data_6JIC # _entry.id 6JIC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6JIC pdb_00006jic 10.2210/pdb6jic/pdb WWPDB D_1300011171 ? ? BMRB 36239 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Identification and Characterization of a carboxypeptidase inhibitor from Lycium barbarum' _pdbx_database_related.db_id 36239 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6JIC _pdbx_database_status.recvd_initial_deposition_date 2019-02-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tan, W.L.' 1 ? 'Wong, K.H.' 2 ? 'Huang, J.Y.' 3 ? 'Tay, S.V.' 4 ? 'Wang, S.J.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Food Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 0308-8146 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 351 _citation.language ? _citation.page_first 129338 _citation.page_last 129338 _citation.title 'Identification and characterization of a wolfberry carboxypeptidase inhibitor from Lycium barbarum.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.foodchem.2021.129338 _citation.pdbx_database_id_PubMed 33647700 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, J.' 1 ? primary 'Wong, K.H.' 2 ? primary 'Tan, W.L.' 3 ? primary 'Tay, S.V.' 4 ? primary 'Wang, S.' 5 ? primary 'Tam, J.P.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description WCI _entity.formula_weight 4019.481 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code QDDPTCGKPCNTMDDCSNGWFCQACWNSRKTCGPFV _entity_poly.pdbx_seq_one_letter_code_can QDDPTCGKPCNTMDDCSNGWFCQACWNSRKTCGPFV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ASP n 1 3 ASP n 1 4 PRO n 1 5 THR n 1 6 CYS n 1 7 GLY n 1 8 LYS n 1 9 PRO n 1 10 CYS n 1 11 ASN n 1 12 THR n 1 13 MET n 1 14 ASP n 1 15 ASP n 1 16 CYS n 1 17 SER n 1 18 ASN n 1 19 GLY n 1 20 TRP n 1 21 PHE n 1 22 CYS n 1 23 GLN n 1 24 ALA n 1 25 CYS n 1 26 TRP n 1 27 ASN n 1 28 SER n 1 29 ARG n 1 30 LYS n 1 31 THR n 1 32 CYS n 1 33 GLY n 1 34 PRO n 1 35 PHE n 1 36 VAL n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 36 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Lycium barbarum' _entity_src_nat.pdbx_ncbi_taxonomy_id 112863 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6JIC _struct_ref.pdbx_db_accession 6JIC _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6JIC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6JIC _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 36 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 36 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label con_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0 mM WCI, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label Sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6JIC _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6JIC _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6JIC _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' Sparky ? Goddard 4 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6JIC _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6JIC _struct.title 'Identification and Characterization of a carboxypeptidase inhibitor from Lycium barbarum' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6JIC _struct_keywords.text 'carboxypeptidase inhibitor, wolfberry, cysteine-rich peptide, PLANT PROTEIN' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 6 A CYS 22 1_555 ? ? ? ? ? ? ? 2.000 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 10 A CYS 25 1_555 ? ? ? ? ? ? ? 2.069 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 16 A CYS 32 1_555 ? ? ? ? ? ? ? 1.951 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 6JIC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 VAL 36 36 36 VAL VAL A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 2810 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-26 2 'Structure model' 1 1 2021-03-10 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' 14 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component WCI _pdbx_nmr_exptl_sample.concentration 1.0 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -92.42 -75.67 2 1 CYS A 16 ? ? -145.28 15.20 3 1 SER A 17 ? ? -90.94 45.60 4 1 ASN A 18 ? ? -143.95 -48.57 5 1 GLN A 23 ? ? -92.35 34.12 6 1 TRP A 26 ? ? 57.27 94.38 7 1 ARG A 29 ? ? -144.38 13.87 8 1 CYS A 32 ? ? -37.48 140.81 9 1 PHE A 35 ? ? -106.77 -169.53 10 2 ASP A 2 ? ? -92.47 -75.79 11 2 CYS A 16 ? ? -145.23 15.10 12 2 SER A 17 ? ? -90.75 45.26 13 2 ASN A 18 ? ? -143.65 -48.24 14 2 GLN A 23 ? ? -92.97 34.88 15 2 TRP A 26 ? ? 56.96 94.21 16 2 ARG A 29 ? ? -144.55 13.93 17 2 CYS A 32 ? ? -37.26 141.12 18 3 ASP A 2 ? ? 179.30 -76.76 19 3 ASP A 3 ? ? 38.75 62.00 20 3 CYS A 16 ? ? -145.26 15.32 21 3 SER A 17 ? ? -90.75 44.99 22 3 ASN A 18 ? ? -142.39 -51.06 23 3 GLN A 23 ? ? -92.24 33.83 24 3 TRP A 26 ? ? 57.54 94.40 25 3 ARG A 29 ? ? -144.83 14.06 26 3 CYS A 32 ? ? -37.04 141.17 27 3 PHE A 35 ? ? -106.06 -168.17 28 4 ASP A 2 ? ? -98.97 -62.13 29 4 CYS A 16 ? ? -146.10 15.71 30 4 SER A 17 ? ? -91.40 45.77 31 4 ASN A 18 ? ? -143.21 -48.92 32 4 GLN A 23 ? ? -90.48 34.92 33 4 TRP A 26 ? ? 58.40 95.08 34 4 ARG A 29 ? ? -154.70 20.56 35 4 CYS A 32 ? ? -36.22 137.87 36 4 PHE A 35 ? ? -65.95 -168.46 37 5 ASP A 2 ? ? -98.71 -68.87 38 5 CYS A 16 ? ? -144.38 14.50 39 5 SER A 17 ? ? -91.38 45.32 40 5 ASN A 18 ? ? -142.92 -49.19 41 5 PHE A 21 ? ? -100.18 -65.25 42 5 GLN A 23 ? ? -92.68 34.61 43 5 TRP A 26 ? ? 59.31 95.41 44 5 ARG A 29 ? ? -143.48 13.66 45 5 CYS A 32 ? ? -36.38 142.41 46 6 ASP A 2 ? ? -91.46 -75.58 47 6 CYS A 16 ? ? -144.90 17.89 48 6 SER A 17 ? ? -87.84 44.14 49 6 ASN A 18 ? ? -140.94 -46.29 50 6 GLN A 23 ? ? -89.67 40.25 51 6 TRP A 26 ? ? 56.95 94.92 52 6 ARG A 29 ? ? -146.80 14.86 53 6 CYS A 32 ? ? -37.52 145.42 54 7 ASP A 2 ? ? -91.53 -75.56 55 7 CYS A 16 ? ? -144.70 18.24 56 7 SER A 17 ? ? -87.96 44.03 57 7 ASN A 18 ? ? -141.09 -45.70 58 7 GLN A 23 ? ? -89.95 40.41 59 7 TRP A 26 ? ? 56.79 94.59 60 7 ARG A 29 ? ? -147.35 15.21 61 7 CYS A 32 ? ? -37.66 145.35 62 8 ASP A 2 ? ? -91.64 -76.09 63 8 CYS A 16 ? ? -144.82 18.18 64 8 SER A 17 ? ? -87.97 44.09 65 8 ASN A 18 ? ? -141.24 -46.01 66 8 GLN A 23 ? ? -89.82 40.11 67 8 TRP A 26 ? ? 56.90 95.01 68 8 ARG A 29 ? ? -146.81 15.18 69 8 CYS A 32 ? ? -37.81 145.70 70 8 PHE A 35 ? ? -68.95 -166.20 71 9 ASP A 2 ? ? -103.80 -61.05 72 9 CYS A 16 ? ? -146.26 16.25 73 9 SER A 17 ? ? -89.42 44.97 74 9 ASN A 18 ? ? -145.18 -52.23 75 9 GLN A 23 ? ? -91.93 34.93 76 9 TRP A 26 ? ? 57.00 94.32 77 9 ARG A 29 ? ? -144.73 14.14 78 9 CYS A 32 ? ? -37.96 142.08 79 10 ASP A 2 ? ? -92.59 -69.12 80 10 CYS A 16 ? ? -146.72 16.65 81 10 SER A 17 ? ? -89.74 45.27 82 10 ASN A 18 ? ? -145.66 -52.05 83 10 GLN A 23 ? ? -91.75 34.40 84 10 TRP A 26 ? ? 57.23 94.80 85 10 ARG A 29 ? ? -144.85 14.17 86 10 CYS A 32 ? ? -38.00 142.00 87 10 PHE A 35 ? ? -62.88 -167.22 # _pdbx_audit_support.funding_organization 'Ministry of Education (Singapore)' _pdbx_audit_support.country Singapore _pdbx_audit_support.grant_number MOE-2016-T3-1-003 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #