GOL GOL A . D 3 GOL 1 303 501 GOL GOL A . E 4 HOH 1 401 15 HOH HOH A . E 4 HOH 2 402 29 HOH HOH A . E 4 HOH 3 403 32 HOH HOH A . E 4 HOH 4 404 9 HOH HOH A . E 4 HOH 5 405 21 HOH HOH A . E 4 HOH 6 406 16 HOH HOH A . E 4 HOH 7 407 4 HOH HOH A . E 4 HOH 8 408 31 HOH HOH A . E 4 HOH 9 409 1 HOH HOH A . E 4 HOH 10 410 18 HOH HOH A . E 4 HOH 11 411 5 HOH HOH A . E 4 HOH 12 412 6 HOH HOH A . E 4 HOH 13 413 14 HOH HOH A . E 4 HOH 14 414 20 HOH HOH A . E 4 HOH 15 415 33 HOH HOH A . E 4 HOH 16 416 7 HOH HOH A . E 4 HOH 17 417 2 HOH HOH A . E 4 HOH 18 418 19 HOH HOH A . E 4 HOH 19 419 3 HOH HOH A . E 4 HOH 20 420 8 HOH HOH A . E 4 HOH 21 421 13 HOH HOH A . E 4 HOH 22 422 17 HOH HOH A . E 4 HOH 23 423 26 HOH HOH A . E 4 HOH 24 424 28 HOH HOH A . E 4 HOH 25 425 23 HOH HOH A . E 4 HOH 26 426 10 HOH HOH A . E 4 HOH 27 427 25 HOH HOH A . E 4 HOH 28 428 12 HOH HOH A . E 4 HOH 29 429 30 HOH HOH A . E 4 HOH 30 430 22 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 125.40 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6IB7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 90.718 _cell.length_a_esd ? _cell.length_b 46.031 _cell.length_b_esd ? _cell.length_c 72.915 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6IB7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6IB7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.3 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Tris-HCl, pH 8.3, 12% PEG 8000,' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-10-26 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator KMC-2 _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.91841 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.91841 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.2 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6IB7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.245 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11994 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.245 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1919 _reflns_shell.percent_possible_all 96.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.58 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6IB7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.245 _refine.ls_d_res_low 36.975 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11611 _refine.ls_number_reflns_R_free 581 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.34 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2172 _refine.ls_R_factor_R_free 0.2605 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2148 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2QFL _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.52 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.30 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1974 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 2017 _refine_hist.d_res_high 2.245 _refine_hist.d_res_low 36.975 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 2051 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.736 ? 2781 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 10.354 ? 1660 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.047 ? 310 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 368 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2451 2.4710 . . 145 2741 97.00 . . . 0.4000 . 0.3310 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4710 2.8284 . . 144 2744 98.00 . . . 0.3506 . 0.2721 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8284 3.5630 . . 146 2765 98.00 . . . 0.2891 . 0.2368 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5630 36.9798 . . 146 2780 97.00 . . . 0.2152 . 0.1810 . . . . . . . . . . # _struct.entry_id 6IB7 _struct.title 'Structure of wild type SuhB' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6IB7 _struct_keywords.text 'SuhB, antitermiantion, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SUHB_ECOLI _struct_ref.pdbx_db_accession P0ADG4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MHPMLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYPQHTIITEESGELEGTDQDVQ WVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFK AKQYATTYINIVGKLFNECADFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVREAGGIVSDFTGGHNYMLTG NIVAGNPRVVKAMLANMRDELSDALKR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6IB7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 271 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0ADG4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 267 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 267 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6IB7 GLY A 1 ? UNP P0ADG4 ? ? 'expression tag' -3 1 1 6IB7 ALA A 2 ? UNP P0ADG4 ? ? 'expression tag' -2 2 1 6IB7 MET A 3 ? UNP P0ADG4 ? ? 'expression tag' -1 3 1 6IB7 ALA A 4 ? UNP P0ADG4 ? ? 'expression tag' 0 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4470 ? 1 MORE -24 ? 1 'SSA (A^2)' 20420 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 48.4797133186 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 59.4350432255 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 6 ? THR A 29 ? HIS A 2 THR A 25 1 ? 24 HELX_P HELX_P2 AA2 THR A 45 ? TYR A 63 ? THR A 41 TYR A 59 1 ? 19 HELX_P HELX_P3 AA3 GLY A 92 ? LYS A 98 ? GLY A 88 LYS A 94 1 ? 7 HELX_P HELX_P4 AA4 ALA A 165 ? GLN A 167 ? ALA A 161 GLN A 163 5 ? 3 HELX_P HELX_P5 AA5 TYR A 168 ? ASN A 181 ? TYR A 164 ASN A 177 1 ? 14 HELX_P HELX_P6 AA6 SER A 191 ? ALA A 201 ? SER A 187 ALA A 197 1 ? 11 HELX_P HELX_P7 AA7 ARG A 213 ? ALA A 227 ? ARG A 209 ALA A 223 1 ? 15 HELX_P HELX_P8 AA8 ASN A 239 ? GLY A 244 ? ASN A 235 GLY A 240 1 ? 6 HELX_P HELX_P9 AA9 ASN A 250 ? ARG A 262 ? ASN A 246 ARG A 258 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 71 OE1 ? ? ? 1_555 B MG . MG ? ? A GLU 67 A MG 301 1_555 ? ? ? ? ? ? ? 2.710 ? ? metalc2 metalc ? ? A ASP 88 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 84 A MG 301 1_555 ? ? ? ? ? ? ? 2.196 ? ? metalc3 metalc ? ? A LEU 90 O ? ? ? 1_555 B MG . MG ? ? A LEU 86 A MG 301 1_555 ? ? ? ? ? ? ? 2.379 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 301 A HOH 413 1_555 ? ? ? ? ? ? ? 2.243 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 301 A HOH 421 1_555 ? ? ? ? ? ? ? 2.229 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 301 A HOH 428 1_555 ? ? ? ? ? ? ? 2.160 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 71 ? A GLU 67 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OD1 ? A ASP 88 ? A ASP 84 ? 1_555 92.9 ? 2 OE1 ? A GLU 71 ? A GLU 67 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? A LEU 90 ? A LEU 86 ? 1_555 168.9 ? 3 OD1 ? A ASP 88 ? A ASP 84 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? A LEU 90 ? A LEU 86 ? 1_555 90.3 ? 4 OE1 ? A GLU 71 ? A GLU 67 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? E HOH . ? A HOH 413 ? 1_555 89.9 ? 5 OD1 ? A ASP 88 ? A ASP 84 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? E HOH . ? A HOH 413 ? 1_555 84.4 ? 6 O ? A LEU 90 ? A LEU 86 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? E HOH . ? A HOH 413 ? 1_555 79.8 ? 7 OE1 ? A GLU 71 ? A GLU 67 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? E HOH . ? A HOH 421 ? 1_555 83.4 ? 8 OD1 ? A ASP 88 ? A ASP 84 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? E HOH . ? A HOH 421 ? 1_555 163.0 ? 9 O ? A LEU 90 ? A LEU 86 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? E HOH . ? A HOH 421 ? 1_555 90.5 ? 10 O ? E HOH . ? A HOH 413 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? E HOH . ? A HOH 421 ? 1_555 79.1 ? 11 OE1 ? A GLU 71 ? A GLU 67 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? E HOH . ? A HOH 428 ? 1_555 91.0 ? 12 OD1 ? A ASP 88 ? A ASP 84 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? E HOH . ? A HOH 428 ? 1_555 120.7 ? 13 O ? A LEU 90 ? A LEU 86 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? E HOH . ? A HOH 428 ? 1_555 96.5 ? 14 O ? E HOH . ? A HOH 413 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? E HOH . ? A HOH 428 ? 1_555 154.8 ? 15 O ? E HOH . ? A HOH 421 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? E HOH . ? A HOH 428 ? 1_555 76.0 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 8 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 37 ? GLY A 39 ? GLN A 33 GLY A 35 AA1 2 ASP A 42 ? PHE A 43 ? ASP A 38 PHE A 39 AA2 1 GLY A 74 ? LEU A 76 ? GLY A 70 LEU A 72 AA2 2 HIS A 66 ? THR A 70 ? HIS A 62 THR A 66 AA2 3 ASP A 80 ? ASP A 91 ? ASP A 76 ASP A 87 AA2 4 ALA A 104 ? ILE A 111 ? ALA A 100 ILE A 107 AA2 5 ARG A 114 ? ASP A 122 ? ARG A 110 ASP A 118 AA2 6 GLU A 127 ? THR A 132 ? GLU A 123 THR A 128 AA2 7 ALA A 137 ? LEU A 139 ? ALA A 133 LEU A 135 AA2 8 TYR A 142 ? ARG A 143 ? TYR A 138 ARG A 139 AA3 1 ASP A 185 ? ARG A 187 ? ASP A 181 ARG A 183 AA3 2 ILE A 156 ? THR A 159 ? ILE A 152 THR A 155 AA3 3 GLY A 206 ? GLU A 209 ? GLY A 202 GLU A 205 AA3 4 ILE A 246 ? GLY A 249 ? ILE A 242 GLY A 245 AA3 5 ILE A 230 ? SER A 232 ? ILE A 226 SER A 228 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 39 ? N GLY A 35 O ASP A 42 ? O ASP A 38 AA2 1 2 O LEU A 76 ? O LEU A 72 N ILE A 68 ? N ILE A 64 AA2 2 3 N ILE A 69 ? N ILE A 65 O TRP A 85 ? O TRP A 81 AA2 3 4 N VAL A 86 ? N VAL A 82 O ALA A 108 ? O ALA A 104 AA2 4 5 N ILE A 111 ? N ILE A 107 O ARG A 114 ? O ARG A 110 AA2 5 6 N VAL A 120 ? N VAL A 116 O PHE A 129 ? O PHE A 125 AA2 6 7 N THR A 130 ? N THR A 126 O GLN A 138 ? O GLN A 134 AA2 7 8 N LEU A 139 ? N LEU A 135 O TYR A 142 ? O TYR A 138 AA3 1 2 O ARG A 187 ? O ARG A 183 N LEU A 157 ? N LEU A 153 AA3 2 3 N ALA A 158 ? N ALA A 154 O GLY A 206 ? O GLY A 202 AA3 3 4 N PHE A 207 ? N PHE A 203 O ALA A 248 ? O ALA A 244 AA3 4 5 O GLY A 249 ? O GLY A 245 N ILE A 230 ? N ILE A 226 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 301 ? 6 'binding site for residue MG A 301' AC2 Software A GOL 302 ? 6 'binding site for residue GOL A 302' AC3 Software A GOL 303 ? 6 'binding site for residue GOL A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 71 ? GLU A 67 . ? 1_555 ? 2 AC1 6 ASP A 88 ? ASP A 84 . ? 1_555 ? 3 AC1 6 LEU A 90 ? LEU A 86 . ? 1_555 ? 4 AC1 6 HOH E . ? HOH A 413 . ? 1_555 ? 5 AC1 6 HOH E . ? HOH A 421 . ? 1_555 ? 6 AC1 6 HOH E . ? HOH A 428 . ? 1_555 ? 7 AC2 6 ASP A 91 ? ASP A 87 . ? 1_555 ? 8 AC2 6 ARG A 188 ? ARG A 184 . ? 1_555 ? 9 AC2 6 GLY A 190 ? GLY A 186 . ? 1_555 ? 10 AC2 6 ALA A 192 ? ALA A 188 . ? 1_555 ? 11 AC2 6 GLU A 209 ? GLU A 205 . ? 1_555 ? 12 AC2 6 HOH E . ? HOH A 417 . ? 1_555 ? 13 AC3 6 LEU A 100 ? LEU A 96 . ? 1_555 ? 14 AC3 6 HIS A 102 ? HIS A 98 . ? 2_656 ? 15 AC3 6 ARG A 125 ? ARG A 121 . ? 2_656 ? 16 AC3 6 THR A 189 ? THR A 185 . ? 2_656 ? 17 AC3 6 TYR A 198 ? TYR A 194 . ? 2_656 ? 18 AC3 6 HOH E . ? HOH A 407 . ? 2_656 ? # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 LEU _pdbx_validate_rmsd_bond.auth_seq_id_1 208 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 N _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 ARG _pdbx_validate_rmsd_bond.auth_seq_id_2 209 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.168 _pdbx_validate_rmsd_bond.bond_target_value 1.336 _pdbx_validate_rmsd_bond.bond_deviation -0.168 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.023 _pdbx_validate_rmsd_bond.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 26 ? ? -79.03 45.78 2 1 SER A 32 ? ? -172.22 144.18 3 1 TYR A 59 ? ? -148.69 57.43 4 1 ASN A 235 ? ? -89.64 37.19 5 1 ASN A 235 ? ? -88.10 37.19 # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 1 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 LEU _pdbx_validate_polymer_linkage.auth_seq_id_1 208 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 ? _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 ARG _pdbx_validate_polymer_linkage.auth_seq_id_2 209 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 ? _pdbx_validate_polymer_linkage.dist 1.17 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -3 ? A GLY 1 2 1 Y 1 A ALA -2 ? A ALA 2 3 1 Y 1 A MET -1 ? A MET 3 4 1 Y 1 A ALA 0 ? A ALA 4 5 1 Y 1 A MET 1 ? A MET 5 6 1 Y 1 A ASP 259 ? A ASP 263 7 1 Y 1 A GLU 260 ? A GLU 264 8 1 Y 1 A LEU 261 ? A LEU 265 9 1 Y 1 A SER 262 ? A SER 266 10 1 Y 1 A ASP 263 ? A ASP 267 11 1 Y 1 A ALA 264 ? A ALA 268 12 1 Y 1 A LEU 265 ? A LEU 269 13 1 Y 1 A LYS 266 ? A LYS 270 14 1 Y 1 A ARG 267 ? A ARG 271 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 MG MG MG N N 264 PHE N N N N 265 PHE CA C N S 266 PHE C C N N 267 PHE O O N N 268 PHE CB C N N 269 PHE CG C Y N 270 PHE CD1 C Y N 271 PHE CD2 C Y N 272 PHE CE1 C Y N 273 PHE CE2 C Y N 274 PHE CZ C Y N 275 PHE OXT O N N 276 PHE H H N N 277 PHE H2 H N N 278 PHE HA H N N 279 PHE HB2 H N N 280 PHE HB3 H N N 281 PHE HD1 H N N 282 PHE HD2 H N N 283 PHE HE1 H N N 284 PHE HE2 H N N 285 PHE HZ H N N 286 PHE HXT H N N 287 PRO N N N N 288 PRO CA C N S 289 PRO C C N N 290 PRO O O N N 291 PRO CB C N N 292 PRO CG C N N 293 PRO CD C N N 294 PRO OXT O N N 295 PRO H H N N 296 PRO HA H N N 297 PRO HB2 H N N 298 PRO HB3 H N N 299 PRO HG2 H N N 300 PRO HG3 H N N 301 PRO HD2 H N N 302 PRO HD3 H N N 303 PRO HXT H N N 304 SER N N N N 305 SER CA C N S 306 SER C C N N 307 SER O O N N 308 SER CB C N N 309 SER OG O N N 310 SER OXT O N N 311 SER H H N N 312 SER H2 H N N 313 SER HA H N N 314 SER HB2 H N N 315 SER HB3 H N N 316 SER HG H N N 317 SER HXT H N N 318 THR N N N N 319 THR CA C N S 320 THR C C N N 321 THR O O N N 322 THR CB C N R 323 THR OG1 O N N 324 THR CG2 C N N 325 THR OXT O N N 326 THR H H N N 327 THR H2 H N N 328 THR HA H N N 329 THR HB H N N 330 THR HG1 H N N 331 THR HG21 H N N 332 THR HG22 H N N 333 THR HG23 H N N 334 THR HXT H N N 335 TRP N N N N 336 TRP CA C N S 337 TRP C C N N 338 TRP O O N N 339 TRP CB C N N 340 TRP CG C Y N 341 TRP CD1 C Y N 342 TRP CD2 C Y N 343 TRP NE1 N Y N 344 TRP CE2 C Y N 345 TRP CE3 C Y N 346 TRP CZ2 C Y N 347 TRP CZ3 C Y N 348 TRP CH2 C Y N 349 TRP OXT O N N 350 TRP H H N N 351 TRP H2 H N N 352 TRP HA H N N 353 TRP HB2 H N N 354 TRP HB3 H N N 355 TRP HD1 H N N 356 TRP HE1 H N N 357 TRP HE3 H N N 358 TRP HZ2 H N N 359 TRP HZ3 H N N 360 TRP HH2 H N N 361 TRP HXT H N N 362 TYR N N N N 363 TYR CA C N S 364 TYR C C N N 365 TYR O O N N 366 TYR CB C N N 367 TYR CG C Y N 368 TYR CD1 C Y N 369 TYR CD2 C Y N 370 TYR CE1 C Y N 371 TYR CE2 C Y N 372 TYR CZ C Y N 373 TYR OH O N N 374 TYR OXT O N N 375 TYR H H N N 376 TYR H2 H N N 377 TYR HA H N N 378 TYR HB2 H N N 379 TYR HB3 H N N 380 TYR HD1 H N N 381 TYR HD2 H N N 382 TYR HE1 H N N 383 TYR HE2 H N N 384 TYR HH H N N 385 TYR HXT H N N 386 VAL N N N N 387 VAL CA C N S 388 VAL C C N N 389 VAL O O N N 390 VAL CB C N N 391 VAL CG1 C N N 392 VAL CG2 C N N 393 VAL OXT O N N 394 VAL H H N N 395 VAL H2 H N N 396 VAL HA H N N 397 VAL HB H N N 398 VAL HG11 H N N 399 VAL HG12 H N N 400 VAL HG13 H N N 401 VAL HG21 H N N 402 VAL HG22 H N N 403 VAL HG23 H N N 404 VAL HXT H N N 405 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 THR N CA sing N N 303 THR N H sing N N 304 THR N H2 sing N N 305 THR CA C sing N N 306 THR CA CB sing N N 307 THR CA HA sing N N 308 THR C O doub N N 309 THR C OXT sing N N 310 THR CB OG1 sing N N 311 THR CB CG2 sing N N 312 THR CB HB sing N N 313 THR OG1 HG1 sing N N 314 THR CG2 HG21 sing N N 315 THR CG2 HG22 sing N N 316 THR CG2 HG23 sing N N 317 THR OXT HXT sing N N 318 TRP N CA sing N N 319 TRP N H sing N N 320 TRP N H2 sing N N 321 TRP CA C sing N N 322 TRP CA CB sing N N 323 TRP CA HA sing N N 324 TRP C O doub N N 325 TRP C OXT sing N N 326 TRP CB CG sing N N 327 TRP CB HB2 sing N N 328 TRP CB HB3 sing N N 329 TRP CG CD1 doub Y N 330 TRP CG CD2 sing Y N 331 TRP CD1 NE1 sing Y N 332 TRP CD1 HD1 sing N N 333 TRP CD2 CE2 doub Y N 334 TRP CD2 CE3 sing Y N 335 TRP NE1 CE2 sing Y N 336 TRP NE1 HE1 sing N N 337 TRP CE2 CZ2 sing Y N 338 TRP CE3 CZ3 doub Y N 339 TRP CE3 HE3 sing N N 340 TRP CZ2 CH2 doub Y N 341 TRP CZ2 HZ2 sing N N 342 TRP CZ3 CH2 sing Y N 343 TRP CZ3 HZ3 sing N N 344 TRP CH2 HH2 sing N N 345 TRP OXT HXT sing N N 346 TYR N CA sing N N 347 TYR N H sing N N 348 TYR N H2 sing N N 349 TYR CA C sing N N 350 TYR CA CB sing N N 351 TYR CA HA sing N N 352 TYR C O doub N N 353 TYR C OXT sing N N 354 TYR CB CG sing N N 355 TYR CB HB2 sing N N 356 TYR CB HB3 sing N N 357 TYR CG CD1 doub Y N 358 TYR CG CD2 sing Y N 359 TYR CD1 CE1 sing Y N 360 TYR CD1 HD1 sing N N 361 TYR CD2 CE2 doub Y N 362 TYR CD2 HD2 sing N N 363 TYR CE1 CZ doub Y N 364 TYR CE1 HE1 sing N N 365 TYR CE2 CZ sing Y N 366 TYR CE2 HE2 sing N N 367 TYR CZ OH sing N N 368 TYR OH HH sing N N 369 TYR OXT HXT sing N N 370 VAL N CA sing N N 371 VAL N H sing N N 372 VAL N H2 sing N N 373 VAL CA C sing N N 374 VAL CA CB sing N N 375 VAL CA HA sing N N 376 VAL C O doub N N 377 VAL C OXT sing N N 378 VAL CB CG1 sing N N 379 VAL CB CG2 sing N N 380 VAL CB HB sing N N 381 VAL CG1 HG11 sing N N 382 VAL CG1 HG12 sing N N 383 VAL CG1 HG13 sing N N 384 VAL CG2 HG21 sing N N 385 VAL CG2 HG22 sing N N 386 VAL CG2 HG23 sing N N 387 VAL OXT HXT sing N N 388 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2QFL _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6IB7 _atom_sites.fract_transf_matrix[1][1] 0.011023 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007833 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021724 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016824 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S # loop_