data_6J4M # _entry.id 6J4M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6J4M pdb_00006j4m 10.2210/pdb6j4m/pdb WWPDB D_1300010462 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6J4M _pdbx_database_status.recvd_initial_deposition_date 2019-01-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, X.' 1 ? 'Zang, J.' 2 ? 'Chen, H.' 3 ? 'Zhou, K.' 4 ? 'Zhao, G.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Rsc Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2046-2069 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 24777 _citation.page_last 24782 _citation.title 'Thermostability of protein nanocages: the effect of natural extra peptide on the exterior surface.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/c9ra04785 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, X.' 1 ? primary 'Zang, J.' 2 ? primary 'Chen, H.' 3 ? primary 'Zhou, K.' 4 ? primary 'Zhang, T.' 5 ? primary 'Lv, C.' 6 ? primary 'Zhao, G.' 7 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6J4M _cell.details ? _cell.formula_units_Z ? _cell.length_a 149.902 _cell.length_a_esd ? _cell.length_b 149.902 _cell.length_b_esd ? _cell.length_c 149.902 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 48 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6J4M _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Ferritin 23865.697 2 1.16.3.1 E155D 'UNP residues 49-257' ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 7 ? ? ? ? 3 water nat water 18.015 81 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ASNAPAPLAGVIFEPFQELKKDYLAVPIAHNVSLARQNYADDSESAINEQINVEYNVSYVYHALFAYFDRDNIALKGLAK FFKESSEEEREHAEQLIKYQNIRGGRVVLHPITSPPSEFEHSEKGDALYAMELALSLEKLTNEKLLHVHSVADRNNDPQL ADFIESEFLYEQVKSIKKIAEYVAQLRLVGKGHGVWHFDQKLLHDEDHV ; _entity_poly.pdbx_seq_one_letter_code_can ;ASNAPAPLAGVIFEPFQELKKDYLAVPIAHNVSLARQNYADDSESAINEQINVEYNVSYVYHALFAYFDRDNIALKGLAK FFKESSEEEREHAEQLIKYQNIRGGRVVLHPITSPPSEFEHSEKGDALYAMELALSLEKLTNEKLLHVHSVADRNNDPQL ADFIESEFLYEQVKSIKKIAEYVAQLRLVGKGHGVWHFDQKLLHDEDHV ; _entity_poly.pdbx_strand_id H,A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 ASN n 1 4 ALA n 1 5 PRO n 1 6 ALA n 1 7 PRO n 1 8 LEU n 1 9 ALA n 1 10 GLY n 1 11 VAL n 1 12 ILE n 1 13 PHE n 1 14 GLU n 1 15 PRO n 1 16 PHE n 1 17 GLN n 1 18 GLU n 1 19 LEU n 1 20 LYS n 1 21 LYS n 1 22 ASP n 1 23 TYR n 1 24 LEU n 1 25 ALA n 1 26 VAL n 1 27 PRO n 1 28 ILE n 1 29 ALA n 1 30 HIS n 1 31 ASN n 1 32 VAL n 1 33 SER n 1 34 LEU n 1 35 ALA n 1 36 ARG n 1 37 GLN n 1 38 ASN n 1 39 TYR n 1 40 ALA n 1 41 ASP n 1 42 ASP n 1 43 SER n 1 44 GLU n 1 45 SER n 1 46 ALA n 1 47 ILE n 1 48 ASN n 1 49 GLU n 1 50 GLN n 1 51 ILE n 1 52 ASN n 1 53 VAL n 1 54 GLU n 1 55 TYR n 1 56 ASN n 1 57 VAL n 1 58 SER n 1 59 TYR n 1 60 VAL n 1 61 TYR n 1 62 HIS n 1 63 ALA n 1 64 LEU n 1 65 PHE n 1 66 ALA n 1 67 TYR n 1 68 PHE n 1 69 ASP n 1 70 ARG n 1 71 ASP n 1 72 ASN n 1 73 ILE n 1 74 ALA n 1 75 LEU n 1 76 LYS n 1 77 GLY n 1 78 LEU n 1 79 ALA n 1 80 LYS n 1 81 PHE n 1 82 PHE n 1 83 LYS n 1 84 GLU n 1 85 SER n 1 86 SER n 1 87 GLU n 1 88 GLU n 1 89 GLU n 1 90 ARG n 1 91 GLU n 1 92 HIS n 1 93 ALA n 1 94 GLU n 1 95 GLN n 1 96 LEU n 1 97 ILE n 1 98 LYS n 1 99 TYR n 1 100 GLN n 1 101 ASN n 1 102 ILE n 1 103 ARG n 1 104 GLY n 1 105 GLY n 1 106 ARG n 1 107 VAL n 1 108 VAL n 1 109 LEU n 1 110 HIS n 1 111 PRO n 1 112 ILE n 1 113 THR n 1 114 SER n 1 115 PRO n 1 116 PRO n 1 117 SER n 1 118 GLU n 1 119 PHE n 1 120 GLU n 1 121 HIS n 1 122 SER n 1 123 GLU n 1 124 LYS n 1 125 GLY n 1 126 ASP n 1 127 ALA n 1 128 LEU n 1 129 TYR n 1 130 ALA n 1 131 MET n 1 132 GLU n 1 133 LEU n 1 134 ALA n 1 135 LEU n 1 136 SER n 1 137 LEU n 1 138 GLU n 1 139 LYS n 1 140 LEU n 1 141 THR n 1 142 ASN n 1 143 GLU n 1 144 LYS n 1 145 LEU n 1 146 LEU n 1 147 HIS n 1 148 VAL n 1 149 HIS n 1 150 SER n 1 151 VAL n 1 152 ALA n 1 153 ASP n 1 154 ARG n 1 155 ASN n 1 156 ASN n 1 157 ASP n 1 158 PRO n 1 159 GLN n 1 160 LEU n 1 161 ALA n 1 162 ASP n 1 163 PHE n 1 164 ILE n 1 165 GLU n 1 166 SER n 1 167 GLU n 1 168 PHE n 1 169 LEU n 1 170 TYR n 1 171 GLU n 1 172 GLN n 1 173 VAL n 1 174 LYS n 1 175 SER n 1 176 ILE n 1 177 LYS n 1 178 LYS n 1 179 ILE n 1 180 ALA n 1 181 GLU n 1 182 TYR n 1 183 VAL n 1 184 ALA n 1 185 GLN n 1 186 LEU n 1 187 ARG n 1 188 LEU n 1 189 VAL n 1 190 GLY n 1 191 LYS n 1 192 GLY n 1 193 HIS n 1 194 GLY n 1 195 VAL n 1 196 TRP n 1 197 HIS n 1 198 PHE n 1 199 ASP n 1 200 GLN n 1 201 LYS n 1 202 LEU n 1 203 LEU n 1 204 HIS n 1 205 ASP n 1 206 GLU n 1 207 ASP n 1 208 HIS n 1 209 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 209 _entity_src_gen.gene_src_common_name Soybean _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Glycine max' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3847 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code I1J7H3_SOYBN _struct_ref.pdbx_db_accession I1J7H3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ASNAPAPLAGVIFEPFQELKKDYLAVPIAHNVSLARQNYADDSESAINEQINVEYNVSYVYHALFAYFDRDNIALKGLAK FFKESSEEEREHAEQLIKYQNIRGGRVVLHPITSPPSEFEHSEKGDALYAMELALSLEKLTNEKLLHVHSVAERNNDPQL ADFIESEFLYEQVKSIKKIAEYVAQLRLVGKGHGVWHFDQKLLHDEDHV ; _struct_ref.pdbx_align_begin 49 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6J4M H 1 ? 209 ? I1J7H3 49 ? 257 ? 3 211 2 1 6J4M A 1 ? 209 ? I1J7H3 49 ? 257 ? 3 211 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6J4M ASP H 153 ? UNP I1J7H3 GLU 201 'engineered mutation' 155 1 2 6J4M ASP A 153 ? UNP I1J7H3 GLU 201 'engineered mutation' 155 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6J4M _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.94 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Magnesium chloride, Tris, 1,6-hexylene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9789 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9789 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6J4M _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.598 _reflns.d_resolution_low 40.06 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17380 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.990 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.598 _reflns_shell.d_res_low 2.691 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.990 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6J4M _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.598 _refine.ls_d_res_low 40.06 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17380 _refine.ls_number_reflns_R_free 841 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.84 _refine.ls_percent_reflns_R_free 4.84 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1950 _refine.ls_R_factor_R_free 0.2238 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1935 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3A68 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.40 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.598 _refine_hist.d_res_low 40.06 _refine_hist.number_atoms_solvent 81 _refine_hist.number_atoms_total 2780 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2692 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 2748 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.950 ? 3710 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 19.881 ? 1644 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.050 ? 400 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 484 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5985 2.7612 . . 176 2694 100.00 . . . 0.2516 . 0.1827 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7612 2.9744 . . 146 2707 100.00 . . . 0.1974 . 0.1562 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9744 3.2737 . . 136 2751 100.00 . . . 0.1903 . 0.1656 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2737 3.7472 . . 137 2750 100.00 . . . 0.2569 . 0.1688 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7472 4.7204 . . 136 2774 100.00 . . . 0.2051 . 0.1909 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.7204 47.4110 . . 110 2865 99.00 . . . 0.2413 . 0.2364 . . . . . . . . . . # _struct.entry_id 6J4M _struct.title 'Thermal treated soybean seed H-2 ferritin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6J4M _struct_keywords.text oxidoreductase _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 3 ? K N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 40 ? ASP A 69 ? ALA H 42 ASP H 71 1 ? 30 HELX_P HELX_P2 AA2 LEU A 75 ? ARG A 103 ? LEU H 77 ARG H 105 1 ? 29 HELX_P HELX_P3 AA3 ASP A 126 ? ASN A 155 ? ASP H 128 ASN H 157 1 ? 30 HELX_P HELX_P4 AA4 ASP A 157 ? PHE A 168 ? ASP H 159 PHE H 170 1 ? 12 HELX_P HELX_P5 AA5 PHE A 168 ? GLY A 190 ? PHE H 170 GLY H 192 1 ? 23 HELX_P HELX_P6 AA6 GLY A 192 ? HIS A 204 ? GLY H 194 HIS H 206 1 ? 13 HELX_P HELX_P7 AA7 ALA B 40 ? ASP B 69 ? ALA A 42 ASP A 71 1 ? 30 HELX_P HELX_P8 AA8 LEU B 75 ? ARG B 103 ? LEU A 77 ARG A 105 1 ? 29 HELX_P HELX_P9 AA9 ASP B 126 ? ASN B 155 ? ASP A 128 ASN A 157 1 ? 30 HELX_P HELX_P10 AB1 ASP B 157 ? PHE B 168 ? ASP A 159 PHE A 170 1 ? 12 HELX_P HELX_P11 AB2 PHE B 168 ? GLY B 190 ? PHE A 170 GLY A 192 1 ? 23 HELX_P HELX_P12 AB3 GLY B 192 ? LEU B 203 ? GLY A 194 LEU A 205 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 42 OD1 ? ? ? 1_555 D MG . MG ? ? H ASP 44 H MG 302 1_555 ? ? ? ? ? ? ? 2.916 ? ? metalc2 metalc ? ? A ASP 42 OD2 ? ? ? 1_555 D MG . MG ? ? H ASP 44 H MG 302 1_555 ? ? ? ? ? ? ? 1.883 ? ? metalc3 metalc ? ? A GLU 54 OE1 ? ? ? 1_555 E MG . MG ? ? H GLU 56 H MG 303 1_555 ? ? ? ? ? ? ? 2.147 ? ? metalc4 metalc ? ? A GLU 89 OE2 ? ? ? 1_555 E MG . MG ? ? H GLU 91 H MG 303 1_555 ? ? ? ? ? ? ? 2.264 ? ? metalc5 metalc ? ? A GLU 89 OE1 ? ? ? 1_555 F MG . MG ? ? H GLU 91 H MG 304 1_555 ? ? ? ? ? ? ? 2.607 ? ? metalc6 metalc one ? A HIS 92 ND1 ? ? ? 1_555 E MG . MG ? ? H HIS 94 H MG 303 1_555 ? ? ? ? ? ? ? 2.374 ? ? metalc7 metalc ? ? A GLU 138 OE1 ? ? ? 1_555 F MG . MG ? ? H GLU 140 H MG 304 1_555 ? ? ? ? ? ? ? 2.932 ? ? metalc8 metalc ? ? A GLU 138 OE2 ? ? ? 1_555 F MG . MG ? ? H GLU 140 H MG 304 1_555 ? ? ? ? ? ? ? 2.463 ? ? metalc9 metalc ? ? A ASP 162 OD1 ? ? ? 1_555 C MG . MG ? ? H ASP 164 H MG 301 1_555 ? ? ? ? ? ? ? 2.729 ? ? metalc10 metalc ? ? A ASP 162 OD1 ? ? ? 1_555 C MG . MG ? ? H ASP 164 H MG 301 5_555 ? ? ? ? ? ? ? 2.729 ? ? metalc11 metalc ? ? A GLU 165 OE2 ? ? ? 1_555 C MG . MG ? ? H GLU 167 H MG 301 1_555 ? ? ? ? ? ? ? 2.697 ? ? metalc12 metalc ? ? A GLU 165 OE2 ? ? ? 1_555 C MG . MG ? ? H GLU 167 H MG 301 5_555 ? ? ? ? ? ? ? 2.697 ? ? metalc13 metalc ? ? D MG . MG ? ? ? 1_555 J HOH . O ? ? H MG 302 H HOH 404 1_555 ? ? ? ? ? ? ? 2.475 ? ? metalc14 metalc ? ? D MG . MG ? ? ? 1_555 J HOH . O ? ? H MG 302 H HOH 409 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc15 metalc ? ? D MG . MG ? ? ? 24_445 B ASP 42 OD2 ? ? H MG 302 A ASP 44 1_555 ? ? ? ? ? ? ? 1.895 ? ? metalc16 metalc ? ? D MG . MG ? ? ? 1_555 K HOH . O ? ? H MG 302 A HOH 406 18_444 ? ? ? ? ? ? ? 2.210 ? ? metalc17 metalc ? ? E MG . MG ? ? ? 1_555 J HOH . O ? ? H MG 303 H HOH 411 1_555 ? ? ? ? ? ? ? 2.064 ? ? metalc18 metalc ? ? E MG . MG ? ? ? 1_555 J HOH . O ? ? H MG 303 H HOH 420 1_555 ? ? ? ? ? ? ? 2.305 ? ? metalc19 metalc ? ? F MG . MG ? ? ? 1_555 J HOH . O ? ? H MG 304 H HOH 420 1_555 ? ? ? ? ? ? ? 2.287 ? ? metalc20 metalc ? ? F MG . MG ? ? ? 1_555 J HOH . O ? ? H MG 304 H HOH 423 1_555 ? ? ? ? ? ? ? 2.373 ? ? metalc21 metalc ? ? B GLU 54 OE1 ? ? ? 1_555 H MG . MG ? ? A GLU 56 A MG 302 1_555 ? ? ? ? ? ? ? 2.036 ? ? metalc22 metalc ? ? B GLU 89 OE2 ? ? ? 1_555 H MG . MG ? ? A GLU 91 A MG 302 1_555 ? ? ? ? ? ? ? 2.150 ? ? metalc23 metalc ? ? B GLU 89 OE1 ? ? ? 1_555 I MG . MG ? ? A GLU 91 A MG 303 1_555 ? ? ? ? ? ? ? 2.798 ? ? metalc24 metalc one ? B HIS 92 ND1 ? ? ? 1_555 H MG . MG ? ? A HIS 94 A MG 302 1_555 ? ? ? ? ? ? ? 2.443 ? ? metalc25 metalc ? ? B GLU 138 OE2 ? ? ? 1_555 I MG . MG ? ? A GLU 140 A MG 303 1_555 ? ? ? ? ? ? ? 2.488 ? ? metalc26 metalc ? ? B ASP 162 OD1 ? ? ? 1_555 G MG . MG ? ? A ASP 164 A MG 301 1_555 ? ? ? ? ? ? ? 2.344 ? ? metalc27 metalc ? ? B ASP 162 OD1 ? ? ? 1_555 G MG . MG ? ? A ASP 164 A MG 301 8_555 ? ? ? ? ? ? ? 2.344 ? ? metalc28 metalc ? ? B GLU 165 OE1 ? ? ? 1_555 G MG . MG ? ? A GLU 167 A MG 301 1_555 ? ? ? ? ? ? ? 2.027 ? ? metalc29 metalc ? ? B GLU 165 OE1 ? ? ? 1_555 G MG . MG ? ? A GLU 167 A MG 301 8_555 ? ? ? ? ? ? ? 2.027 ? ? metalc30 metalc ? ? H MG . MG ? ? ? 1_555 K HOH . O ? ? A MG 302 A HOH 410 1_555 ? ? ? ? ? ? ? 1.962 ? ? metalc31 metalc ? ? H MG . MG ? ? ? 1_555 K HOH . O ? ? A MG 302 A HOH 417 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc32 metalc ? ? I MG . MG ? ? ? 1_555 K HOH . O ? ? A MG 303 A HOH 417 1_555 ? ? ? ? ? ? ? 2.456 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software H MG 301 ? 6 'binding site for residue MG H 301' AC2 Software H MG 302 ? 5 'binding site for residue MG H 302' AC3 Software H MG 303 ? 5 'binding site for residue MG H 303' AC4 Software H MG 304 ? 4 'binding site for residue MG H 304' AC5 Software A MG 301 ? 9 'binding site for residue MG A 301' AC6 Software A MG 302 ? 5 'binding site for residue MG A 302' AC7 Software A MG 303 ? 4 'binding site for residue MG A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 162 ? ASP H 164 . ? 1_555 ? 2 AC1 6 ASP A 162 ? ASP H 164 . ? 5_555 ? 3 AC1 6 ASP A 162 ? ASP H 164 . ? 9_555 ? 4 AC1 6 GLU A 165 ? GLU H 167 . ? 5_555 ? 5 AC1 6 GLU A 165 ? GLU H 167 . ? 9_555 ? 6 AC1 6 GLU A 165 ? GLU H 167 . ? 1_555 ? 7 AC2 5 ASP B 42 ? ASP A 44 . ? 18_444 ? 8 AC2 5 HOH K . ? HOH A 406 . ? 18_444 ? 9 AC2 5 ASP A 42 ? ASP H 44 . ? 1_555 ? 10 AC2 5 HOH J . ? HOH H 404 . ? 1_555 ? 11 AC2 5 HOH J . ? HOH H 409 . ? 1_555 ? 12 AC3 5 GLU A 54 ? GLU H 56 . ? 1_555 ? 13 AC3 5 GLU A 89 ? GLU H 91 . ? 1_555 ? 14 AC3 5 HIS A 92 ? HIS H 94 . ? 1_555 ? 15 AC3 5 HOH J . ? HOH H 411 . ? 1_555 ? 16 AC3 5 HOH J . ? HOH H 420 . ? 1_555 ? 17 AC4 4 GLU A 89 ? GLU H 91 . ? 1_555 ? 18 AC4 4 GLU A 138 ? GLU H 140 . ? 1_555 ? 19 AC4 4 HOH J . ? HOH H 420 . ? 1_555 ? 20 AC4 4 HOH J . ? HOH H 423 . ? 1_555 ? 21 AC5 9 ASP B 162 ? ASP A 164 . ? 1_555 ? 22 AC5 9 ASP B 162 ? ASP A 164 . ? 11_555 ? 23 AC5 9 ASP B 162 ? ASP A 164 . ? 8_555 ? 24 AC5 9 GLU B 165 ? GLU A 167 . ? 11_555 ? 25 AC5 9 GLU B 165 ? GLU A 167 . ? 8_555 ? 26 AC5 9 GLU B 165 ? GLU A 167 . ? 1_555 ? 27 AC5 9 HOH K . ? HOH A 416 . ? 11_555 ? 28 AC5 9 HOH K . ? HOH A 416 . ? 8_555 ? 29 AC5 9 HOH K . ? HOH A 416 . ? 1_555 ? 30 AC6 5 GLU B 54 ? GLU A 56 . ? 1_555 ? 31 AC6 5 GLU B 89 ? GLU A 91 . ? 1_555 ? 32 AC6 5 HIS B 92 ? HIS A 94 . ? 1_555 ? 33 AC6 5 HOH K . ? HOH A 410 . ? 1_555 ? 34 AC6 5 HOH K . ? HOH A 417 . ? 1_555 ? 35 AC7 4 GLU B 89 ? GLU A 91 . ? 1_555 ? 36 AC7 4 GLU B 138 ? GLU A 140 . ? 1_555 ? 37 AC7 4 SER B 175 ? SER A 177 . ? 1_555 ? 38 AC7 4 HOH K . ? HOH A 417 . ? 1_555 ? # _atom_sites.entry_id 6J4M _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006671 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006671 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006671 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 3 ? ? ? H . n A 1 2 SER 2 4 ? ? ? H . n A 1 3 ASN 3 5 ? ? ? H . n A 1 4 ALA 4 6 ? ? ? H . n A 1 5 PRO 5 7 ? ? ? H . n A 1 6 ALA 6 8 ? ? ? H . n A 1 7 PRO 7 9 ? ? ? H . n A 1 8 LEU 8 10 ? ? ? H . n A 1 9 ALA 9 11 ? ? ? H . n A 1 10 GLY 10 12 ? ? ? H . n A 1 11 VAL 11 13 ? ? ? H . n A 1 12 ILE 12 14 ? ? ? H . n A 1 13 PHE 13 15 ? ? ? H . n A 1 14 GLU 14 16 ? ? ? H . n A 1 15 PRO 15 17 ? ? ? H . n A 1 16 PHE 16 18 ? ? ? H . n A 1 17 GLN 17 19 ? ? ? H . n A 1 18 GLU 18 20 ? ? ? H . n A 1 19 LEU 19 21 ? ? ? H . n A 1 20 LYS 20 22 ? ? ? H . n A 1 21 LYS 21 23 ? ? ? H . n A 1 22 ASP 22 24 ? ? ? H . n A 1 23 TYR 23 25 ? ? ? H . n A 1 24 LEU 24 26 ? ? ? H . n A 1 25 ALA 25 27 ? ? ? H . n A 1 26 VAL 26 28 ? ? ? H . n A 1 27 PRO 27 29 ? ? ? H . n A 1 28 ILE 28 30 ? ? ? H . n A 1 29 ALA 29 31 ? ? ? H . n A 1 30 HIS 30 32 ? ? ? H . n A 1 31 ASN 31 33 ? ? ? H . n A 1 32 VAL 32 34 34 VAL VAL H . n A 1 33 SER 33 35 35 SER SER H . n A 1 34 LEU 34 36 36 LEU LEU H . n A 1 35 ALA 35 37 37 ALA ALA H . n A 1 36 ARG 36 38 38 ARG ARG H . n A 1 37 GLN 37 39 39 GLN GLN H . n A 1 38 ASN 38 40 40 ASN ASN H . n A 1 39 TYR 39 41 41 TYR TYR H . n A 1 40 ALA 40 42 42 ALA ALA H . n A 1 41 ASP 41 43 43 ASP ASP H . n A 1 42 ASP 42 44 44 ASP ASP H . n A 1 43 SER 43 45 45 SER SER H . n A 1 44 GLU 44 46 46 GLU GLU H . n A 1 45 SER 45 47 47 SER SER H . n A 1 46 ALA 46 48 48 ALA ALA H . n A 1 47 ILE 47 49 49 ILE ILE H . n A 1 48 ASN 48 50 50 ASN ASN H . n A 1 49 GLU 49 51 51 GLU GLU H . n A 1 50 GLN 50 52 52 GLN GLN H . n A 1 51 ILE 51 53 53 ILE ILE H . n A 1 52 ASN 52 54 54 ASN ASN H . n A 1 53 VAL 53 55 55 VAL VAL H . n A 1 54 GLU 54 56 56 GLU GLU H . n A 1 55 TYR 55 57 57 TYR TYR H . n A 1 56 ASN 56 58 58 ASN ASN H . n A 1 57 VAL 57 59 59 VAL VAL H . n A 1 58 SER 58 60 60 SER SER H . n A 1 59 TYR 59 61 61 TYR TYR H . n A 1 60 VAL 60 62 62 VAL VAL H . n A 1 61 TYR 61 63 63 TYR TYR H . n A 1 62 HIS 62 64 64 HIS HIS H . n A 1 63 ALA 63 65 65 ALA ALA H . n A 1 64 LEU 64 66 66 LEU LEU H . n A 1 65 PHE 65 67 67 PHE PHE H . n A 1 66 ALA 66 68 68 ALA ALA H . n A 1 67 TYR 67 69 69 TYR TYR H . n A 1 68 PHE 68 70 70 PHE PHE H . n A 1 69 ASP 69 71 71 ASP ASP H . n A 1 70 ARG 70 72 72 ARG ARG H . n A 1 71 ASP 71 73 73 ASP ASP H . n A 1 72 ASN 72 74 74 ASN ASN H . n A 1 73 ILE 73 75 75 ILE ILE H . n A 1 74 ALA 74 76 76 ALA ALA H . n A 1 75 LEU 75 77 77 LEU LEU H . n A 1 76 LYS 76 78 78 LYS LYS H . n A 1 77 GLY 77 79 79 GLY GLY H . n A 1 78 LEU 78 80 80 LEU LEU H . n A 1 79 ALA 79 81 81 ALA ALA H . n A 1 80 LYS 80 82 82 LYS LYS H . n A 1 81 PHE 81 83 83 PHE PHE H . n A 1 82 PHE 82 84 84 PHE PHE H . n A 1 83 LYS 83 85 85 LYS LYS H . n A 1 84 GLU 84 86 86 GLU GLU H . n A 1 85 SER 85 87 87 SER SER H . n A 1 86 SER 86 88 88 SER SER H . n A 1 87 GLU 87 89 89 GLU GLU H . n A 1 88 GLU 88 90 90 GLU GLU H . n A 1 89 GLU 89 91 91 GLU GLU H . n A 1 90 ARG 90 92 92 ARG ARG H . n A 1 91 GLU 91 93 93 GLU GLU H . n A 1 92 HIS 92 94 94 HIS HIS H . n A 1 93 ALA 93 95 95 ALA ALA H . n A 1 94 GLU 94 96 96 GLU GLU H . n A 1 95 GLN 95 97 97 GLN GLN H . n A 1 96 LEU 96 98 98 LEU LEU H . n A 1 97 ILE 97 99 99 ILE ILE H . n A 1 98 LYS 98 100 100 LYS LYS H . n A 1 99 TYR 99 101 101 TYR TYR H . n A 1 100 GLN 100 102 102 GLN GLN H . n A 1 101 ASN 101 103 103 ASN ASN H . n A 1 102 ILE 102 104 104 ILE ILE H . n A 1 103 ARG 103 105 105 ARG ARG H . n A 1 104 GLY 104 106 106 GLY GLY H . n A 1 105 GLY 105 107 107 GLY GLY H . n A 1 106 ARG 106 108 108 ARG ARG H . n A 1 107 VAL 107 109 109 VAL VAL H . n A 1 108 VAL 108 110 110 VAL VAL H . n A 1 109 LEU 109 111 111 LEU LEU H . n A 1 110 HIS 110 112 112 HIS HIS H . n A 1 111 PRO 111 113 113 PRO PRO H . n A 1 112 ILE 112 114 114 ILE ILE H . n A 1 113 THR 113 115 115 THR THR H . n A 1 114 SER 114 116 116 SER SER H . n A 1 115 PRO 115 117 117 PRO PRO H . n A 1 116 PRO 116 118 118 PRO PRO H . n A 1 117 SER 117 119 ? ? ? H . n A 1 118 GLU 118 120 ? ? ? H . n A 1 119 PHE 119 121 ? ? ? H . n A 1 120 GLU 120 122 ? ? ? H . n A 1 121 HIS 121 123 ? ? ? H . n A 1 122 SER 122 124 ? ? ? H . n A 1 123 GLU 123 125 ? ? ? H . n A 1 124 LYS 124 126 ? ? ? H . n A 1 125 GLY 125 127 127 GLY GLY H . n A 1 126 ASP 126 128 128 ASP ASP H . n A 1 127 ALA 127 129 129 ALA ALA H . n A 1 128 LEU 128 130 130 LEU LEU H . n A 1 129 TYR 129 131 131 TYR TYR H . n A 1 130 ALA 130 132 132 ALA ALA H . n A 1 131 MET 131 133 133 MET MET H . n A 1 132 GLU 132 134 134 GLU GLU H . n A 1 133 LEU 133 135 135 LEU LEU H . n A 1 134 ALA 134 136 136 ALA ALA H . n A 1 135 LEU 135 137 137 LEU LEU H . n A 1 136 SER 136 138 138 SER SER H . n A 1 137 LEU 137 139 139 LEU LEU H . n A 1 138 GLU 138 140 140 GLU GLU H . n A 1 139 LYS 139 141 141 LYS LYS H . n A 1 140 LEU 140 142 142 LEU LEU H . n A 1 141 THR 141 143 143 THR THR H . n A 1 142 ASN 142 144 144 ASN ASN H . n A 1 143 GLU 143 145 145 GLU GLU H . n A 1 144 LYS 144 146 146 LYS LYS H . n A 1 145 LEU 145 147 147 LEU LEU H . n A 1 146 LEU 146 148 148 LEU LEU H . n A 1 147 HIS 147 149 149 HIS HIS H . n A 1 148 VAL 148 150 150 VAL VAL H . n A 1 149 HIS 149 151 151 HIS HIS H . n A 1 150 SER 150 152 152 SER SER H . n A 1 151 VAL 151 153 153 VAL VAL H . n A 1 152 ALA 152 154 154 ALA ALA H . n A 1 153 ASP 153 155 155 ASP ASP H . n A 1 154 ARG 154 156 156 ARG ARG H . n A 1 155 ASN 155 157 157 ASN ASN H . n A 1 156 ASN 156 158 158 ASN ASN H . n A 1 157 ASP 157 159 159 ASP ASP H . n A 1 158 PRO 158 160 160 PRO PRO H . n A 1 159 GLN 159 161 161 GLN GLN H . n A 1 160 LEU 160 162 162 LEU LEU H . n A 1 161 ALA 161 163 163 ALA ALA H . n A 1 162 ASP 162 164 164 ASP ASP H . n A 1 163 PHE 163 165 165 PHE PHE H . n A 1 164 ILE 164 166 166 ILE ILE H . n A 1 165 GLU 165 167 167 GLU GLU H . n A 1 166 SER 166 168 168 SER SER H . n A 1 167 GLU 167 169 169 GLU GLU H . n A 1 168 PHE 168 170 170 PHE PHE H . n A 1 169 LEU 169 171 171 LEU LEU H . n A 1 170 TYR 170 172 172 TYR TYR H . n A 1 171 GLU 171 173 173 GLU GLU H . n A 1 172 GLN 172 174 174 GLN GLN H . n A 1 173 VAL 173 175 175 VAL VAL H . n A 1 174 LYS 174 176 176 LYS LYS H . n A 1 175 SER 175 177 177 SER SER H . n A 1 176 ILE 176 178 178 ILE ILE H . n A 1 177 LYS 177 179 179 LYS LYS H . n A 1 178 LYS 178 180 180 LYS LYS H . n A 1 179 ILE 179 181 181 ILE ILE H . n A 1 180 ALA 180 182 182 ALA ALA H . n A 1 181 GLU 181 183 183 GLU GLU H . n A 1 182 TYR 182 184 184 TYR TYR H . n A 1 183 VAL 183 185 185 VAL VAL H . n A 1 184 ALA 184 186 186 ALA ALA H . n A 1 185 GLN 185 187 187 GLN GLN H . n A 1 186 LEU 186 188 188 LEU LEU H . n A 1 187 ARG 187 189 189 ARG ARG H . n A 1 188 LEU 188 190 190 LEU LEU H . n A 1 189 VAL 189 191 191 VAL VAL H . n A 1 190 GLY 190 192 192 GLY GLY H . n A 1 191 LYS 191 193 193 LYS LYS H . n A 1 192 GLY 192 194 194 GLY GLY H . n A 1 193 HIS 193 195 195 HIS HIS H . n A 1 194 GLY 194 196 196 GLY GLY H . n A 1 195 VAL 195 197 197 VAL VAL H . n A 1 196 TRP 196 198 198 TRP TRP H . n A 1 197 HIS 197 199 199 HIS HIS H . n A 1 198 PHE 198 200 200 PHE PHE H . n A 1 199 ASP 199 201 201 ASP ASP H . n A 1 200 GLN 200 202 202 GLN GLN H . n A 1 201 LYS 201 203 203 LYS LYS H . n A 1 202 LEU 202 204 204 LEU LEU H . n A 1 203 LEU 203 205 205 LEU LEU H . n A 1 204 HIS 204 206 206 HIS HIS H . n A 1 205 ASP 205 207 207 ASP ASP H . n A 1 206 GLU 206 208 ? ? ? H . n A 1 207 ASP 207 209 ? ? ? H . n A 1 208 HIS 208 210 ? ? ? H . n A 1 209 VAL 209 211 ? ? ? H . n B 1 1 ALA 1 3 ? ? ? A . n B 1 2 SER 2 4 ? ? ? A . n B 1 3 ASN 3 5 ? ? ? A . n B 1 4 ALA 4 6 ? ? ? A . n B 1 5 PRO 5 7 ? ? ? A . n B 1 6 ALA 6 8 ? ? ? A . n B 1 7 PRO 7 9 ? ? ? A . n B 1 8 LEU 8 10 ? ? ? A . n B 1 9 ALA 9 11 ? ? ? A . n B 1 10 GLY 10 12 ? ? ? A . n B 1 11 VAL 11 13 ? ? ? A . n B 1 12 ILE 12 14 ? ? ? A . n B 1 13 PHE 13 15 ? ? ? A . n B 1 14 GLU 14 16 ? ? ? A . n B 1 15 PRO 15 17 ? ? ? A . n B 1 16 PHE 16 18 ? ? ? A . n B 1 17 GLN 17 19 ? ? ? A . n B 1 18 GLU 18 20 ? ? ? A . n B 1 19 LEU 19 21 ? ? ? A . n B 1 20 LYS 20 22 ? ? ? A . n B 1 21 LYS 21 23 ? ? ? A . n B 1 22 ASP 22 24 ? ? ? A . n B 1 23 TYR 23 25 ? ? ? A . n B 1 24 LEU 24 26 ? ? ? A . n B 1 25 ALA 25 27 ? ? ? A . n B 1 26 VAL 26 28 ? ? ? A . n B 1 27 PRO 27 29 ? ? ? A . n B 1 28 ILE 28 30 ? ? ? A . n B 1 29 ALA 29 31 ? ? ? A . n B 1 30 HIS 30 32 ? ? ? A . n B 1 31 ASN 31 33 ? ? ? A . n B 1 32 VAL 32 34 34 VAL VAL A . n B 1 33 SER 33 35 35 SER SER A . n B 1 34 LEU 34 36 36 LEU LEU A . n B 1 35 ALA 35 37 37 ALA ALA A . n B 1 36 ARG 36 38 38 ARG ARG A . n B 1 37 GLN 37 39 39 GLN GLN A . n B 1 38 ASN 38 40 40 ASN ASN A . n B 1 39 TYR 39 41 41 TYR TYR A . n B 1 40 ALA 40 42 42 ALA ALA A . n B 1 41 ASP 41 43 43 ASP ASP A . n B 1 42 ASP 42 44 44 ASP ASP A . n B 1 43 SER 43 45 45 SER SER A . n B 1 44 GLU 44 46 46 GLU GLU A . n B 1 45 SER 45 47 47 SER SER A . n B 1 46 ALA 46 48 48 ALA ALA A . n B 1 47 ILE 47 49 49 ILE ILE A . n B 1 48 ASN 48 50 50 ASN ASN A . n B 1 49 GLU 49 51 51 GLU GLU A . n B 1 50 GLN 50 52 52 GLN GLN A . n B 1 51 ILE 51 53 53 ILE ILE A . n B 1 52 ASN 52 54 54 ASN ASN A . n B 1 53 VAL 53 55 55 VAL VAL A . n B 1 54 GLU 54 56 56 GLU GLU A . n B 1 55 TYR 55 57 57 TYR TYR A . n B 1 56 ASN 56 58 58 ASN ASN A . n B 1 57 VAL 57 59 59 VAL VAL A . n B 1 58 SER 58 60 60 SER SER A . n B 1 59 TYR 59 61 61 TYR TYR A . n B 1 60 VAL 60 62 62 VAL VAL A . n B 1 61 TYR 61 63 63 TYR TYR A . n B 1 62 HIS 62 64 64 HIS HIS A . n B 1 63 ALA 63 65 65 ALA ALA A . n B 1 64 LEU 64 66 66 LEU LEU A . n B 1 65 PHE 65 67 67 PHE PHE A . n B 1 66 ALA 66 68 68 ALA ALA A . n B 1 67 TYR 67 69 69 TYR TYR A . n B 1 68 PHE 68 70 70 PHE PHE A . n B 1 69 ASP 69 71 71 ASP ASP A . n B 1 70 ARG 70 72 72 ARG ARG A . n B 1 71 ASP 71 73 73 ASP ASP A . n B 1 72 ASN 72 74 74 ASN ASN A . n B 1 73 ILE 73 75 75 ILE ILE A . n B 1 74 ALA 74 76 76 ALA ALA A . n B 1 75 LEU 75 77 77 LEU LEU A . n B 1 76 LYS 76 78 78 LYS LYS A . n B 1 77 GLY 77 79 79 GLY GLY A . n B 1 78 LEU 78 80 80 LEU LEU A . n B 1 79 ALA 79 81 81 ALA ALA A . n B 1 80 LYS 80 82 82 LYS LYS A . n B 1 81 PHE 81 83 83 PHE PHE A . n B 1 82 PHE 82 84 84 PHE PHE A . n B 1 83 LYS 83 85 85 LYS LYS A . n B 1 84 GLU 84 86 86 GLU GLU A . n B 1 85 SER 85 87 87 SER SER A . n B 1 86 SER 86 88 88 SER SER A . n B 1 87 GLU 87 89 89 GLU GLU A . n B 1 88 GLU 88 90 90 GLU GLU A . n B 1 89 GLU 89 91 91 GLU GLU A . n B 1 90 ARG 90 92 92 ARG ARG A . n B 1 91 GLU 91 93 93 GLU GLU A . n B 1 92 HIS 92 94 94 HIS HIS A . n B 1 93 ALA 93 95 95 ALA ALA A . n B 1 94 GLU 94 96 96 GLU GLU A . n B 1 95 GLN 95 97 97 GLN GLN A . n B 1 96 LEU 96 98 98 LEU LEU A . n B 1 97 ILE 97 99 99 ILE ILE A . n B 1 98 LYS 98 100 100 LYS LYS A . n B 1 99 TYR 99 101 101 TYR TYR A . n B 1 100 GLN 100 102 102 GLN GLN A . n B 1 101 ASN 101 103 103 ASN ASN A . n B 1 102 ILE 102 104 104 ILE ILE A . n B 1 103 ARG 103 105 105 ARG ARG A . n B 1 104 GLY 104 106 106 GLY GLY A . n B 1 105 GLY 105 107 107 GLY GLY A . n B 1 106 ARG 106 108 108 ARG ARG A . n B 1 107 VAL 107 109 109 VAL VAL A . n B 1 108 VAL 108 110 110 VAL VAL A . n B 1 109 LEU 109 111 111 LEU LEU A . n B 1 110 HIS 110 112 112 HIS HIS A . n B 1 111 PRO 111 113 113 PRO PRO A . n B 1 112 ILE 112 114 114 ILE ILE A . n B 1 113 THR 113 115 115 THR THR A . n B 1 114 SER 114 116 116 SER SER A . n B 1 115 PRO 115 117 117 PRO PRO A . n B 1 116 PRO 116 118 118 PRO PRO A . n B 1 117 SER 117 119 ? ? ? A . n B 1 118 GLU 118 120 ? ? ? A . n B 1 119 PHE 119 121 ? ? ? A . n B 1 120 GLU 120 122 ? ? ? A . n B 1 121 HIS 121 123 ? ? ? A . n B 1 122 SER 122 124 ? ? ? A . n B 1 123 GLU 123 125 ? ? ? A . n B 1 124 LYS 124 126 ? ? ? A . n B 1 125 GLY 125 127 127 GLY GLY A . n B 1 126 ASP 126 128 128 ASP ASP A . n B 1 127 ALA 127 129 129 ALA ALA A . n B 1 128 LEU 128 130 130 LEU LEU A . n B 1 129 TYR 129 131 131 TYR TYR A . n B 1 130 ALA 130 132 132 ALA ALA A . n B 1 131 MET 131 133 133 MET MET A . n B 1 132 GLU 132 134 134 GLU GLU A . n B 1 133 LEU 133 135 135 LEU LEU A . n B 1 134 ALA 134 136 136 ALA ALA A . n B 1 135 LEU 135 137 137 LEU LEU A . n B 1 136 SER 136 138 138 SER SER A . n B 1 137 LEU 137 139 139 LEU LEU A . n B 1 138 GLU 138 140 140 GLU GLU A . n B 1 139 LYS 139 141 141 LYS LYS A . n B 1 140 LEU 140 142 142 LEU LEU A . n B 1 141 THR 141 143 143 THR THR A . n B 1 142 ASN 142 144 144 ASN ASN A . n B 1 143 GLU 143 145 145 GLU GLU A . n B 1 144 LYS 144 146 146 LYS LYS A . n B 1 145 LEU 145 147 147 LEU LEU A . n B 1 146 LEU 146 148 148 LEU LEU A . n B 1 147 HIS 147 149 149 HIS HIS A . n B 1 148 VAL 148 150 150 VAL VAL A . n B 1 149 HIS 149 151 151 HIS HIS A . n B 1 150 SER 150 152 152 SER SER A . n B 1 151 VAL 151 153 153 VAL VAL A . n B 1 152 ALA 152 154 154 ALA ALA A . n B 1 153 ASP 153 155 155 ASP ASP A . n B 1 154 ARG 154 156 156 ARG ARG A . n B 1 155 ASN 155 157 157 ASN ASN A . n B 1 156 ASN 156 158 158 ASN ASN A . n B 1 157 ASP 157 159 159 ASP ASP A . n B 1 158 PRO 158 160 160 PRO PRO A . n B 1 159 GLN 159 161 161 GLN GLN A . n B 1 160 LEU 160 162 162 LEU LEU A . n B 1 161 ALA 161 163 163 ALA ALA A . n B 1 162 ASP 162 164 164 ASP ASP A . n B 1 163 PHE 163 165 165 PHE PHE A . n B 1 164 ILE 164 166 166 ILE ILE A . n B 1 165 GLU 165 167 167 GLU GLU A . n B 1 166 SER 166 168 168 SER SER A . n B 1 167 GLU 167 169 169 GLU GLU A . n B 1 168 PHE 168 170 170 PHE PHE A . n B 1 169 LEU 169 171 171 LEU LEU A . n B 1 170 TYR 170 172 172 TYR TYR A . n B 1 171 GLU 171 173 173 GLU GLU A . n B 1 172 GLN 172 174 174 GLN GLN A . n B 1 173 VAL 173 175 175 VAL VAL A . n B 1 174 LYS 174 176 176 LYS LYS A . n B 1 175 SER 175 177 177 SER SER A . n B 1 176 ILE 176 178 178 ILE ILE A . n B 1 177 LYS 177 179 179 LYS LYS A . n B 1 178 LYS 178 180 180 LYS LYS A . n B 1 179 ILE 179 181 181 ILE ILE A . n B 1 180 ALA 180 182 182 ALA ALA A . n B 1 181 GLU 181 183 183 GLU GLU A . n B 1 182 TYR 182 184 184 TYR TYR A . n B 1 183 VAL 183 185 185 VAL VAL A . n B 1 184 ALA 184 186 186 ALA ALA A . n B 1 185 GLN 185 187 187 GLN GLN A . n B 1 186 LEU 186 188 188 LEU LEU A . n B 1 187 ARG 187 189 189 ARG ARG A . n B 1 188 LEU 188 190 190 LEU LEU A . n B 1 189 VAL 189 191 191 VAL VAL A . n B 1 190 GLY 190 192 192 GLY GLY A . n B 1 191 LYS 191 193 193 LYS LYS A . n B 1 192 GLY 192 194 194 GLY GLY A . n B 1 193 HIS 193 195 195 HIS HIS A . n B 1 194 GLY 194 196 196 GLY GLY A . n B 1 195 VAL 195 197 197 VAL VAL A . n B 1 196 TRP 196 198 198 TRP TRP A . n B 1 197 HIS 197 199 199 HIS HIS A . n B 1 198 PHE 198 200 200 PHE PHE A . n B 1 199 ASP 199 201 201 ASP ASP A . n B 1 200 GLN 200 202 202 GLN GLN A . n B 1 201 LYS 201 203 203 LYS LYS A . n B 1 202 LEU 202 204 204 LEU LEU A . n B 1 203 LEU 203 205 205 LEU LEU A . n B 1 204 HIS 204 206 206 HIS HIS A . n B 1 205 ASP 205 207 207 ASP ASP A . n B 1 206 GLU 206 208 ? ? ? A . n B 1 207 ASP 207 209 ? ? ? A . n B 1 208 HIS 208 210 ? ? ? A . n B 1 209 VAL 209 211 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 MG 1 301 2 MG MG H . D 2 MG 1 302 3 MG MG H . E 2 MG 1 303 5 MG MG H . F 2 MG 1 304 7 MG MG H . G 2 MG 1 301 1 MG MG A . H 2 MG 1 302 4 MG MG A . I 2 MG 1 303 6 MG MG A . J 3 HOH 1 401 18 HOH HOH H . J 3 HOH 2 402 76 HOH HOH H . J 3 HOH 3 403 40 HOH HOH H . J 3 HOH 4 404 79 HOH HOH H . J 3 HOH 5 405 31 HOH HOH H . J 3 HOH 6 406 11 HOH HOH H . J 3 HOH 7 407 36 HOH HOH H . J 3 HOH 8 408 21 HOH HOH H . J 3 HOH 9 409 33 HOH HOH H . J 3 HOH 10 410 2 HOH HOH H . J 3 HOH 11 411 43 HOH HOH H . J 3 HOH 12 412 10 HOH HOH H . J 3 HOH 13 413 87 HOH HOH H . J 3 HOH 14 414 44 HOH HOH H . J 3 HOH 15 415 54 HOH HOH H . J 3 HOH 16 416 8 HOH HOH H . J 3 HOH 17 417 4 HOH HOH H . J 3 HOH 18 418 39 HOH HOH H . J 3 HOH 19 419 30 HOH HOH H . J 3 HOH 20 420 13 HOH HOH H . J 3 HOH 21 421 48 HOH HOH H . J 3 HOH 22 422 85 HOH HOH H . J 3 HOH 23 423 61 HOH HOH H . J 3 HOH 24 424 81 HOH HOH H . J 3 HOH 25 425 57 HOH HOH H . J 3 HOH 26 426 88 HOH HOH H . J 3 HOH 27 427 23 HOH HOH H . J 3 HOH 28 428 27 HOH HOH H . J 3 HOH 29 429 65 HOH HOH H . J 3 HOH 30 430 12 HOH HOH H . J 3 HOH 31 431 86 HOH HOH H . J 3 HOH 32 432 42 HOH HOH H . J 3 HOH 33 433 68 HOH HOH H . J 3 HOH 34 434 34 HOH HOH H . J 3 HOH 35 435 75 HOH HOH H . J 3 HOH 36 436 89 HOH HOH H . J 3 HOH 37 437 51 HOH HOH H . J 3 HOH 38 438 73 HOH HOH H . J 3 HOH 39 439 80 HOH HOH H . J 3 HOH 40 440 67 HOH HOH H . J 3 HOH 41 441 16 HOH HOH H . K 3 HOH 1 401 24 HOH HOH A . K 3 HOH 2 402 9 HOH HOH A . K 3 HOH 3 403 28 HOH HOH A . K 3 HOH 4 404 17 HOH HOH A . K 3 HOH 5 405 38 HOH HOH A . K 3 HOH 6 406 77 HOH HOH A . K 3 HOH 7 407 1 HOH HOH A . K 3 HOH 8 408 20 HOH HOH A . K 3 HOH 9 409 56 HOH HOH A . K 3 HOH 10 410 46 HOH HOH A . K 3 HOH 11 411 50 HOH HOH A . K 3 HOH 12 412 52 HOH HOH A . K 3 HOH 13 413 15 HOH HOH A . K 3 HOH 14 414 53 HOH HOH A . K 3 HOH 15 415 25 HOH HOH A . K 3 HOH 16 416 3 HOH HOH A . K 3 HOH 17 417 14 HOH HOH A . K 3 HOH 18 418 19 HOH HOH A . K 3 HOH 19 419 26 HOH HOH A . K 3 HOH 20 420 64 HOH HOH A . K 3 HOH 21 421 5 HOH HOH A . K 3 HOH 22 422 55 HOH HOH A . K 3 HOH 23 423 35 HOH HOH A . K 3 HOH 24 424 22 HOH HOH A . K 3 HOH 25 425 6 HOH HOH A . K 3 HOH 26 426 82 HOH HOH A . K 3 HOH 27 427 84 HOH HOH A . K 3 HOH 28 428 7 HOH HOH A . K 3 HOH 29 429 49 HOH HOH A . K 3 HOH 30 430 72 HOH HOH A . K 3 HOH 31 431 71 HOH HOH A . K 3 HOH 32 432 29 HOH HOH A . K 3 HOH 33 433 69 HOH HOH A . K 3 HOH 34 434 58 HOH HOH A . K 3 HOH 35 435 47 HOH HOH A . K 3 HOH 36 436 70 HOH HOH A . K 3 HOH 37 437 60 HOH HOH A . K 3 HOH 38 438 41 HOH HOH A . K 3 HOH 39 439 59 HOH HOH A . K 3 HOH 40 440 66 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100980 ? 1 MORE -789 ? 1 'SSA (A^2)' 127260 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 H MG 301 ? C MG . 2 1 A MG 301 ? G MG . 3 1 H HOH 424 ? J HOH . 4 1 H HOH 431 ? J HOH . 5 1 H HOH 440 ? J HOH . 6 1 A HOH 416 ? K HOH . 7 1 A HOH 440 ? K HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 42 ? H ASP 44 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 OD2 ? A ASP 42 ? H ASP 44 ? 1_555 49.0 ? 2 OD1 ? A ASP 42 ? H ASP 44 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 O ? J HOH . ? H HOH 404 ? 1_555 49.4 ? 3 OD2 ? A ASP 42 ? H ASP 44 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 O ? J HOH . ? H HOH 404 ? 1_555 98.1 ? 4 OD1 ? A ASP 42 ? H ASP 44 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 O ? J HOH . ? H HOH 409 ? 1_555 105.4 ? 5 OD2 ? A ASP 42 ? H ASP 44 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 O ? J HOH . ? H HOH 409 ? 1_555 72.6 ? 6 O ? J HOH . ? H HOH 404 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 O ? J HOH . ? H HOH 409 ? 1_555 124.7 ? 7 OD1 ? A ASP 42 ? H ASP 44 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 OD2 ? B ASP 42 ? A ASP 44 ? 1_555 18.7 ? 8 OD2 ? A ASP 42 ? H ASP 44 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 OD2 ? B ASP 42 ? A ASP 44 ? 1_555 61.7 ? 9 O ? J HOH . ? H HOH 404 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 OD2 ? B ASP 42 ? A ASP 44 ? 1_555 37.9 ? 10 O ? J HOH . ? H HOH 409 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 OD2 ? B ASP 42 ? A ASP 44 ? 1_555 100.7 ? 11 OD1 ? A ASP 42 ? H ASP 44 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 O ? K HOH . ? A HOH 406 ? 18_444 123.9 ? 12 OD2 ? A ASP 42 ? H ASP 44 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 O ? K HOH . ? A HOH 406 ? 18_444 79.1 ? 13 O ? J HOH . ? H HOH 404 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 O ? K HOH . ? A HOH 406 ? 18_444 162.7 ? 14 O ? J HOH . ? H HOH 409 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 O ? K HOH . ? A HOH 406 ? 18_444 71.0 ? 15 OD2 ? B ASP 42 ? A ASP 44 ? 1_555 MG ? D MG . ? H MG 302 ? 1_555 O ? K HOH . ? A HOH 406 ? 18_444 140.3 ? 16 OE1 ? A GLU 54 ? H GLU 56 ? 1_555 MG ? E MG . ? H MG 303 ? 1_555 OE2 ? A GLU 89 ? H GLU 91 ? 1_555 77.5 ? 17 OE1 ? A GLU 54 ? H GLU 56 ? 1_555 MG ? E MG . ? H MG 303 ? 1_555 ND1 ? A HIS 92 ? H HIS 94 ? 1_555 101.2 ? 18 OE2 ? A GLU 89 ? H GLU 91 ? 1_555 MG ? E MG . ? H MG 303 ? 1_555 ND1 ? A HIS 92 ? H HIS 94 ? 1_555 87.9 ? 19 OE1 ? A GLU 54 ? H GLU 56 ? 1_555 MG ? E MG . ? H MG 303 ? 1_555 O ? J HOH . ? H HOH 411 ? 1_555 94.4 ? 20 OE2 ? A GLU 89 ? H GLU 91 ? 1_555 MG ? E MG . ? H MG 303 ? 1_555 O ? J HOH . ? H HOH 411 ? 1_555 165.8 ? 21 ND1 ? A HIS 92 ? H HIS 94 ? 1_555 MG ? E MG . ? H MG 303 ? 1_555 O ? J HOH . ? H HOH 411 ? 1_555 105.3 ? 22 OE1 ? A GLU 54 ? H GLU 56 ? 1_555 MG ? E MG . ? H MG 303 ? 1_555 O ? J HOH . ? H HOH 420 ? 1_555 144.0 ? 23 OE2 ? A GLU 89 ? H GLU 91 ? 1_555 MG ? E MG . ? H MG 303 ? 1_555 O ? J HOH . ? H HOH 420 ? 1_555 82.9 ? 24 ND1 ? A HIS 92 ? H HIS 94 ? 1_555 MG ? E MG . ? H MG 303 ? 1_555 O ? J HOH . ? H HOH 420 ? 1_555 108.0 ? 25 O ? J HOH . ? H HOH 411 ? 1_555 MG ? E MG . ? H MG 303 ? 1_555 O ? J HOH . ? H HOH 420 ? 1_555 97.7 ? 26 OE1 ? A GLU 89 ? H GLU 91 ? 1_555 MG ? F MG . ? H MG 304 ? 1_555 OE1 ? A GLU 138 ? H GLU 140 ? 1_555 69.6 ? 27 OE1 ? A GLU 89 ? H GLU 91 ? 1_555 MG ? F MG . ? H MG 304 ? 1_555 OE2 ? A GLU 138 ? H GLU 140 ? 1_555 99.7 ? 28 OE1 ? A GLU 138 ? H GLU 140 ? 1_555 MG ? F MG . ? H MG 304 ? 1_555 OE2 ? A GLU 138 ? H GLU 140 ? 1_555 46.3 ? 29 OE1 ? A GLU 89 ? H GLU 91 ? 1_555 MG ? F MG . ? H MG 304 ? 1_555 O ? J HOH . ? H HOH 420 ? 1_555 69.9 ? 30 OE1 ? A GLU 138 ? H GLU 140 ? 1_555 MG ? F MG . ? H MG 304 ? 1_555 O ? J HOH . ? H HOH 420 ? 1_555 95.2 ? 31 OE2 ? A GLU 138 ? H GLU 140 ? 1_555 MG ? F MG . ? H MG 304 ? 1_555 O ? J HOH . ? H HOH 420 ? 1_555 73.3 ? 32 OE1 ? A GLU 89 ? H GLU 91 ? 1_555 MG ? F MG . ? H MG 304 ? 1_555 O ? J HOH . ? H HOH 423 ? 1_555 69.6 ? 33 OE1 ? A GLU 138 ? H GLU 140 ? 1_555 MG ? F MG . ? H MG 304 ? 1_555 O ? J HOH . ? H HOH 423 ? 1_555 78.8 ? 34 OE2 ? A GLU 138 ? H GLU 140 ? 1_555 MG ? F MG . ? H MG 304 ? 1_555 O ? J HOH . ? H HOH 423 ? 1_555 122.3 ? 35 O ? J HOH . ? H HOH 420 ? 1_555 MG ? F MG . ? H MG 304 ? 1_555 O ? J HOH . ? H HOH 423 ? 1_555 138.5 ? 36 OD1 ? A ASP 162 ? H ASP 164 ? 1_555 MG ? C MG . ? H MG 301 ? 1_555 OD1 ? A ASP 162 ? H ASP 164 ? 1_555 0.0 ? 37 OD1 ? A ASP 162 ? H ASP 164 ? 1_555 MG ? C MG . ? H MG 301 ? 1_555 OE2 ? A GLU 165 ? H GLU 167 ? 1_555 86.2 ? 38 OD1 ? A ASP 162 ? H ASP 164 ? 1_555 MG ? C MG . ? H MG 301 ? 1_555 OE2 ? A GLU 165 ? H GLU 167 ? 1_555 86.2 ? 39 OD1 ? A ASP 162 ? H ASP 164 ? 1_555 MG ? C MG . ? H MG 301 ? 1_555 OE2 ? A GLU 165 ? H GLU 167 ? 1_555 86.2 ? 40 OD1 ? A ASP 162 ? H ASP 164 ? 1_555 MG ? C MG . ? H MG 301 ? 1_555 OE2 ? A GLU 165 ? H GLU 167 ? 1_555 86.2 ? 41 OE2 ? A GLU 165 ? H GLU 167 ? 1_555 MG ? C MG . ? H MG 301 ? 1_555 OE2 ? A GLU 165 ? H GLU 167 ? 1_555 0.0 ? 42 OE1 ? B GLU 54 ? A GLU 56 ? 1_555 MG ? H MG . ? A MG 302 ? 1_555 OE2 ? B GLU 89 ? A GLU 91 ? 1_555 84.4 ? 43 OE1 ? B GLU 54 ? A GLU 56 ? 1_555 MG ? H MG . ? A MG 302 ? 1_555 ND1 ? B HIS 92 ? A HIS 94 ? 1_555 100.5 ? 44 OE2 ? B GLU 89 ? A GLU 91 ? 1_555 MG ? H MG . ? A MG 302 ? 1_555 ND1 ? B HIS 92 ? A HIS 94 ? 1_555 87.4 ? 45 OE1 ? B GLU 54 ? A GLU 56 ? 1_555 MG ? H MG . ? A MG 302 ? 1_555 O ? K HOH . ? A HOH 410 ? 1_555 92.3 ? 46 OE2 ? B GLU 89 ? A GLU 91 ? 1_555 MG ? H MG . ? A MG 302 ? 1_555 O ? K HOH . ? A HOH 410 ? 1_555 176.3 ? 47 ND1 ? B HIS 92 ? A HIS 94 ? 1_555 MG ? H MG . ? A MG 302 ? 1_555 O ? K HOH . ? A HOH 410 ? 1_555 94.8 ? 48 OE1 ? B GLU 54 ? A GLU 56 ? 1_555 MG ? H MG . ? A MG 302 ? 1_555 O ? K HOH . ? A HOH 417 ? 1_555 158.8 ? 49 OE2 ? B GLU 89 ? A GLU 91 ? 1_555 MG ? H MG . ? A MG 302 ? 1_555 O ? K HOH . ? A HOH 417 ? 1_555 87.9 ? 50 ND1 ? B HIS 92 ? A HIS 94 ? 1_555 MG ? H MG . ? A MG 302 ? 1_555 O ? K HOH . ? A HOH 417 ? 1_555 98.9 ? 51 O ? K HOH . ? A HOH 410 ? 1_555 MG ? H MG . ? A MG 302 ? 1_555 O ? K HOH . ? A HOH 417 ? 1_555 94.6 ? 52 OE1 ? B GLU 89 ? A GLU 91 ? 1_555 MG ? I MG . ? A MG 303 ? 1_555 OE2 ? B GLU 138 ? A GLU 140 ? 1_555 89.0 ? 53 OE1 ? B GLU 89 ? A GLU 91 ? 1_555 MG ? I MG . ? A MG 303 ? 1_555 O ? K HOH . ? A HOH 417 ? 1_555 64.9 ? 54 OE2 ? B GLU 138 ? A GLU 140 ? 1_555 MG ? I MG . ? A MG 303 ? 1_555 O ? K HOH . ? A HOH 417 ? 1_555 75.4 ? 55 OD1 ? B ASP 162 ? A ASP 164 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OD1 ? B ASP 162 ? A ASP 164 ? 1_555 0.0 ? 56 OD1 ? B ASP 162 ? A ASP 164 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OE1 ? B GLU 165 ? A GLU 167 ? 1_555 89.6 ? 57 OD1 ? B ASP 162 ? A ASP 164 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OE1 ? B GLU 165 ? A GLU 167 ? 1_555 89.6 ? 58 OD1 ? B ASP 162 ? A ASP 164 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OE1 ? B GLU 165 ? A GLU 167 ? 1_555 89.6 ? 59 OD1 ? B ASP 162 ? A ASP 164 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OE1 ? B GLU 165 ? A GLU 167 ? 1_555 89.6 ? 60 OE1 ? B GLU 165 ? A GLU 167 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OE1 ? B GLU 165 ? A GLU 167 ? 1_555 0.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-09-18 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' pdbx_struct_conn_angle 6 2 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.value' 14 2 'Structure model' '_struct_conn.pdbx_dist_value' 15 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 16 2 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 17 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 2 'Structure model' '_struct_conn.ptnr1_symmetry' 24 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 25 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 2 'Structure model' '_struct_conn.ptnr2_label_seq_id' 31 2 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASN 158 ? ? O A HOH 401 ? ? 2.09 2 1 O H HOH 439 ? ? O A HOH 421 ? ? 2.10 3 1 O H HOH 439 ? ? O H HOH 441 ? ? 2.12 4 1 O A HOH 426 ? ? O A HOH 430 ? ? 2.13 5 1 NZ A LYS 180 ? ? OH A TYR 184 ? ? 2.14 6 1 O H HOH 410 ? ? O H HOH 438 ? ? 2.17 7 1 NE2 H GLN 161 ? ? O H HOH 401 ? ? 2.19 8 1 OD1 H ASN 158 ? ? O H HOH 402 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 H _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 436 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 H _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 436 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_555 _pdbx_validate_symm_contact.dist 2.09 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 H _pdbx_validate_rmsd_bond.auth_comp_id_1 LYS _pdbx_validate_rmsd_bond.auth_seq_id_1 203 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CE _pdbx_validate_rmsd_bond.auth_asym_id_2 H _pdbx_validate_rmsd_bond.auth_comp_id_2 LYS _pdbx_validate_rmsd_bond.auth_seq_id_2 203 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.349 _pdbx_validate_rmsd_bond.bond_target_value 1.508 _pdbx_validate_rmsd_bond.bond_deviation -0.159 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.025 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLN _pdbx_validate_rmsd_angle.auth_seq_id_1 202 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LYS _pdbx_validate_rmsd_angle.auth_seq_id_2 203 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LYS _pdbx_validate_rmsd_angle.auth_seq_id_3 203 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 137.77 _pdbx_validate_rmsd_angle.angle_target_value 121.70 _pdbx_validate_rmsd_angle.angle_deviation 16.07 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU H 77 ? ? -100.07 79.26 2 1 ASP H 159 ? ? -117.07 76.40 3 1 PHE H 170 ? ? -124.62 -56.68 4 1 HIS H 206 ? ? -102.77 41.95 5 1 PHE A 170 ? ? -124.50 -53.73 6 1 LYS A 203 ? ? 74.56 -93.12 7 1 HIS A 206 ? ? -99.66 45.58 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLN _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 202 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LYS _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 203 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 42.41 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 H ASP 207 ? CB ? A ASP 205 CB 2 1 Y 1 H ASP 207 ? CG ? A ASP 205 CG 3 1 Y 1 H ASP 207 ? OD1 ? A ASP 205 OD1 4 1 Y 1 H ASP 207 ? OD2 ? A ASP 205 OD2 5 1 Y 1 A ASP 207 ? CB ? B ASP 205 CB 6 1 Y 1 A ASP 207 ? CG ? B ASP 205 CG 7 1 Y 1 A ASP 207 ? OD1 ? B ASP 205 OD1 8 1 Y 1 A ASP 207 ? OD2 ? B ASP 205 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 H ALA 3 ? A ALA 1 2 1 Y 1 H SER 4 ? A SER 2 3 1 Y 1 H ASN 5 ? A ASN 3 4 1 Y 1 H ALA 6 ? A ALA 4 5 1 Y 1 H PRO 7 ? A PRO 5 6 1 Y 1 H ALA 8 ? A ALA 6 7 1 Y 1 H PRO 9 ? A PRO 7 8 1 Y 1 H LEU 10 ? A LEU 8 9 1 Y 1 H ALA 11 ? A ALA 9 10 1 Y 1 H GLY 12 ? A GLY 10 11 1 Y 1 H VAL 13 ? A VAL 11 12 1 Y 1 H ILE 14 ? A ILE 12 13 1 Y 1 H PHE 15 ? A PHE 13 14 1 Y 1 H GLU 16 ? A GLU 14 15 1 Y 1 H PRO 17 ? A PRO 15 16 1 Y 1 H PHE 18 ? A PHE 16 17 1 Y 1 H GLN 19 ? A GLN 17 18 1 Y 1 H GLU 20 ? A GLU 18 19 1 Y 1 H LEU 21 ? A LEU 19 20 1 Y 1 H LYS 22 ? A LYS 20 21 1 Y 1 H LYS 23 ? A LYS 21 22 1 Y 1 H ASP 24 ? A ASP 22 23 1 Y 1 H TYR 25 ? A TYR 23 24 1 Y 1 H LEU 26 ? A LEU 24 25 1 Y 1 H ALA 27 ? A ALA 25 26 1 Y 1 H VAL 28 ? A VAL 26 27 1 Y 1 H PRO 29 ? A PRO 27 28 1 Y 1 H ILE 30 ? A ILE 28 29 1 Y 1 H ALA 31 ? A ALA 29 30 1 Y 1 H HIS 32 ? A HIS 30 31 1 Y 1 H ASN 33 ? A ASN 31 32 1 Y 1 H SER 119 ? A SER 117 33 1 Y 1 H GLU 120 ? A GLU 118 34 1 Y 1 H PHE 121 ? A PHE 119 35 1 Y 1 H GLU 122 ? A GLU 120 36 1 Y 1 H HIS 123 ? A HIS 121 37 1 Y 1 H SER 124 ? A SER 122 38 1 Y 1 H GLU 125 ? A GLU 123 39 1 Y 1 H LYS 126 ? A LYS 124 40 1 Y 1 H GLU 208 ? A GLU 206 41 1 Y 1 H ASP 209 ? A ASP 207 42 1 Y 1 H HIS 210 ? A HIS 208 43 1 Y 1 H VAL 211 ? A VAL 209 44 1 Y 1 A ALA 3 ? B ALA 1 45 1 Y 1 A SER 4 ? B SER 2 46 1 Y 1 A ASN 5 ? B ASN 3 47 1 Y 1 A ALA 6 ? B ALA 4 48 1 Y 1 A PRO 7 ? B PRO 5 49 1 Y 1 A ALA 8 ? B ALA 6 50 1 Y 1 A PRO 9 ? B PRO 7 51 1 Y 1 A LEU 10 ? B LEU 8 52 1 Y 1 A ALA 11 ? B ALA 9 53 1 Y 1 A GLY 12 ? B GLY 10 54 1 Y 1 A VAL 13 ? B VAL 11 55 1 Y 1 A ILE 14 ? B ILE 12 56 1 Y 1 A PHE 15 ? B PHE 13 57 1 Y 1 A GLU 16 ? B GLU 14 58 1 Y 1 A PRO 17 ? B PRO 15 59 1 Y 1 A PHE 18 ? B PHE 16 60 1 Y 1 A GLN 19 ? B GLN 17 61 1 Y 1 A GLU 20 ? B GLU 18 62 1 Y 1 A LEU 21 ? B LEU 19 63 1 Y 1 A LYS 22 ? B LYS 20 64 1 Y 1 A LYS 23 ? B LYS 21 65 1 Y 1 A ASP 24 ? B ASP 22 66 1 Y 1 A TYR 25 ? B TYR 23 67 1 Y 1 A LEU 26 ? B LEU 24 68 1 Y 1 A ALA 27 ? B ALA 25 69 1 Y 1 A VAL 28 ? B VAL 26 70 1 Y 1 A PRO 29 ? B PRO 27 71 1 Y 1 A ILE 30 ? B ILE 28 72 1 Y 1 A ALA 31 ? B ALA 29 73 1 Y 1 A HIS 32 ? B HIS 30 74 1 Y 1 A ASN 33 ? B ASN 31 75 1 Y 1 A SER 119 ? B SER 117 76 1 Y 1 A GLU 120 ? B GLU 118 77 1 Y 1 A PHE 121 ? B PHE 119 78 1 Y 1 A GLU 122 ? B GLU 120 79 1 Y 1 A HIS 123 ? B HIS 121 80 1 Y 1 A SER 124 ? B SER 122 81 1 Y 1 A GLU 125 ? B GLU 123 82 1 Y 1 A LYS 126 ? B LYS 124 83 1 Y 1 A GLU 208 ? B GLU 206 84 1 Y 1 A ASP 209 ? B ASP 207 85 1 Y 1 A HIS 210 ? B HIS 208 86 1 Y 1 A VAL 211 ? B VAL 209 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 MG MG MG N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31730069 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3A68 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #