data_6IYZ # _entry.id 6IYZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6IYZ pdb_00006iyz 10.2210/pdb6iyz/pdb WWPDB D_1300010190 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6IYZ _pdbx_database_status.recvd_initial_deposition_date 2018-12-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, X.H.' 1 ? 'Zeng, Y.' 2 ? 'Qin, L.' 3 ? 'Gao, F.' 4 ? 'Su, M.' 5 ? 'Chen, Y.H.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 116 _citation.language ? _citation.page_first 4238 _citation.page_last 4243 _citation.title 'Structural basis for activity of TRIC counter-ion channels in calcium release.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1817271116 _citation.pdbx_database_id_PubMed 30770441 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, X.H.' 1 ? primary 'Su, M.' 2 ? primary 'Gao, F.' 3 ? primary 'Xie, W.' 4 ? primary 'Zeng, Y.' 5 ? primary 'Li, D.L.' 6 ? primary 'Liu, X.L.' 7 ? primary 'Zhao, H.' 8 ? primary 'Qin, L.' 9 ? primary 'Li, F.' 10 ? primary 'Liu, Q.' 11 ? primary 'Clarke, O.B.' 12 ? primary 'Lam, S.M.' 13 ? primary 'Shui, G.H.' 14 ? primary 'Hendrickson, W.A.' 15 ? primary 'Chen, Y.H.' 16 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6IYZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 268.210 _cell.length_a_esd ? _cell.length_b 268.210 _cell.length_b_esd ? _cell.length_c 268.210 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6IYZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 210 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Trimeric intracellular cation channel type A' 36957.551 1 ? C245S ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 3 water nat water 18.015 13 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TRICA,Transmembrane protein 38A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MELPGALQLGELAAAFASVPVFPLFDAAYFIVSVLYLKYEPGAVEMSRKSPFASWLCAMLHCFGSYILADLLLGESPIHY FSNNSSVILATAVWYLIFFCPMNLFYKCVSFLPVKLIFVAMKEVVRVRKIAAGVHHAHHQYHHGWFIMMATGWVKGSGVA LMSNFEQLLRGVWRPETNEILHMSFPTKASLYGTVLFTLQQTHWLPVSEANLVFFFTMFMIVCKVFMTATHSHASPFAPV EGFISPVFFGSVSSGHTSHHNQHGHSHEASYQPPPPVKSKEELNEGTRKRKAKKAEAAAENLYFQGLEDYKDDDDKHHHH HHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MELPGALQLGELAAAFASVPVFPLFDAAYFIVSVLYLKYEPGAVEMSRKSPFASWLCAMLHCFGSYILADLLLGESPIHY FSNNSSVILATAVWYLIFFCPMNLFYKCVSFLPVKLIFVAMKEVVRVRKIAAGVHHAHHQYHHGWFIMMATGWVKGSGVA LMSNFEQLLRGVWRPETNEILHMSFPTKASLYGTVLFTLQQTHWLPVSEANLVFFFTMFMIVCKVFMTATHSHASPFAPV EGFISPVFFGSVSSGHTSHHNQHGHSHEASYQPPPPVKSKEELNEGTRKRKAKKAEAAAENLYFQGLEDYKDDDDKHHHH HHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LEU n 1 4 PRO n 1 5 GLY n 1 6 ALA n 1 7 LEU n 1 8 GLN n 1 9 LEU n 1 10 GLY n 1 11 GLU n 1 12 LEU n 1 13 ALA n 1 14 ALA n 1 15 ALA n 1 16 PHE n 1 17 ALA n 1 18 SER n 1 19 VAL n 1 20 PRO n 1 21 VAL n 1 22 PHE n 1 23 PRO n 1 24 LEU n 1 25 PHE n 1 26 ASP n 1 27 ALA n 1 28 ALA n 1 29 TYR n 1 30 PHE n 1 31 ILE n 1 32 VAL n 1 33 SER n 1 34 VAL n 1 35 LEU n 1 36 TYR n 1 37 LEU n 1 38 LYS n 1 39 TYR n 1 40 GLU n 1 41 PRO n 1 42 GLY n 1 43 ALA n 1 44 VAL n 1 45 GLU n 1 46 MET n 1 47 SER n 1 48 ARG n 1 49 LYS n 1 50 SER n 1 51 PRO n 1 52 PHE n 1 53 ALA n 1 54 SER n 1 55 TRP n 1 56 LEU n 1 57 CYS n 1 58 ALA n 1 59 MET n 1 60 LEU n 1 61 HIS n 1 62 CYS n 1 63 PHE n 1 64 GLY n 1 65 SER n 1 66 TYR n 1 67 ILE n 1 68 LEU n 1 69 ALA n 1 70 ASP n 1 71 LEU n 1 72 LEU n 1 73 LEU n 1 74 GLY n 1 75 GLU n 1 76 SER n 1 77 PRO n 1 78 ILE n 1 79 HIS n 1 80 TYR n 1 81 PHE n 1 82 SER n 1 83 ASN n 1 84 ASN n 1 85 SER n 1 86 SER n 1 87 VAL n 1 88 ILE n 1 89 LEU n 1 90 ALA n 1 91 THR n 1 92 ALA n 1 93 VAL n 1 94 TRP n 1 95 TYR n 1 96 LEU n 1 97 ILE n 1 98 PHE n 1 99 PHE n 1 100 CYS n 1 101 PRO n 1 102 MET n 1 103 ASN n 1 104 LEU n 1 105 PHE n 1 106 TYR n 1 107 LYS n 1 108 CYS n 1 109 VAL n 1 110 SER n 1 111 PHE n 1 112 LEU n 1 113 PRO n 1 114 VAL n 1 115 LYS n 1 116 LEU n 1 117 ILE n 1 118 PHE n 1 119 VAL n 1 120 ALA n 1 121 MET n 1 122 LYS n 1 123 GLU n 1 124 VAL n 1 125 VAL n 1 126 ARG n 1 127 VAL n 1 128 ARG n 1 129 LYS n 1 130 ILE n 1 131 ALA n 1 132 ALA n 1 133 GLY n 1 134 VAL n 1 135 HIS n 1 136 HIS n 1 137 ALA n 1 138 HIS n 1 139 HIS n 1 140 GLN n 1 141 TYR n 1 142 HIS n 1 143 HIS n 1 144 GLY n 1 145 TRP n 1 146 PHE n 1 147 ILE n 1 148 MET n 1 149 MET n 1 150 ALA n 1 151 THR n 1 152 GLY n 1 153 TRP n 1 154 VAL n 1 155 LYS n 1 156 GLY n 1 157 SER n 1 158 GLY n 1 159 VAL n 1 160 ALA n 1 161 LEU n 1 162 MET n 1 163 SER n 1 164 ASN n 1 165 PHE n 1 166 GLU n 1 167 GLN n 1 168 LEU n 1 169 LEU n 1 170 ARG n 1 171 GLY n 1 172 VAL n 1 173 TRP n 1 174 ARG n 1 175 PRO n 1 176 GLU n 1 177 THR n 1 178 ASN n 1 179 GLU n 1 180 ILE n 1 181 LEU n 1 182 HIS n 1 183 MET n 1 184 SER n 1 185 PHE n 1 186 PRO n 1 187 THR n 1 188 LYS n 1 189 ALA n 1 190 SER n 1 191 LEU n 1 192 TYR n 1 193 GLY n 1 194 THR n 1 195 VAL n 1 196 LEU n 1 197 PHE n 1 198 THR n 1 199 LEU n 1 200 GLN n 1 201 GLN n 1 202 THR n 1 203 HIS n 1 204 TRP n 1 205 LEU n 1 206 PRO n 1 207 VAL n 1 208 SER n 1 209 GLU n 1 210 ALA n 1 211 ASN n 1 212 LEU n 1 213 VAL n 1 214 PHE n 1 215 PHE n 1 216 PHE n 1 217 THR n 1 218 MET n 1 219 PHE n 1 220 MET n 1 221 ILE n 1 222 VAL n 1 223 CYS n 1 224 LYS n 1 225 VAL n 1 226 PHE n 1 227 MET n 1 228 THR n 1 229 ALA n 1 230 THR n 1 231 HIS n 1 232 SER n 1 233 HIS n 1 234 ALA n 1 235 SER n 1 236 PRO n 1 237 PHE n 1 238 ALA n 1 239 PRO n 1 240 VAL n 1 241 GLU n 1 242 GLY n 1 243 PHE n 1 244 ILE n 1 245 SER n 1 246 PRO n 1 247 VAL n 1 248 PHE n 1 249 PHE n 1 250 GLY n 1 251 SER n 1 252 VAL n 1 253 SER n 1 254 SER n 1 255 GLY n 1 256 HIS n 1 257 THR n 1 258 SER n 1 259 HIS n 1 260 HIS n 1 261 ASN n 1 262 GLN n 1 263 HIS n 1 264 GLY n 1 265 HIS n 1 266 SER n 1 267 HIS n 1 268 GLU n 1 269 ALA n 1 270 SER n 1 271 TYR n 1 272 GLN n 1 273 PRO n 1 274 PRO n 1 275 PRO n 1 276 PRO n 1 277 VAL n 1 278 LYS n 1 279 SER n 1 280 LYS n 1 281 GLU n 1 282 GLU n 1 283 LEU n 1 284 ASN n 1 285 GLU n 1 286 GLY n 1 287 THR n 1 288 ARG n 1 289 LYS n 1 290 ARG n 1 291 LYS n 1 292 ALA n 1 293 LYS n 1 294 LYS n 1 295 ALA n 1 296 GLU n 1 297 ALA n 1 298 ALA n 1 299 ALA n 1 300 GLU n 1 301 ASN n 1 302 LEU n 1 303 TYR n 1 304 PHE n 1 305 GLN n 1 306 GLY n 1 307 LEU n 1 308 GLU n 1 309 ASP n 1 310 TYR n 1 311 LYS n 1 312 ASP n 1 313 ASP n 1 314 ASP n 1 315 ASP n 1 316 LYS n 1 317 HIS n 1 318 HIS n 1 319 HIS n 1 320 HIS n 1 321 HIS n 1 322 HIS n 1 323 HIS n 1 324 HIS n 1 325 HIS n 1 326 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 326 _entity_src_gen.gene_src_common_name Chicken _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TMEM38A, RCJMB04_13f15' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name Schizosaccharomyces _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4895 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TM38A_CHICK _struct_ref.pdbx_db_accession Q5ZK43 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MELPGALQLGELAAAFASVPVFPLFDAAYFIVSVLYLKYEPGAVEMSRKSPFASWLCAMLHCFGSYILADLLLGESPIHY FSNNSSVILATAVWYLIFFCPMNLFYKCVSFLPVKLIFVAMKEVVRVRKIAAGVHHAHHQYHHGWFIMMATGWVKGSGVA LMSNFEQLLRGVWRPETNEILHMSFPTKASLYGTVLFTLQQTHWLPVSEANLVFFFTMFMIVCKVFMTATHSHASPFAPV EGFICPVFFGSVSSGHTSHHNQHGHSHEASYQPPPPVKSKEELNEGTRKRKAKKAE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6IYZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 296 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5ZK43 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 296 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 296 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6IYZ SER A 245 ? UNP Q5ZK43 CYS 245 'engineered mutation' 245 1 1 6IYZ ALA A 297 ? UNP Q5ZK43 ? ? 'expression tag' 297 2 1 6IYZ ALA A 298 ? UNP Q5ZK43 ? ? 'expression tag' 298 3 1 6IYZ ALA A 299 ? UNP Q5ZK43 ? ? 'expression tag' 299 4 1 6IYZ GLU A 300 ? UNP Q5ZK43 ? ? 'expression tag' 300 5 1 6IYZ ASN A 301 ? UNP Q5ZK43 ? ? 'expression tag' 301 6 1 6IYZ LEU A 302 ? UNP Q5ZK43 ? ? 'expression tag' 302 7 1 6IYZ TYR A 303 ? UNP Q5ZK43 ? ? 'expression tag' 303 8 1 6IYZ PHE A 304 ? UNP Q5ZK43 ? ? 'expression tag' 304 9 1 6IYZ GLN A 305 ? UNP Q5ZK43 ? ? 'expression tag' 305 10 1 6IYZ GLY A 306 ? UNP Q5ZK43 ? ? 'expression tag' 306 11 1 6IYZ LEU A 307 ? UNP Q5ZK43 ? ? 'expression tag' 307 12 1 6IYZ GLU A 308 ? UNP Q5ZK43 ? ? 'expression tag' 308 13 1 6IYZ ASP A 309 ? UNP Q5ZK43 ? ? 'expression tag' 309 14 1 6IYZ TYR A 310 ? UNP Q5ZK43 ? ? 'expression tag' 310 15 1 6IYZ LYS A 311 ? UNP Q5ZK43 ? ? 'expression tag' 311 16 1 6IYZ ASP A 312 ? UNP Q5ZK43 ? ? 'expression tag' 312 17 1 6IYZ ASP A 313 ? UNP Q5ZK43 ? ? 'expression tag' 313 18 1 6IYZ ASP A 314 ? UNP Q5ZK43 ? ? 'expression tag' 314 19 1 6IYZ ASP A 315 ? UNP Q5ZK43 ? ? 'expression tag' 315 20 1 6IYZ LYS A 316 ? UNP Q5ZK43 ? ? 'expression tag' 316 21 1 6IYZ HIS A 317 ? UNP Q5ZK43 ? ? 'expression tag' 317 22 1 6IYZ HIS A 318 ? UNP Q5ZK43 ? ? 'expression tag' 318 23 1 6IYZ HIS A 319 ? UNP Q5ZK43 ? ? 'expression tag' 319 24 1 6IYZ HIS A 320 ? UNP Q5ZK43 ? ? 'expression tag' 320 25 1 6IYZ HIS A 321 ? UNP Q5ZK43 ? ? 'expression tag' 321 26 1 6IYZ HIS A 322 ? UNP Q5ZK43 ? ? 'expression tag' 322 27 1 6IYZ HIS A 323 ? UNP Q5ZK43 ? ? 'expression tag' 323 28 1 6IYZ HIS A 324 ? UNP Q5ZK43 ? ? 'expression tag' 324 29 1 6IYZ HIS A 325 ? UNP Q5ZK43 ? ? 'expression tag' 325 30 1 6IYZ HIS A 326 ? UNP Q5ZK43 ? ? 'expression tag' 326 31 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6IYZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.44 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 77.38 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 278 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'NaH2PO4, K2HPO4, phosphate-citrate pH 4.2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 300K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-01-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9785 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9785 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6IYZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 47.410 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 42420 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 147.200 _reflns.pdbx_Rmerge_I_obs 0.392 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 5 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.394 _reflns.pdbx_Rpim_I_all 0.032 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 6242648 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.200 2.270 ? ? 544171 ? ? ? 3608 99.800 ? ? ? ? 18.658 ? ? ? ? ? ? ? ? 150.800 ? ? ? 1.100 18.721 1.516 ? 1 1 0.465 ? 9.070 47.410 ? ? 80149 ? ? ? 733 99.400 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 109.300 ? ? ? 107.000 0.066 0.006 ? 2 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 137.890 _refine.B_iso_mean 60.6597 _refine.B_iso_min 33.020 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6IYZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2000 _refine.ls_d_res_low 47.4130 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 42368 _refine.ls_number_reflns_R_free 2199 _refine.ls_number_reflns_R_work 40169 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9700 _refine.ls_percent_reflns_R_free 5.1900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2522 _refine.ls_R_factor_R_free 0.2742 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2509 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6IYU _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.4100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.2000 _refine_hist.d_res_low 47.4130 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1811 _refine_hist.pdbx_number_residues_total 225 _refine_hist.pdbx_B_iso_mean_ligand 84.58 _refine_hist.pdbx_B_iso_mean_solvent 53.01 _refine_hist.pdbx_number_atoms_protein 1796 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1996 2.2475 2613 . 113 2500 100.0000 . . . 0.3965 0.0000 0.3686 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 2.2475 2.2997 2577 . 139 2438 100.0000 . . . 0.3276 0.0000 0.3252 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 2.2997 2.3572 2594 . 143 2451 100.0000 . . . 0.3648 0.0000 0.3100 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 2.3572 2.4210 2611 . 133 2478 100.0000 . . . 0.3252 0.0000 0.2980 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 2.4210 2.4922 2586 . 136 2450 100.0000 . . . 0.2791 0.0000 0.2932 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 2.4922 2.5726 2605 . 126 2479 100.0000 . . . 0.2831 0.0000 0.2886 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 2.5726 2.6646 2618 . 126 2492 100.0000 . . . 0.3210 0.0000 0.2766 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 2.6646 2.7713 2620 . 135 2485 100.0000 . . . 0.3106 0.0000 0.2691 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 2.7713 2.8974 2616 . 134 2482 100.0000 . . . 0.2675 0.0000 0.2471 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 2.8974 3.0501 2633 . 126 2507 100.0000 . . . 0.2248 0.0000 0.2410 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 3.0501 3.2412 2648 . 151 2497 100.0000 . . . 0.2770 0.0000 0.2554 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 3.2412 3.4913 2640 . 139 2501 100.0000 . . . 0.2679 0.0000 0.2341 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 3.4913 3.8425 2667 . 133 2534 100.0000 . . . 0.2428 0.0000 0.2256 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 3.8425 4.3982 2694 . 137 2557 100.0000 . . . 0.2254 0.0000 0.2162 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 4.3982 5.5399 2728 . 152 2576 100.0000 . . . 0.2647 0.0000 0.2276 . . . . . . 16 . . . 'X-RAY DIFFRACTION' 5.5399 47.4243 2918 . 176 2742 100.0000 . . . 0.3032 0.0000 0.2760 . . . . . . 16 . . . # _struct.entry_id 6IYZ _struct.title 'Structural basis for activity of TRIC counter-ion channels in calcium release' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6IYZ _struct_keywords.text 'TRIC, cation channel, membrane protein' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 10 ? ALA A 17 ? GLY A 10 ALA A 17 1 ? 8 HELX_P HELX_P2 AA2 PRO A 23 ? TYR A 39 ? PRO A 23 TYR A 39 1 ? 17 HELX_P HELX_P3 AA3 GLY A 42 ? SER A 50 ? GLY A 42 SER A 50 1 ? 9 HELX_P HELX_P4 AA4 SER A 50 ? GLY A 74 ? SER A 50 GLY A 74 1 ? 25 HELX_P HELX_P5 AA5 ILE A 78 ? SER A 82 ? ILE A 78 SER A 82 5 ? 5 HELX_P HELX_P6 AA6 ASN A 83 ? PHE A 99 ? ASN A 83 PHE A 99 1 ? 17 HELX_P HELX_P7 AA7 LEU A 104 ? PHE A 111 ? LEU A 104 PHE A 111 1 ? 8 HELX_P HELX_P8 AA8 PHE A 111 ? TYR A 141 ? PHE A 111 TYR A 141 1 ? 31 HELX_P HELX_P9 AA9 GLY A 144 ? GLY A 158 ? GLY A 144 GLY A 158 1 ? 15 HELX_P HELX_P10 AB1 VAL A 159 ? LEU A 161 ? VAL A 159 LEU A 161 5 ? 3 HELX_P HELX_P11 AB2 MET A 162 ? ARG A 170 ? MET A 162 ARG A 170 1 ? 9 HELX_P HELX_P12 AB3 SER A 184 ? THR A 202 ? SER A 184 THR A 202 1 ? 19 HELX_P HELX_P13 AB4 SER A 208 ? SER A 232 ? SER A 208 SER A 232 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 22 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 22 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 23 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 23 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.06 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 401 ? 2 'binding site for residue CL A 401' AC2 Software A CL 402 ? 1 'binding site for residue CL A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 TYR A 106 ? TYR A 106 . ? 1_555 ? 2 AC1 2 TYR A 106 ? TYR A 106 . ? 26_555 ? 3 AC2 1 HIS A 142 ? HIS A 142 . ? 72_454 ? # _atom_sites.entry_id 6IYZ _atom_sites.fract_transf_matrix[1][1] 0.003728 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.003728 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003728 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL K N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 GLN 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 CYS 100 100 100 CYS CYS A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 TRP 145 145 145 TRP TRP A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 MET 148 148 148 MET MET A . n A 1 149 MET 149 149 149 MET MET A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 TRP 153 153 153 TRP TRP A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 MET 162 162 162 MET MET A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 TRP 173 173 173 TRP TRP A . n A 1 174 ARG 174 174 174 ARG ARG A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 TYR 192 192 192 TYR TYR A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 PHE 197 197 197 PHE PHE A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 GLN 200 200 200 GLN GLN A . n A 1 201 GLN 201 201 201 GLN GLN A . n A 1 202 THR 202 202 202 THR THR A . n A 1 203 HIS 203 203 203 HIS HIS A . n A 1 204 TRP 204 204 204 TRP TRP A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 GLU 209 209 209 GLU GLU A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 PHE 214 214 214 PHE PHE A . n A 1 215 PHE 215 215 215 PHE PHE A . n A 1 216 PHE 216 216 216 PHE PHE A . n A 1 217 THR 217 217 217 THR THR A . n A 1 218 MET 218 218 218 MET MET A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 MET 220 220 220 MET MET A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 CYS 223 223 223 CYS CYS A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 PHE 226 226 226 PHE PHE A . n A 1 227 MET 227 227 227 MET MET A . n A 1 228 THR 228 228 228 THR THR A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 HIS 231 231 231 HIS HIS A . n A 1 232 SER 232 232 232 SER SER A . n A 1 233 HIS 233 233 233 HIS HIS A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 SER 235 235 ? ? ? A . n A 1 236 PRO 236 236 ? ? ? A . n A 1 237 PHE 237 237 ? ? ? A . n A 1 238 ALA 238 238 ? ? ? A . n A 1 239 PRO 239 239 ? ? ? A . n A 1 240 VAL 240 240 ? ? ? A . n A 1 241 GLU 241 241 ? ? ? A . n A 1 242 GLY 242 242 ? ? ? A . n A 1 243 PHE 243 243 ? ? ? A . n A 1 244 ILE 244 244 ? ? ? A . n A 1 245 SER 245 245 ? ? ? A . n A 1 246 PRO 246 246 ? ? ? A . n A 1 247 VAL 247 247 ? ? ? A . n A 1 248 PHE 248 248 ? ? ? A . n A 1 249 PHE 249 249 ? ? ? A . n A 1 250 GLY 250 250 ? ? ? A . n A 1 251 SER 251 251 ? ? ? A . n A 1 252 VAL 252 252 ? ? ? A . n A 1 253 SER 253 253 ? ? ? A . n A 1 254 SER 254 254 ? ? ? A . n A 1 255 GLY 255 255 ? ? ? A . n A 1 256 HIS 256 256 ? ? ? A . n A 1 257 THR 257 257 ? ? ? A . n A 1 258 SER 258 258 ? ? ? A . n A 1 259 HIS 259 259 ? ? ? A . n A 1 260 HIS 260 260 ? ? ? A . n A 1 261 ASN 261 261 ? ? ? A . n A 1 262 GLN 262 262 ? ? ? A . n A 1 263 HIS 263 263 ? ? ? A . n A 1 264 GLY 264 264 ? ? ? A . n A 1 265 HIS 265 265 ? ? ? A . n A 1 266 SER 266 266 ? ? ? A . n A 1 267 HIS 267 267 ? ? ? A . n A 1 268 GLU 268 268 ? ? ? A . n A 1 269 ALA 269 269 ? ? ? A . n A 1 270 SER 270 270 ? ? ? A . n A 1 271 TYR 271 271 ? ? ? A . n A 1 272 GLN 272 272 ? ? ? A . n A 1 273 PRO 273 273 ? ? ? A . n A 1 274 PRO 274 274 ? ? ? A . n A 1 275 PRO 275 275 ? ? ? A . n A 1 276 PRO 276 276 ? ? ? A . n A 1 277 VAL 277 277 ? ? ? A . n A 1 278 LYS 278 278 ? ? ? A . n A 1 279 SER 279 279 ? ? ? A . n A 1 280 LYS 280 280 ? ? ? A . n A 1 281 GLU 281 281 ? ? ? A . n A 1 282 GLU 282 282 ? ? ? A . n A 1 283 LEU 283 283 ? ? ? A . n A 1 284 ASN 284 284 ? ? ? A . n A 1 285 GLU 285 285 ? ? ? A . n A 1 286 GLY 286 286 ? ? ? A . n A 1 287 THR 287 287 ? ? ? A . n A 1 288 ARG 288 288 ? ? ? A . n A 1 289 LYS 289 289 ? ? ? A . n A 1 290 ARG 290 290 ? ? ? A . n A 1 291 LYS 291 291 ? ? ? A . n A 1 292 ALA 292 292 ? ? ? A . n A 1 293 LYS 293 293 ? ? ? A . n A 1 294 LYS 294 294 ? ? ? A . n A 1 295 ALA 295 295 ? ? ? A . n A 1 296 GLU 296 296 ? ? ? A . n A 1 297 ALA 297 297 ? ? ? A . n A 1 298 ALA 298 298 ? ? ? A . n A 1 299 ALA 299 299 ? ? ? A . n A 1 300 GLU 300 300 ? ? ? A . n A 1 301 ASN 301 301 ? ? ? A . n A 1 302 LEU 302 302 ? ? ? A . n A 1 303 TYR 303 303 ? ? ? A . n A 1 304 PHE 304 304 ? ? ? A . n A 1 305 GLN 305 305 ? ? ? A . n A 1 306 GLY 306 306 ? ? ? A . n A 1 307 LEU 307 307 ? ? ? A . n A 1 308 GLU 308 308 ? ? ? A . n A 1 309 ASP 309 309 ? ? ? A . n A 1 310 TYR 310 310 ? ? ? A . n A 1 311 LYS 311 311 ? ? ? A . n A 1 312 ASP 312 312 ? ? ? A . n A 1 313 ASP 313 313 ? ? ? A . n A 1 314 ASP 314 314 ? ? ? A . n A 1 315 ASP 315 315 ? ? ? A . n A 1 316 LYS 316 316 ? ? ? A . n A 1 317 HIS 317 317 ? ? ? A . n A 1 318 HIS 318 318 ? ? ? A . n A 1 319 HIS 319 319 ? ? ? A . n A 1 320 HIS 320 320 ? ? ? A . n A 1 321 HIS 321 321 ? ? ? A . n A 1 322 HIS 322 322 ? ? ? A . n A 1 323 HIS 323 323 ? ? ? A . n A 1 324 HIS 324 324 ? ? ? A . n A 1 325 HIS 325 325 ? ? ? A . n A 1 326 HIS 326 326 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 401 1 CL CL A . C 2 CL 1 402 2 CL CL A . D 3 HOH 1 501 1 HOH HOH A . D 3 HOH 2 502 12 HOH HOH A . D 3 HOH 3 503 15 HOH HOH A . D 3 HOH 4 504 13 HOH HOH A . D 3 HOH 5 505 10 HOH HOH A . D 3 HOH 6 506 6 HOH HOH A . D 3 HOH 7 507 5 HOH HOH A . D 3 HOH 8 508 8 HOH HOH A . D 3 HOH 9 509 11 HOH HOH A . D 3 HOH 10 510 7 HOH HOH A . D 3 HOH 11 511 4 HOH HOH A . D 3 HOH 12 512 14 HOH HOH A . D 3 HOH 13 513 3 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5650 ? 1 MORE -67 ? 1 'SSA (A^2)' 30620 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 36_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 54_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CL 401 ? B CL . 2 1 A HOH 502 ? D HOH . 3 1 A HOH 512 ? D HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-01 2 'Structure model' 1 1 2019-11-06 3 'Structure model' 1 2 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14rc2_3191 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.29 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 233 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 56.78 _pdbx_validate_torsion.psi 78.38 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 11 ? CG ? A GLU 11 CG 2 1 Y 1 A GLU 11 ? CD ? A GLU 11 CD 3 1 Y 1 A GLU 11 ? OE1 ? A GLU 11 OE1 4 1 Y 1 A GLU 11 ? OE2 ? A GLU 11 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A GLN 8 ? A GLN 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A SER 235 ? A SER 235 11 1 Y 1 A PRO 236 ? A PRO 236 12 1 Y 1 A PHE 237 ? A PHE 237 13 1 Y 1 A ALA 238 ? A ALA 238 14 1 Y 1 A PRO 239 ? A PRO 239 15 1 Y 1 A VAL 240 ? A VAL 240 16 1 Y 1 A GLU 241 ? A GLU 241 17 1 Y 1 A GLY 242 ? A GLY 242 18 1 Y 1 A PHE 243 ? A PHE 243 19 1 Y 1 A ILE 244 ? A ILE 244 20 1 Y 1 A SER 245 ? A SER 245 21 1 Y 1 A PRO 246 ? A PRO 246 22 1 Y 1 A VAL 247 ? A VAL 247 23 1 Y 1 A PHE 248 ? A PHE 248 24 1 Y 1 A PHE 249 ? A PHE 249 25 1 Y 1 A GLY 250 ? A GLY 250 26 1 Y 1 A SER 251 ? A SER 251 27 1 Y 1 A VAL 252 ? A VAL 252 28 1 Y 1 A SER 253 ? A SER 253 29 1 Y 1 A SER 254 ? A SER 254 30 1 Y 1 A GLY 255 ? A GLY 255 31 1 Y 1 A HIS 256 ? A HIS 256 32 1 Y 1 A THR 257 ? A THR 257 33 1 Y 1 A SER 258 ? A SER 258 34 1 Y 1 A HIS 259 ? A HIS 259 35 1 Y 1 A HIS 260 ? A HIS 260 36 1 Y 1 A ASN 261 ? A ASN 261 37 1 Y 1 A GLN 262 ? A GLN 262 38 1 Y 1 A HIS 263 ? A HIS 263 39 1 Y 1 A GLY 264 ? A GLY 264 40 1 Y 1 A HIS 265 ? A HIS 265 41 1 Y 1 A SER 266 ? A SER 266 42 1 Y 1 A HIS 267 ? A HIS 267 43 1 Y 1 A GLU 268 ? A GLU 268 44 1 Y 1 A ALA 269 ? A ALA 269 45 1 Y 1 A SER 270 ? A SER 270 46 1 Y 1 A TYR 271 ? A TYR 271 47 1 Y 1 A GLN 272 ? A GLN 272 48 1 Y 1 A PRO 273 ? A PRO 273 49 1 Y 1 A PRO 274 ? A PRO 274 50 1 Y 1 A PRO 275 ? A PRO 275 51 1 Y 1 A PRO 276 ? A PRO 276 52 1 Y 1 A VAL 277 ? A VAL 277 53 1 Y 1 A LYS 278 ? A LYS 278 54 1 Y 1 A SER 279 ? A SER 279 55 1 Y 1 A LYS 280 ? A LYS 280 56 1 Y 1 A GLU 281 ? A GLU 281 57 1 Y 1 A GLU 282 ? A GLU 282 58 1 Y 1 A LEU 283 ? A LEU 283 59 1 Y 1 A ASN 284 ? A ASN 284 60 1 Y 1 A GLU 285 ? A GLU 285 61 1 Y 1 A GLY 286 ? A GLY 286 62 1 Y 1 A THR 287 ? A THR 287 63 1 Y 1 A ARG 288 ? A ARG 288 64 1 Y 1 A LYS 289 ? A LYS 289 65 1 Y 1 A ARG 290 ? A ARG 290 66 1 Y 1 A LYS 291 ? A LYS 291 67 1 Y 1 A ALA 292 ? A ALA 292 68 1 Y 1 A LYS 293 ? A LYS 293 69 1 Y 1 A LYS 294 ? A LYS 294 70 1 Y 1 A ALA 295 ? A ALA 295 71 1 Y 1 A GLU 296 ? A GLU 296 72 1 Y 1 A ALA 297 ? A ALA 297 73 1 Y 1 A ALA 298 ? A ALA 298 74 1 Y 1 A ALA 299 ? A ALA 299 75 1 Y 1 A GLU 300 ? A GLU 300 76 1 Y 1 A ASN 301 ? A ASN 301 77 1 Y 1 A LEU 302 ? A LEU 302 78 1 Y 1 A TYR 303 ? A TYR 303 79 1 Y 1 A PHE 304 ? A PHE 304 80 1 Y 1 A GLN 305 ? A GLN 305 81 1 Y 1 A GLY 306 ? A GLY 306 82 1 Y 1 A LEU 307 ? A LEU 307 83 1 Y 1 A GLU 308 ? A GLU 308 84 1 Y 1 A ASP 309 ? A ASP 309 85 1 Y 1 A TYR 310 ? A TYR 310 86 1 Y 1 A LYS 311 ? A LYS 311 87 1 Y 1 A ASP 312 ? A ASP 312 88 1 Y 1 A ASP 313 ? A ASP 313 89 1 Y 1 A ASP 314 ? A ASP 314 90 1 Y 1 A ASP 315 ? A ASP 315 91 1 Y 1 A LYS 316 ? A LYS 316 92 1 Y 1 A HIS 317 ? A HIS 317 93 1 Y 1 A HIS 318 ? A HIS 318 94 1 Y 1 A HIS 319 ? A HIS 319 95 1 Y 1 A HIS 320 ? A HIS 320 96 1 Y 1 A HIS 321 ? A HIS 321 97 1 Y 1 A HIS 322 ? A HIS 322 98 1 Y 1 A HIS 323 ? A HIS 323 99 1 Y 1 A HIS 324 ? A HIS 324 100 1 Y 1 A HIS 325 ? A HIS 325 101 1 Y 1 A HIS 326 ? A HIS 326 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Science and Technology (China)' China 2016YFA0500503 1 'Ministry of Science and Technology (China)' China 2015CB910102 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6IYU _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support cross-linking _pdbx_struct_assembly_auth_evidence.details ? #