data_6IGH # _entry.id 6IGH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6IGH pdb_00006igh 10.2210/pdb6igh/pdb WWPDB D_1300009103 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6IGH _pdbx_database_status.recvd_initial_deposition_date 2018-09-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Watanabe, S.' 1 0000-0002-1130-0477 'Nakamura, Y.' 2 ? 'Kanehara, K.' 3 ? 'Inaba, K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Iscience _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2589-0042 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 21 _citation.language ? _citation.page_first 577 _citation.page_last 586 _citation.title 'High-Resolution Crystal Structure of Arabidopsis FLOWERING LOCUS T Illuminates Its Phospholipid-Binding Site in Flowering.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.isci.2019.10.045 _citation.pdbx_database_id_PubMed 31726375 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nakamura, Y.' 1 ? primary 'Lin, Y.C.' 2 ? primary 'Watanabe, S.' 3 ? primary 'Liu, Y.C.' 4 ? primary 'Katsuyama, K.' 5 ? primary 'Kanehara, K.' 6 ? primary 'Inaba, K.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6IGH _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.889 _cell.length_a_esd ? _cell.length_b 60.956 _cell.length_b_esd ? _cell.length_c 63.799 _cell.length_c_esd ? _cell.volume 190125.989 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6IGH _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein FLOWERING LOCUS T' 19433.900 1 ? 'C107S, C164S' 'UNP residues 1-168' ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 4 ? ? ? ? 3 water nat water 18.015 294 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ISHMSINIRDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSP SNPHLREYLHWLVTDIPATTGTTFGNEIVSYENPSPTAGIHRVVFILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPV AAVFYNSQRES ; _entity_poly.pdbx_seq_one_letter_code_can ;ISHMSINIRDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSP SNPHLREYLHWLVTDIPATTGTTFGNEIVSYENPSPTAGIHRVVFILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPV AAVFYNSQRES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 ILE n 1 7 ASN n 1 8 ILE n 1 9 ARG n 1 10 ASP n 1 11 PRO n 1 12 LEU n 1 13 ILE n 1 14 VAL n 1 15 SER n 1 16 ARG n 1 17 VAL n 1 18 VAL n 1 19 GLY n 1 20 ASP n 1 21 VAL n 1 22 LEU n 1 23 ASP n 1 24 PRO n 1 25 PHE n 1 26 ASN n 1 27 ARG n 1 28 SER n 1 29 ILE n 1 30 THR n 1 31 LEU n 1 32 LYS n 1 33 VAL n 1 34 THR n 1 35 TYR n 1 36 GLY n 1 37 GLN n 1 38 ARG n 1 39 GLU n 1 40 VAL n 1 41 THR n 1 42 ASN n 1 43 GLY n 1 44 LEU n 1 45 ASP n 1 46 LEU n 1 47 ARG n 1 48 PRO n 1 49 SER n 1 50 GLN n 1 51 VAL n 1 52 GLN n 1 53 ASN n 1 54 LYS n 1 55 PRO n 1 56 ARG n 1 57 VAL n 1 58 GLU n 1 59 ILE n 1 60 GLY n 1 61 GLY n 1 62 GLU n 1 63 ASP n 1 64 LEU n 1 65 ARG n 1 66 ASN n 1 67 PHE n 1 68 TYR n 1 69 THR n 1 70 LEU n 1 71 VAL n 1 72 MET n 1 73 VAL n 1 74 ASP n 1 75 PRO n 1 76 ASP n 1 77 VAL n 1 78 PRO n 1 79 SER n 1 80 PRO n 1 81 SER n 1 82 ASN n 1 83 PRO n 1 84 HIS n 1 85 LEU n 1 86 ARG n 1 87 GLU n 1 88 TYR n 1 89 LEU n 1 90 HIS n 1 91 TRP n 1 92 LEU n 1 93 VAL n 1 94 THR n 1 95 ASP n 1 96 ILE n 1 97 PRO n 1 98 ALA n 1 99 THR n 1 100 THR n 1 101 GLY n 1 102 THR n 1 103 THR n 1 104 PHE n 1 105 GLY n 1 106 ASN n 1 107 GLU n 1 108 ILE n 1 109 VAL n 1 110 SER n 1 111 TYR n 1 112 GLU n 1 113 ASN n 1 114 PRO n 1 115 SER n 1 116 PRO n 1 117 THR n 1 118 ALA n 1 119 GLY n 1 120 ILE n 1 121 HIS n 1 122 ARG n 1 123 VAL n 1 124 VAL n 1 125 PHE n 1 126 ILE n 1 127 LEU n 1 128 PHE n 1 129 ARG n 1 130 GLN n 1 131 LEU n 1 132 GLY n 1 133 ARG n 1 134 GLN n 1 135 THR n 1 136 VAL n 1 137 TYR n 1 138 ALA n 1 139 PRO n 1 140 GLY n 1 141 TRP n 1 142 ARG n 1 143 GLN n 1 144 ASN n 1 145 PHE n 1 146 ASN n 1 147 THR n 1 148 ARG n 1 149 GLU n 1 150 PHE n 1 151 ALA n 1 152 GLU n 1 153 ILE n 1 154 TYR n 1 155 ASN n 1 156 LEU n 1 157 GLY n 1 158 LEU n 1 159 PRO n 1 160 VAL n 1 161 ALA n 1 162 ALA n 1 163 VAL n 1 164 PHE n 1 165 TYR n 1 166 ASN n 1 167 SER n 1 168 GLN n 1 169 ARG n 1 170 GLU n 1 171 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 171 _entity_src_gen.gene_src_common_name 'Mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FT _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FT_ARATH _struct_ref.pdbx_db_accession Q9SXZ2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSINIRDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSPSNP HLREYLHWLVTDIPATTGTTFGNEIVCYENPSPTAGIHRVVFILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPVAAV FYNCQRES ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6IGH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 171 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9SXZ2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 168 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 168 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6IGH ILE A 1 ? UNP Q9SXZ2 ? ? 'expression tag' -2 1 1 6IGH SER A 2 ? UNP Q9SXZ2 ? ? 'expression tag' -1 2 1 6IGH HIS A 3 ? UNP Q9SXZ2 ? ? 'expression tag' 0 3 1 6IGH SER A 110 ? UNP Q9SXZ2 CYS 107 'engineered mutation' 107 4 1 6IGH SER A 167 ? UNP Q9SXZ2 CYS 164 'engineered mutation' 164 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6IGH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG4000 and ammonium citrate/citric acid, pH 5.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-10-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL44XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL44XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 9.15 _reflns.entry_id 6IGH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.01 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 97694 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.01 _reflns_shell.d_res_low 1.03 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 6267 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.833 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 14.64 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6IGH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.01 _refine.ls_d_res_low 32.74 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 97693 _refine.ls_number_reflns_R_free 4869 _refine.ls_number_reflns_R_work 92824 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.35 _refine.ls_percent_reflns_R_free 4.98 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1179 _refine.ls_R_factor_R_free 0.1385 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1169 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1WKP _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 10.5215 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0671 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.01 _refine_hist.d_res_low 32.74 _refine_hist.number_atoms_solvent 294 _refine_hist.number_atoms_total 1653 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1343 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0145 ? 1498 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.4728 ? 2052 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.1198 ? 223 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0121 ? 279 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 3.4067 ? 852 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.01 1.02 . . 163 2936 93.63 . . . 0.2253 . 0.1817 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.02 1.03 . . 162 3007 95.42 . . . 0.1813 . 0.1678 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.03 1.05 . . 152 2978 94.93 . . . 0.1681 . 0.1537 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.05 1.06 . . 161 3007 95.45 . . . 0.1583 . 0.1413 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.06 1.07 . . 134 3015 95.34 . . . 0.1631 . 0.1341 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.07 1.09 . . 170 3001 95.51 . . . 0.1484 . 0.1305 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.09 1.10 . . 168 2985 95.89 . . . 0.1265 . 0.1208 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.10 1.12 . . 163 3023 96.22 . . . 0.1348 . 0.1086 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.12 1.14 . . 152 3006 95.49 . . . 0.1336 . 0.1080 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.14 1.16 . . 168 3049 96.87 . . . 0.1230 . 0.1042 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.16 1.18 . . 163 3047 96.51 . . . 0.1314 . 0.1026 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.18 1.20 . . 180 3030 96.45 . . . 0.1157 . 0.0994 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.20 1.22 . . 170 3058 97.08 . . . 0.1286 . 0.1008 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.22 1.25 . . 152 3065 97.13 . . . 0.1284 . 0.0996 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.25 1.27 . . 162 3047 97.15 . . . 0.1249 . 0.1000 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.27 1.30 . . 169 3094 97.55 . . . 0.1426 . 0.0982 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.30 1.34 . . 149 3083 97.76 . . . 0.1251 . 0.1002 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.34 1.37 . . 146 3116 97.84 . . . 0.1221 . 0.0970 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.37 1.41 . . 162 3110 98.05 . . . 0.1100 . 0.0954 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.41 1.46 . . 152 3142 98.21 . . . 0.1227 . 0.0941 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.46 1.51 . . 178 3101 98.44 . . . 0.1150 . 0.0948 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.51 1.57 . . 170 3119 98.27 . . . 0.1057 . 0.0952 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.57 1.64 . . 177 3141 98.69 . . . 0.1091 . 0.0972 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.64 1.73 . . 169 3145 99.31 . . . 0.1310 . 0.0999 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.73 1.84 . . 160 3186 98.94 . . . 0.1205 . 0.1055 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.84 1.98 . . 162 3184 99.35 . . . 0.1281 . 0.1051 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.98 2.18 . . 155 3232 99.65 . . . 0.1249 . 0.1081 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.18 2.49 . . 189 3204 99.71 . . . 0.1455 . 0.1181 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.49 3.14 . . 167 3281 99.83 . . . 0.1573 . 0.1327 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.14 32.74 . . 144 3432 99.28 . . . 0.1675 . 0.1454 . . . . . . . . . . # _struct.entry_id 6IGH _struct.title 'Crystal structure of FT condition3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6IGH _struct_keywords.text 'flowering control, PLANT PROTEIN' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 10 ? SER A 15 ? ASP A 7 SER A 12 1 ? 6 HELX_P HELX_P2 AA2 ARG A 16 ? VAL A 21 ? ARG A 13 VAL A 18 1 ? 6 HELX_P HELX_P3 AA3 ARG A 47 ? VAL A 51 ? ARG A 44 VAL A 48 5 ? 5 HELX_P HELX_P4 AA4 GLY A 101 ? GLY A 105 ? GLY A 98 GLY A 102 5 ? 5 HELX_P HELX_P5 AA5 ASN A 146 ? TYR A 154 ? ASN A 143 TYR A 151 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 77 A . ? VAL 74 A PRO 78 A ? PRO 75 A 1 -0.73 2 ARG 86 A . ? ARG 83 A GLU 87 A ? GLU 84 A 1 -13.85 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 38 ? VAL A 40 ? ARG A 35 VAL A 37 AA1 2 LEU A 31 ? TYR A 35 ? LEU A 28 TYR A 32 AA1 3 ARG A 56 ? ILE A 59 ? ARG A 53 ILE A 56 AA2 1 ASN A 42 ? ASP A 45 ? ASN A 39 ASP A 42 AA2 2 ALA A 161 ? SER A 167 ? ALA A 158 SER A 164 AA2 3 HIS A 121 ? ARG A 129 ? HIS A 118 ARG A 126 AA2 4 PHE A 67 ? ASP A 74 ? PHE A 64 ASP A 71 AA2 5 TYR A 88 ? PRO A 97 ? TYR A 85 PRO A 94 AA2 6 ASN A 106 ? VAL A 109 ? ASN A 103 VAL A 106 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 40 ? O VAL A 37 N VAL A 33 ? N VAL A 30 AA1 2 3 N THR A 34 ? N THR A 31 O ARG A 56 ? O ARG A 53 AA2 1 2 N GLY A 43 ? N GLY A 40 O PHE A 164 ? O PHE A 161 AA2 2 3 O SER A 167 ? O SER A 164 N HIS A 121 ? N HIS A 118 AA2 3 4 O VAL A 124 ? O VAL A 121 N VAL A 73 ? N VAL A 70 AA2 4 5 N LEU A 70 ? N LEU A 67 O VAL A 93 ? O VAL A 90 AA2 5 6 N THR A 94 ? N THR A 91 O ASN A 106 ? O ASN A 103 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 201 ? 7 'binding site for residue EDO A 201' AC2 Software A EDO 202 ? 5 'binding site for residue EDO A 202' AC3 Software A EDO 203 ? 5 'binding site for residue EDO A 203' AC4 Software A EDO 204 ? 7 'binding site for residue EDO A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 SER A 28 ? SER A 25 . ? 4_545 ? 2 AC1 7 ASP A 45 ? ASP A 42 . ? 1_555 ? 3 AC1 7 LEU A 46 ? LEU A 43 . ? 1_555 ? 4 AC1 7 ARG A 47 ? ARG A 44 . ? 1_555 ? 5 AC1 7 SER A 167 ? SER A 164 . ? 1_555 ? 6 AC1 7 GLN A 168 ? GLN A 165 . ? 1_555 ? 7 AC1 7 HOH F . ? HOH A 331 . ? 1_555 ? 8 AC2 5 ASP A 10 ? ASP A 7 . ? 1_555 ? 9 AC2 5 PRO A 24 ? PRO A 21 . ? 1_555 ? 10 AC2 5 PHE A 25 ? PHE A 22 . ? 1_555 ? 11 AC2 5 HOH F . ? HOH A 383 . ? 1_555 ? 12 AC2 5 HOH F . ? HOH A 400 . ? 1_555 ? 13 AC3 5 VAL A 109 ? VAL A 106 . ? 1_555 ? 14 AC3 5 PRO A 139 ? PRO A 136 . ? 1_555 ? 15 AC3 5 GLY A 140 ? GLY A 137 . ? 1_555 ? 16 AC3 5 HOH F . ? HOH A 406 . ? 1_555 ? 17 AC3 5 HOH F . ? HOH A 418 . ? 1_555 ? 18 AC4 7 SER A 28 ? SER A 25 . ? 1_555 ? 19 AC4 7 ASP A 45 ? ASP A 42 . ? 4_445 ? 20 AC4 7 ARG A 47 ? ARG A 44 . ? 4_445 ? 21 AC4 7 GLN A 50 ? GLN A 47 . ? 4_445 ? 22 AC4 7 GLU A 62 ? GLU A 59 . ? 1_555 ? 23 AC4 7 HOH F . ? HOH A 319 . ? 1_555 ? 24 AC4 7 HOH F . ? HOH A 326 . ? 1_555 ? # _atom_sites.entry_id 6IGH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020454 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016405 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015674 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 0 HIS HIS A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 ILE 6 3 3 ILE ILE A . n A 1 7 ASN 7 4 4 ASN ASN A . n A 1 8 ILE 8 5 5 ILE ILE A . n A 1 9 ARG 9 6 6 ARG ARG A . n A 1 10 ASP 10 7 7 ASP ASP A . n A 1 11 PRO 11 8 8 PRO PRO A . n A 1 12 LEU 12 9 9 LEU LEU A . n A 1 13 ILE 13 10 10 ILE ILE A . n A 1 14 VAL 14 11 11 VAL VAL A . n A 1 15 SER 15 12 12 SER SER A . n A 1 16 ARG 16 13 13 ARG ARG A . n A 1 17 VAL 17 14 14 VAL VAL A . n A 1 18 VAL 18 15 15 VAL VAL A . n A 1 19 GLY 19 16 16 GLY GLY A . n A 1 20 ASP 20 17 17 ASP ASP A . n A 1 21 VAL 21 18 18 VAL VAL A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 ASP 23 20 20 ASP ASP A . n A 1 24 PRO 24 21 21 PRO PRO A . n A 1 25 PHE 25 22 22 PHE PHE A . n A 1 26 ASN 26 23 23 ASN ASN A . n A 1 27 ARG 27 24 24 ARG ARG A . n A 1 28 SER 28 25 25 SER SER A . n A 1 29 ILE 29 26 26 ILE ILE A . n A 1 30 THR 30 27 27 THR THR A . n A 1 31 LEU 31 28 28 LEU LEU A . n A 1 32 LYS 32 29 29 LYS LYS A . n A 1 33 VAL 33 30 30 VAL VAL A . n A 1 34 THR 34 31 31 THR THR A . n A 1 35 TYR 35 32 32 TYR TYR A . n A 1 36 GLY 36 33 33 GLY GLY A . n A 1 37 GLN 37 34 34 GLN GLN A . n A 1 38 ARG 38 35 35 ARG ALA A . n A 1 39 GLU 39 36 36 GLU GLU A . n A 1 40 VAL 40 37 37 VAL VAL A . n A 1 41 THR 41 38 38 THR THR A . n A 1 42 ASN 42 39 39 ASN ASN A . n A 1 43 GLY 43 40 40 GLY GLY A . n A 1 44 LEU 44 41 41 LEU LEU A . n A 1 45 ASP 45 42 42 ASP ASP A . n A 1 46 LEU 46 43 43 LEU LEU A . n A 1 47 ARG 47 44 44 ARG ARG A . n A 1 48 PRO 48 45 45 PRO PRO A . n A 1 49 SER 49 46 46 SER SER A . n A 1 50 GLN 50 47 47 GLN GLN A . n A 1 51 VAL 51 48 48 VAL VAL A . n A 1 52 GLN 52 49 49 GLN GLN A . n A 1 53 ASN 53 50 50 ASN ASN A . n A 1 54 LYS 54 51 51 LYS LYS A . n A 1 55 PRO 55 52 52 PRO PRO A . n A 1 56 ARG 56 53 53 ARG ARG A . n A 1 57 VAL 57 54 54 VAL VAL A . n A 1 58 GLU 58 55 55 GLU GLU A . n A 1 59 ILE 59 56 56 ILE ILE A . n A 1 60 GLY 60 57 57 GLY GLY A . n A 1 61 GLY 61 58 58 GLY GLY A . n A 1 62 GLU 62 59 59 GLU GLU A . n A 1 63 ASP 63 60 60 ASP ASP A . n A 1 64 LEU 64 61 61 LEU LEU A . n A 1 65 ARG 65 62 62 ARG ARG A . n A 1 66 ASN 66 63 63 ASN ASN A . n A 1 67 PHE 67 64 64 PHE PHE A . n A 1 68 TYR 68 65 65 TYR TYR A . n A 1 69 THR 69 66 66 THR THR A . n A 1 70 LEU 70 67 67 LEU LEU A . n A 1 71 VAL 71 68 68 VAL VAL A . n A 1 72 MET 72 69 69 MET MET A . n A 1 73 VAL 73 70 70 VAL VAL A . n A 1 74 ASP 74 71 71 ASP ASP A . n A 1 75 PRO 75 72 72 PRO PRO A . n A 1 76 ASP 76 73 73 ASP ASP A . n A 1 77 VAL 77 74 74 VAL VAL A . n A 1 78 PRO 78 75 75 PRO PRO A . n A 1 79 SER 79 76 76 SER SER A . n A 1 80 PRO 80 77 77 PRO PRO A . n A 1 81 SER 81 78 78 SER SER A . n A 1 82 ASN 82 79 79 ASN ASN A . n A 1 83 PRO 83 80 80 PRO PRO A . n A 1 84 HIS 84 81 81 HIS HIS A . n A 1 85 LEU 85 82 82 LEU LEU A . n A 1 86 ARG 86 83 83 ARG ARG A . n A 1 87 GLU 87 84 84 GLU GLU A . n A 1 88 TYR 88 85 85 TYR TYR A . n A 1 89 LEU 89 86 86 LEU LEU A . n A 1 90 HIS 90 87 87 HIS HIS A . n A 1 91 TRP 91 88 88 TRP TRP A . n A 1 92 LEU 92 89 89 LEU LEU A . n A 1 93 VAL 93 90 90 VAL VAL A . n A 1 94 THR 94 91 91 THR THR A . n A 1 95 ASP 95 92 92 ASP ASP A . n A 1 96 ILE 96 93 93 ILE ILE A . n A 1 97 PRO 97 94 94 PRO PRO A . n A 1 98 ALA 98 95 95 ALA ALA A . n A 1 99 THR 99 96 96 THR THR A . n A 1 100 THR 100 97 97 THR THR A . n A 1 101 GLY 101 98 98 GLY GLY A . n A 1 102 THR 102 99 99 THR THR A . n A 1 103 THR 103 100 100 THR THR A . n A 1 104 PHE 104 101 101 PHE PHE A . n A 1 105 GLY 105 102 102 GLY GLY A . n A 1 106 ASN 106 103 103 ASN ASN A . n A 1 107 GLU 107 104 104 GLU GLU A . n A 1 108 ILE 108 105 105 ILE ILE A . n A 1 109 VAL 109 106 106 VAL VAL A . n A 1 110 SER 110 107 107 SER SER A . n A 1 111 TYR 111 108 108 TYR TYR A . n A 1 112 GLU 112 109 109 GLU GLU A . n A 1 113 ASN 113 110 110 ASN ASN A . n A 1 114 PRO 114 111 111 PRO PRO A . n A 1 115 SER 115 112 112 SER SER A . n A 1 116 PRO 116 113 113 PRO PRO A . n A 1 117 THR 117 114 114 THR THR A . n A 1 118 ALA 118 115 115 ALA ALA A . n A 1 119 GLY 119 116 116 GLY GLY A . n A 1 120 ILE 120 117 117 ILE ILE A . n A 1 121 HIS 121 118 118 HIS HIS A . n A 1 122 ARG 122 119 119 ARG ARG A . n A 1 123 VAL 123 120 120 VAL VAL A . n A 1 124 VAL 124 121 121 VAL VAL A . n A 1 125 PHE 125 122 122 PHE PHE A . n A 1 126 ILE 126 123 123 ILE ILE A . n A 1 127 LEU 127 124 124 LEU LEU A . n A 1 128 PHE 128 125 125 PHE PHE A . n A 1 129 ARG 129 126 126 ARG ARG A . n A 1 130 GLN 130 127 127 GLN GLN A . n A 1 131 LEU 131 128 128 LEU LEU A . n A 1 132 GLY 132 129 129 GLY GLY A . n A 1 133 ARG 133 130 130 ARG ARG A . n A 1 134 GLN 134 131 131 GLN GLN A . n A 1 135 THR 135 132 132 THR THR A . n A 1 136 VAL 136 133 133 VAL VAL A . n A 1 137 TYR 137 134 134 TYR TYR A . n A 1 138 ALA 138 135 135 ALA ALA A . n A 1 139 PRO 139 136 136 PRO PRO A . n A 1 140 GLY 140 137 137 GLY GLY A . n A 1 141 TRP 141 138 138 TRP TRP A . n A 1 142 ARG 142 139 139 ARG ARG A . n A 1 143 GLN 143 140 140 GLN GLN A . n A 1 144 ASN 144 141 141 ASN ASN A . n A 1 145 PHE 145 142 142 PHE PHE A . n A 1 146 ASN 146 143 143 ASN ASN A . n A 1 147 THR 147 144 144 THR THR A . n A 1 148 ARG 148 145 145 ARG ARG A . n A 1 149 GLU 149 146 146 GLU GLU A . n A 1 150 PHE 150 147 147 PHE PHE A . n A 1 151 ALA 151 148 148 ALA ALA A . n A 1 152 GLU 152 149 149 GLU GLU A . n A 1 153 ILE 153 150 150 ILE ILE A . n A 1 154 TYR 154 151 151 TYR TYR A . n A 1 155 ASN 155 152 152 ASN ASN A . n A 1 156 LEU 156 153 153 LEU LEU A . n A 1 157 GLY 157 154 154 GLY GLY A . n A 1 158 LEU 158 155 155 LEU LEU A . n A 1 159 PRO 159 156 156 PRO PRO A . n A 1 160 VAL 160 157 157 VAL VAL A . n A 1 161 ALA 161 158 158 ALA ALA A . n A 1 162 ALA 162 159 159 ALA ALA A . n A 1 163 VAL 163 160 160 VAL VAL A . n A 1 164 PHE 164 161 161 PHE PHE A . n A 1 165 TYR 165 162 162 TYR TYR A . n A 1 166 ASN 166 163 163 ASN ASN A . n A 1 167 SER 167 164 164 SER SER A . n A 1 168 GLN 168 165 165 GLN GLN A . n A 1 169 ARG 169 166 166 ARG ARG A . n A 1 170 GLU 170 167 167 GLU GLU A . n A 1 171 SER 171 168 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 201 1 EDO EDO A . C 2 EDO 1 202 2 EDO EDO A . D 2 EDO 1 203 3 EDO EDO A . E 2 EDO 1 204 4 EDO EDO A . F 3 HOH 1 301 294 HOH HOH A . F 3 HOH 2 302 293 HOH HOH A . F 3 HOH 3 303 229 HOH HOH A . F 3 HOH 4 304 205 HOH HOH A . F 3 HOH 5 305 93 HOH HOH A . F 3 HOH 6 306 269 HOH HOH A . F 3 HOH 7 307 167 HOH HOH A . F 3 HOH 8 308 237 HOH HOH A . F 3 HOH 9 309 271 HOH HOH A . F 3 HOH 10 310 227 HOH HOH A . F 3 HOH 11 311 144 HOH HOH A . F 3 HOH 12 312 162 HOH HOH A . F 3 HOH 13 313 209 HOH HOH A . F 3 HOH 14 314 100 HOH HOH A . F 3 HOH 15 315 96 HOH HOH A . F 3 HOH 16 316 111 HOH HOH A . F 3 HOH 17 317 213 HOH HOH A . F 3 HOH 18 318 102 HOH HOH A . F 3 HOH 19 319 198 HOH HOH A . F 3 HOH 20 320 146 HOH HOH A . F 3 HOH 21 321 47 HOH HOH A . F 3 HOH 22 322 63 HOH HOH A . F 3 HOH 23 323 72 HOH HOH A . F 3 HOH 24 324 160 HOH HOH A . F 3 HOH 25 325 207 HOH HOH A . F 3 HOH 26 326 71 HOH HOH A . F 3 HOH 27 327 2 HOH HOH A . F 3 HOH 28 328 64 HOH HOH A . F 3 HOH 29 329 7 HOH HOH A . F 3 HOH 30 330 99 HOH HOH A . F 3 HOH 31 331 43 HOH HOH A . F 3 HOH 32 332 101 HOH HOH A . F 3 HOH 33 333 230 HOH HOH A . F 3 HOH 34 334 24 HOH HOH A . F 3 HOH 35 335 56 HOH HOH A . F 3 HOH 36 336 31 HOH HOH A . F 3 HOH 37 337 178 HOH HOH A . F 3 HOH 38 338 104 HOH HOH A . F 3 HOH 39 339 15 HOH HOH A . F 3 HOH 40 340 211 HOH HOH A . F 3 HOH 41 341 124 HOH HOH A . F 3 HOH 42 342 5 HOH HOH A . F 3 HOH 43 343 184 HOH HOH A . F 3 HOH 44 344 82 HOH HOH A . F 3 HOH 45 345 97 HOH HOH A . F 3 HOH 46 346 276 HOH HOH A . F 3 HOH 47 347 36 HOH HOH A . F 3 HOH 48 348 1 HOH HOH A . F 3 HOH 49 349 208 HOH HOH A . F 3 HOH 50 350 32 HOH HOH A . F 3 HOH 51 351 243 HOH HOH A . F 3 HOH 52 352 20 HOH HOH A . F 3 HOH 53 353 8 HOH HOH A . F 3 HOH 54 354 115 HOH HOH A . F 3 HOH 55 355 13 HOH HOH A . F 3 HOH 56 356 116 HOH HOH A . F 3 HOH 57 357 53 HOH HOH A . F 3 HOH 58 358 156 HOH HOH A . F 3 HOH 59 359 200 HOH HOH A . F 3 HOH 60 360 185 HOH HOH A . F 3 HOH 61 361 228 HOH HOH A . F 3 HOH 62 362 60 HOH HOH A . F 3 HOH 63 363 51 HOH HOH A . F 3 HOH 64 364 27 HOH HOH A . F 3 HOH 65 365 21 HOH HOH A . F 3 HOH 66 366 220 HOH HOH A . F 3 HOH 67 367 270 HOH HOH A . F 3 HOH 68 368 4 HOH HOH A . F 3 HOH 69 369 10 HOH HOH A . F 3 HOH 70 370 46 HOH HOH A . F 3 HOH 71 371 119 HOH HOH A . F 3 HOH 72 372 88 HOH HOH A . F 3 HOH 73 373 112 HOH HOH A . F 3 HOH 74 374 3 HOH HOH A . F 3 HOH 75 375 106 HOH HOH A . F 3 HOH 76 376 242 HOH HOH A . F 3 HOH 77 377 9 HOH HOH A . F 3 HOH 78 378 84 HOH HOH A . F 3 HOH 79 379 50 HOH HOH A . F 3 HOH 80 380 114 HOH HOH A . F 3 HOH 81 381 54 HOH HOH A . F 3 HOH 82 382 6 HOH HOH A . F 3 HOH 83 383 38 HOH HOH A . F 3 HOH 84 384 139 HOH HOH A . F 3 HOH 85 385 107 HOH HOH A . F 3 HOH 86 386 132 HOH HOH A . F 3 HOH 87 387 240 HOH HOH A . F 3 HOH 88 388 78 HOH HOH A . F 3 HOH 89 389 12 HOH HOH A . F 3 HOH 90 390 134 HOH HOH A . F 3 HOH 91 391 149 HOH HOH A . F 3 HOH 92 392 175 HOH HOH A . F 3 HOH 93 393 18 HOH HOH A . F 3 HOH 94 394 30 HOH HOH A . F 3 HOH 95 395 199 HOH HOH A . F 3 HOH 96 396 19 HOH HOH A . F 3 HOH 97 397 109 HOH HOH A . F 3 HOH 98 398 65 HOH HOH A . F 3 HOH 99 399 26 HOH HOH A . F 3 HOH 100 400 86 HOH HOH A . F 3 HOH 101 401 157 HOH HOH A . F 3 HOH 102 402 257 HOH HOH A . F 3 HOH 103 403 154 HOH HOH A . F 3 HOH 104 404 48 HOH HOH A . F 3 HOH 105 405 136 HOH HOH A . F 3 HOH 106 406 80 HOH HOH A . F 3 HOH 107 407 193 HOH HOH A . F 3 HOH 108 408 17 HOH HOH A . F 3 HOH 109 409 52 HOH HOH A . F 3 HOH 110 410 121 HOH HOH A . F 3 HOH 111 411 212 HOH HOH A . F 3 HOH 112 412 252 HOH HOH A . F 3 HOH 113 413 150 HOH HOH A . F 3 HOH 114 414 153 HOH HOH A . F 3 HOH 115 415 49 HOH HOH A . F 3 HOH 116 416 103 HOH HOH A . F 3 HOH 117 417 272 HOH HOH A . F 3 HOH 118 418 210 HOH HOH A . F 3 HOH 119 419 22 HOH HOH A . F 3 HOH 120 420 34 HOH HOH A . F 3 HOH 121 421 244 HOH HOH A . F 3 HOH 122 422 206 HOH HOH A . F 3 HOH 123 423 25 HOH HOH A . F 3 HOH 124 424 14 HOH HOH A . F 3 HOH 125 425 28 HOH HOH A . F 3 HOH 126 426 145 HOH HOH A . F 3 HOH 127 427 253 HOH HOH A . F 3 HOH 128 428 168 HOH HOH A . F 3 HOH 129 429 197 HOH HOH A . F 3 HOH 130 430 284 HOH HOH A . F 3 HOH 131 431 37 HOH HOH A . F 3 HOH 132 432 235 HOH HOH A . F 3 HOH 133 433 127 HOH HOH A . F 3 HOH 134 434 59 HOH HOH A . F 3 HOH 135 435 183 HOH HOH A . F 3 HOH 136 436 120 HOH HOH A . F 3 HOH 137 437 57 HOH HOH A . F 3 HOH 138 438 133 HOH HOH A . F 3 HOH 139 439 68 HOH HOH A . F 3 HOH 140 440 61 HOH HOH A . F 3 HOH 141 441 44 HOH HOH A . F 3 HOH 142 442 260 HOH HOH A . F 3 HOH 143 443 83 HOH HOH A . F 3 HOH 144 444 70 HOH HOH A . F 3 HOH 145 445 113 HOH HOH A . F 3 HOH 146 446 297 HOH HOH A . F 3 HOH 147 447 23 HOH HOH A . F 3 HOH 148 448 11 HOH HOH A . F 3 HOH 149 449 123 HOH HOH A . F 3 HOH 150 450 35 HOH HOH A . F 3 HOH 151 451 39 HOH HOH A . F 3 HOH 152 452 262 HOH HOH A . F 3 HOH 153 453 232 HOH HOH A . F 3 HOH 154 454 89 HOH HOH A . F 3 HOH 155 455 110 HOH HOH A . F 3 HOH 156 456 166 HOH HOH A . F 3 HOH 157 457 169 HOH HOH A . F 3 HOH 158 458 130 HOH HOH A . F 3 HOH 159 459 42 HOH HOH A . F 3 HOH 160 460 33 HOH HOH A . F 3 HOH 161 461 55 HOH HOH A . F 3 HOH 162 462 41 HOH HOH A . F 3 HOH 163 463 295 HOH HOH A . F 3 HOH 164 464 239 HOH HOH A . F 3 HOH 165 465 29 HOH HOH A . F 3 HOH 166 466 265 HOH HOH A . F 3 HOH 167 467 75 HOH HOH A . F 3 HOH 168 468 74 HOH HOH A . F 3 HOH 169 469 195 HOH HOH A . F 3 HOH 170 470 90 HOH HOH A . F 3 HOH 171 471 221 HOH HOH A . F 3 HOH 172 472 58 HOH HOH A . F 3 HOH 173 473 40 HOH HOH A . F 3 HOH 174 474 73 HOH HOH A . F 3 HOH 175 475 98 HOH HOH A . F 3 HOH 176 476 238 HOH HOH A . F 3 HOH 177 477 77 HOH HOH A . F 3 HOH 178 478 92 HOH HOH A . F 3 HOH 179 479 105 HOH HOH A . F 3 HOH 180 480 76 HOH HOH A . F 3 HOH 181 481 155 HOH HOH A . F 3 HOH 182 482 16 HOH HOH A . F 3 HOH 183 483 182 HOH HOH A . F 3 HOH 184 484 91 HOH HOH A . F 3 HOH 185 485 158 HOH HOH A . F 3 HOH 186 486 147 HOH HOH A . F 3 HOH 187 487 190 HOH HOH A . F 3 HOH 188 488 118 HOH HOH A . F 3 HOH 189 489 138 HOH HOH A . F 3 HOH 190 490 223 HOH HOH A . F 3 HOH 191 491 143 HOH HOH A . F 3 HOH 192 492 165 HOH HOH A . F 3 HOH 193 493 218 HOH HOH A . F 3 HOH 194 494 135 HOH HOH A . F 3 HOH 195 495 248 HOH HOH A . F 3 HOH 196 496 131 HOH HOH A . F 3 HOH 197 497 291 HOH HOH A . F 3 HOH 198 498 66 HOH HOH A . F 3 HOH 199 499 231 HOH HOH A . F 3 HOH 200 500 204 HOH HOH A . F 3 HOH 201 501 196 HOH HOH A . F 3 HOH 202 502 214 HOH HOH A . F 3 HOH 203 503 67 HOH HOH A . F 3 HOH 204 504 245 HOH HOH A . F 3 HOH 205 505 171 HOH HOH A . F 3 HOH 206 506 267 HOH HOH A . F 3 HOH 207 507 176 HOH HOH A . F 3 HOH 208 508 222 HOH HOH A . F 3 HOH 209 509 217 HOH HOH A . F 3 HOH 210 510 250 HOH HOH A . F 3 HOH 211 511 191 HOH HOH A . F 3 HOH 212 512 201 HOH HOH A . F 3 HOH 213 513 87 HOH HOH A . F 3 HOH 214 514 234 HOH HOH A . F 3 HOH 215 515 179 HOH HOH A . F 3 HOH 216 516 173 HOH HOH A . F 3 HOH 217 517 152 HOH HOH A . F 3 HOH 218 518 140 HOH HOH A . F 3 HOH 219 519 141 HOH HOH A . F 3 HOH 220 520 279 HOH HOH A . F 3 HOH 221 521 280 HOH HOH A . F 3 HOH 222 522 241 HOH HOH A . F 3 HOH 223 523 45 HOH HOH A . F 3 HOH 224 524 125 HOH HOH A . F 3 HOH 225 525 62 HOH HOH A . F 3 HOH 226 526 247 HOH HOH A . F 3 HOH 227 527 94 HOH HOH A . F 3 HOH 228 528 161 HOH HOH A . F 3 HOH 229 529 108 HOH HOH A . F 3 HOH 230 530 255 HOH HOH A . F 3 HOH 231 531 225 HOH HOH A . F 3 HOH 232 532 259 HOH HOH A . F 3 HOH 233 533 180 HOH HOH A . F 3 HOH 234 534 181 HOH HOH A . F 3 HOH 235 535 215 HOH HOH A . F 3 HOH 236 536 285 HOH HOH A . F 3 HOH 237 537 258 HOH HOH A . F 3 HOH 238 538 273 HOH HOH A . F 3 HOH 239 539 117 HOH HOH A . F 3 HOH 240 540 189 HOH HOH A . F 3 HOH 241 541 151 HOH HOH A . F 3 HOH 242 542 249 HOH HOH A . F 3 HOH 243 543 137 HOH HOH A . F 3 HOH 244 544 192 HOH HOH A . F 3 HOH 245 545 177 HOH HOH A . F 3 HOH 246 546 174 HOH HOH A . F 3 HOH 247 547 288 HOH HOH A . F 3 HOH 248 548 69 HOH HOH A . F 3 HOH 249 549 219 HOH HOH A . F 3 HOH 250 550 278 HOH HOH A . F 3 HOH 251 551 170 HOH HOH A . F 3 HOH 252 552 299 HOH HOH A . F 3 HOH 253 553 256 HOH HOH A . F 3 HOH 254 554 85 HOH HOH A . F 3 HOH 255 555 274 HOH HOH A . F 3 HOH 256 556 296 HOH HOH A . F 3 HOH 257 557 216 HOH HOH A . F 3 HOH 258 558 186 HOH HOH A . F 3 HOH 259 559 298 HOH HOH A . F 3 HOH 260 560 283 HOH HOH A . F 3 HOH 261 561 236 HOH HOH A . F 3 HOH 262 562 126 HOH HOH A . F 3 HOH 263 563 246 HOH HOH A . F 3 HOH 264 564 95 HOH HOH A . F 3 HOH 265 565 202 HOH HOH A . F 3 HOH 266 566 268 HOH HOH A . F 3 HOH 267 567 81 HOH HOH A . F 3 HOH 268 568 264 HOH HOH A . F 3 HOH 269 569 224 HOH HOH A . F 3 HOH 270 570 290 HOH HOH A . F 3 HOH 271 571 292 HOH HOH A . F 3 HOH 272 572 79 HOH HOH A . F 3 HOH 273 573 261 HOH HOH A . F 3 HOH 274 574 251 HOH HOH A . F 3 HOH 275 575 226 HOH HOH A . F 3 HOH 276 576 122 HOH HOH A . F 3 HOH 277 577 188 HOH HOH A . F 3 HOH 278 578 187 HOH HOH A . F 3 HOH 279 579 289 HOH HOH A . F 3 HOH 280 580 159 HOH HOH A . F 3 HOH 281 581 163 HOH HOH A . F 3 HOH 282 582 233 HOH HOH A . F 3 HOH 283 583 287 HOH HOH A . F 3 HOH 284 584 194 HOH HOH A . F 3 HOH 285 585 148 HOH HOH A . F 3 HOH 286 586 172 HOH HOH A . F 3 HOH 287 587 164 HOH HOH A . F 3 HOH 288 588 282 HOH HOH A . F 3 HOH 289 589 263 HOH HOH A . F 3 HOH 290 590 142 HOH HOH A . F 3 HOH 291 591 203 HOH HOH A . F 3 HOH 292 592 129 HOH HOH A . F 3 HOH 293 593 275 HOH HOH A . F 3 HOH 294 594 281 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 730 ? 1 MORE 11 ? 1 'SSA (A^2)' 8800 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-25 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 6IGH _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASN 39 ? B O A HOH 302 ? ? 1.94 2 1 OE1 A GLU 36 ? A O A HOH 303 ? ? 2.03 3 1 OE1 A GLU 55 ? A O A HOH 304 ? ? 2.07 4 1 OE1 A GLU 36 ? A O A HOH 305 ? ? 2.07 5 1 O A HOH 412 ? ? O A HOH 510 ? ? 2.08 6 1 O A HOH 490 ? ? O A HOH 508 ? ? 2.14 7 1 O A HOH 469 ? ? O A HOH 588 ? ? 2.15 8 1 O A HOH 427 ? ? O A HOH 520 ? ? 2.18 9 1 O A HOH 306 ? ? O A HOH 407 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 520 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 566 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_454 _pdbx_validate_symm_contact.dist 1.98 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 145 ? ? CZ A ARG 145 ? ? NH1 A ARG 145 ? ? 125.49 120.30 5.19 0.50 N 2 1 NE A ARG 145 ? ? CZ A ARG 145 ? ? NH2 A ARG 145 ? ? 115.25 120.30 -5.05 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 38 ? A -142.86 -85.98 2 1 ASN A 39 ? B -2.45 61.77 3 1 ASP A 73 ? ? -108.34 44.02 4 1 THR A 96 ? ? 77.42 -2.38 5 1 THR A 97 ? ? -104.04 -124.52 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id VAL _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 37 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle 10.40 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 591 ? 5.81 . 2 1 O ? A HOH 592 ? 6.02 . 3 1 O ? A HOH 593 ? 6.10 . 4 1 O ? A HOH 594 ? 6.68 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 35 ? CG ? A ARG 38 CG 2 1 Y 1 A ARG 35 ? CD ? A ARG 38 CD 3 1 Y 1 A ARG 35 ? NE ? A ARG 38 NE 4 1 Y 1 A ARG 35 ? CZ ? A ARG 38 CZ 5 1 Y 1 A ARG 35 ? NH1 ? A ARG 38 NH1 6 1 Y 1 A ARG 35 ? NH2 ? A ARG 38 NH2 7 1 Y 1 A ARG 166 ? NE ? A ARG 169 NE 8 1 Y 1 A ARG 166 ? CZ ? A ARG 169 CZ 9 1 Y 1 A ARG 166 ? NH1 ? A ARG 169 NH1 10 1 Y 1 A ARG 166 ? NH2 ? A ARG 169 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE -2 ? A ILE 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A SER 168 ? A SER 171 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TRP N N N N 331 TRP CA C N S 332 TRP C C N N 333 TRP O O N N 334 TRP CB C N N 335 TRP CG C Y N 336 TRP CD1 C Y N 337 TRP CD2 C Y N 338 TRP NE1 N Y N 339 TRP CE2 C Y N 340 TRP CE3 C Y N 341 TRP CZ2 C Y N 342 TRP CZ3 C Y N 343 TRP CH2 C Y N 344 TRP OXT O N N 345 TRP H H N N 346 TRP H2 H N N 347 TRP HA H N N 348 TRP HB2 H N N 349 TRP HB3 H N N 350 TRP HD1 H N N 351 TRP HE1 H N N 352 TRP HE3 H N N 353 TRP HZ2 H N N 354 TRP HZ3 H N N 355 TRP HH2 H N N 356 TRP HXT H N N 357 TYR N N N N 358 TYR CA C N S 359 TYR C C N N 360 TYR O O N N 361 TYR CB C N N 362 TYR CG C Y N 363 TYR CD1 C Y N 364 TYR CD2 C Y N 365 TYR CE1 C Y N 366 TYR CE2 C Y N 367 TYR CZ C Y N 368 TYR OH O N N 369 TYR OXT O N N 370 TYR H H N N 371 TYR H2 H N N 372 TYR HA H N N 373 TYR HB2 H N N 374 TYR HB3 H N N 375 TYR HD1 H N N 376 TYR HD2 H N N 377 TYR HE1 H N N 378 TYR HE2 H N N 379 TYR HH H N N 380 TYR HXT H N N 381 VAL N N N N 382 VAL CA C N S 383 VAL C C N N 384 VAL O O N N 385 VAL CB C N N 386 VAL CG1 C N N 387 VAL CG2 C N N 388 VAL OXT O N N 389 VAL H H N N 390 VAL H2 H N N 391 VAL HA H N N 392 VAL HB H N N 393 VAL HG11 H N N 394 VAL HG12 H N N 395 VAL HG13 H N N 396 VAL HG21 H N N 397 VAL HG22 H N N 398 VAL HG23 H N N 399 VAL HXT H N N 400 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id EDO _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id EDO _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1WKP _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #