data_6JJA # _entry.id 6JJA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6JJA pdb_00006jja 10.2210/pdb6jja/pdb WWPDB D_1300011218 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-17 2 'Structure model' 1 1 2024-03-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_oper_list.name' 4 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 5 2 'Structure model' '_pdbx_struct_oper_list.type' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6JJA _pdbx_database_status.recvd_initial_deposition_date 2019-02-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details . _pdbx_database_related.db_id EMD-9705 _pdbx_database_related.content_type 'associated EM volume' # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chang, W.H.' 1 0000-0002-2612-850X 'Wang, C.H.' 2 0000-0003-2242-7200 'Lin, H.H.' 3 ? 'Lin, S.Y.' 4 ? 'Chong, S.C.' 5 ? 'Wu, Y.Y.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Cryo-EM structure of giant freshwater prawn Macrobrachium rosenbergii extra small virus (XSV) VLP' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chang, W.H.' 1 0000-0002-2612-850X primary 'Wang, C.H.' 2 0000-0003-2242-7200 primary 'Lin, H.H.' 3 ? primary 'Lin, S.Y.' 4 ? primary 'Chong, S.C.' 5 ? primary 'Wu, Y.Y.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nucleocapsid protein CP17' 19142.818 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNKRINNNRRTMRSRRGRGRTMGSNLIPYANSPVPIPYTPPVTPVTVIGNPRKTTWIDIDLSSEESGIYTLTVGSYRNRI TKLGPSKPNFIIEKVAAYAAPGDYKVVLNDFKTGIQVVDEGSYAHRAAAGILYPPAAQMFYGISATGTLNTITTTAKDPV PVVRALVTYWDSEQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MNKRINNNRRTMRSRRGRGRTMGSNLIPYANSPVPIPYTPPVTPVTVIGNPRKTTWIDIDLSSEESGIYTLTVGSYRNRI TKLGPSKPNFIIEKVAAYAAPGDYKVVLNDFKTGIQVVDEGSYAHRAAAGILYPPAAQMFYGISATGTLNTITTTAKDPV PVVRALVTYWDSEQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 LYS n 1 4 ARG n 1 5 ILE n 1 6 ASN n 1 7 ASN n 1 8 ASN n 1 9 ARG n 1 10 ARG n 1 11 THR n 1 12 MET n 1 13 ARG n 1 14 SER n 1 15 ARG n 1 16 ARG n 1 17 GLY n 1 18 ARG n 1 19 GLY n 1 20 ARG n 1 21 THR n 1 22 MET n 1 23 GLY n 1 24 SER n 1 25 ASN n 1 26 LEU n 1 27 ILE n 1 28 PRO n 1 29 TYR n 1 30 ALA n 1 31 ASN n 1 32 SER n 1 33 PRO n 1 34 VAL n 1 35 PRO n 1 36 ILE n 1 37 PRO n 1 38 TYR n 1 39 THR n 1 40 PRO n 1 41 PRO n 1 42 VAL n 1 43 THR n 1 44 PRO n 1 45 VAL n 1 46 THR n 1 47 VAL n 1 48 ILE n 1 49 GLY n 1 50 ASN n 1 51 PRO n 1 52 ARG n 1 53 LYS n 1 54 THR n 1 55 THR n 1 56 TRP n 1 57 ILE n 1 58 ASP n 1 59 ILE n 1 60 ASP n 1 61 LEU n 1 62 SER n 1 63 SER n 1 64 GLU n 1 65 GLU n 1 66 SER n 1 67 GLY n 1 68 ILE n 1 69 TYR n 1 70 THR n 1 71 LEU n 1 72 THR n 1 73 VAL n 1 74 GLY n 1 75 SER n 1 76 TYR n 1 77 ARG n 1 78 ASN n 1 79 ARG n 1 80 ILE n 1 81 THR n 1 82 LYS n 1 83 LEU n 1 84 GLY n 1 85 PRO n 1 86 SER n 1 87 LYS n 1 88 PRO n 1 89 ASN n 1 90 PHE n 1 91 ILE n 1 92 ILE n 1 93 GLU n 1 94 LYS n 1 95 VAL n 1 96 ALA n 1 97 ALA n 1 98 TYR n 1 99 ALA n 1 100 ALA n 1 101 PRO n 1 102 GLY n 1 103 ASP n 1 104 TYR n 1 105 LYS n 1 106 VAL n 1 107 VAL n 1 108 LEU n 1 109 ASN n 1 110 ASP n 1 111 PHE n 1 112 LYS n 1 113 THR n 1 114 GLY n 1 115 ILE n 1 116 GLN n 1 117 VAL n 1 118 VAL n 1 119 ASP n 1 120 GLU n 1 121 GLY n 1 122 SER n 1 123 TYR n 1 124 ALA n 1 125 HIS n 1 126 ARG n 1 127 ALA n 1 128 ALA n 1 129 ALA n 1 130 GLY n 1 131 ILE n 1 132 LEU n 1 133 TYR n 1 134 PRO n 1 135 PRO n 1 136 ALA n 1 137 ALA n 1 138 GLN n 1 139 MET n 1 140 PHE n 1 141 TYR n 1 142 GLY n 1 143 ILE n 1 144 SER n 1 145 ALA n 1 146 THR n 1 147 GLY n 1 148 THR n 1 149 LEU n 1 150 ASN n 1 151 THR n 1 152 ILE n 1 153 THR n 1 154 THR n 1 155 THR n 1 156 ALA n 1 157 LYS n 1 158 ASP n 1 159 PRO n 1 160 VAL n 1 161 PRO n 1 162 VAL n 1 163 VAL n 1 164 ARG n 1 165 ALA n 1 166 LEU n 1 167 VAL n 1 168 THR n 1 169 TYR n 1 170 TRP n 1 171 ASP n 1 172 SER n 1 173 GLU n 1 174 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 174 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Extra small virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 230604 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pETDuet-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 ARG 4 4 ? ? ? A . n A 1 5 ILE 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 ASN 7 7 ? ? ? A . n A 1 8 ASN 8 8 ? ? ? A . n A 1 9 ARG 9 9 ? ? ? A . n A 1 10 ARG 10 10 ? ? ? A . n A 1 11 THR 11 11 ? ? ? A . n A 1 12 MET 12 12 ? ? ? A . n A 1 13 ARG 13 13 ? ? ? A . n A 1 14 SER 14 14 ? ? ? A . n A 1 15 ARG 15 15 ? ? ? A . n A 1 16 ARG 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 ARG 18 18 ? ? ? A . n A 1 19 GLY 19 19 ? ? ? A . n A 1 20 ARG 20 20 ? ? ? A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 MET 139 139 139 MET MET A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 PRO 161 161 161 PRO PRO A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 GLN 174 174 174 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 1 CA CA A . C 2 CA 1 202 2 CA CA A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6JJA _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 6JJA _struct.title 'Cryo-EM structure of giant freshwater prawn Macrobrachium rosenbergii extra small virus (XSV) VLP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6JJA _struct_keywords.text ;Giant freshwater prawn Macrobrachium rosenbergii, T=1 icosahedral particle, Single-stranded RNA satellite virus, Canonical jelly-roll beta-barrel fold, VIRUS LIKE PARTICLE, VIRUS ; _struct_keywords.pdbx_keywords VIRUS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q15BP7_9VIRU _struct_ref.pdbx_db_accession Q15BP7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNKRINNNRRTMRSRRGRGRTMGSNLIPYANSPVPIPYTPPVTPVTVIGNPRKTTWIDIDLSSEESGIYTLTVGSYRNRI TKLGPSKPNFIIEKVAAYAAPGDYKVVLNDFKTGIQVVDEGSYAHRAAAGILYPPAAQMFYGISATGTLNTITTTAKDPV PVVRALVTYWDSEQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6JJA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 174 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15BP7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 174 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 174 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'complete icosahedral assembly' ? 60-meric 60 2 'icosahedral asymmetric unit' ? monomeric 1 3 'icosahedral pentamer' ? pentameric 5 4 'icosahedral 23 hexamer' ? hexameric 6 5 'icosahedral asymmetric unit, std point frame' ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-60)' A,B,C 2 1 A,B,C 3 '(1-5)' A,B,C 4 '(1,2,6,10,23,24)' A,B,C 5 P A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support microscopy _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] P 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 2 'point symmetry operation' ? ? 0.30901699 -0.80901699 0.50000000 0.00000 0.80901699 0.50000000 0.30901699 0.00000 -0.50000000 0.30901699 0.80901699 0.00000 3 'point symmetry operation' ? ? -0.80901699 -0.50000000 0.30901699 0.00000 0.50000000 -0.30901699 0.80901699 0.00000 -0.30901699 0.80901699 0.50000000 0.00000 4 'point symmetry operation' ? ? -0.80901699 0.50000000 -0.30901699 0.00000 -0.50000000 -0.30901699 0.80901699 0.00000 0.30901699 0.80901699 0.50000000 0.00000 5 'point symmetry operation' ? ? 0.30901699 0.80901699 -0.50000000 0.00000 -0.80901699 0.50000000 0.30901699 0.00000 0.50000000 0.30901699 0.80901699 0.00000 6 'point symmetry operation' ? ? -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 7 'point symmetry operation' ? ? -0.30901699 0.80901699 -0.50000000 0.00000 -0.80901699 -0.50000000 -0.30901699 0.00000 -0.50000000 0.30901699 0.80901699 0.00000 8 'point symmetry operation' ? ? 0.80901699 0.50000000 -0.30901699 0.00000 -0.50000000 0.30901699 -0.80901699 0.00000 -0.30901699 0.80901699 0.50000000 0.00000 9 'point symmetry operation' ? ? 0.80901699 -0.50000000 0.30901699 0.00000 0.50000000 0.30901699 -0.80901699 0.00000 0.30901699 0.80901699 0.50000000 0.00000 10 'point symmetry operation' ? ? -0.30901699 -0.80901699 0.50000000 0.00000 0.80901699 -0.50000000 -0.30901699 0.00000 0.50000000 0.30901699 0.80901699 0.00000 11 'point symmetry operation' ? ? -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 12 'point symmetry operation' ? ? -0.30901699 0.80901699 -0.50000000 0.00000 0.80901699 0.50000000 0.30901699 0.00000 0.50000000 -0.30901699 -0.80901699 0.00000 13 'point symmetry operation' ? ? 0.80901699 0.50000000 -0.30901699 0.00000 0.50000000 -0.30901699 0.80901699 0.00000 0.30901699 -0.80901699 -0.50000000 0.00000 14 'point symmetry operation' ? ? 0.80901699 -0.50000000 0.30901699 0.00000 -0.50000000 -0.30901699 0.80901699 0.00000 -0.30901699 -0.80901699 -0.50000000 0.00000 15 'point symmetry operation' ? ? -0.30901699 -0.80901699 0.50000000 0.00000 -0.80901699 0.50000000 0.30901699 0.00000 -0.50000000 -0.30901699 -0.80901699 0.00000 16 'point symmetry operation' ? ? 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 17 'point symmetry operation' ? ? 0.30901699 -0.80901699 0.50000000 0.00000 -0.80901699 -0.50000000 -0.30901699 0.00000 0.50000000 -0.30901699 -0.80901699 0.00000 18 'point symmetry operation' ? ? -0.80901699 -0.50000000 0.30901699 0.00000 -0.50000000 0.30901699 -0.80901699 0.00000 0.30901699 -0.80901699 -0.50000000 0.00000 19 'point symmetry operation' ? ? -0.80901699 0.50000000 -0.30901699 0.00000 0.50000000 0.30901699 -0.80901699 0.00000 -0.30901699 -0.80901699 -0.50000000 0.00000 20 'point symmetry operation' ? ? 0.30901699 0.80901699 -0.50000000 0.00000 0.80901699 -0.50000000 -0.30901699 0.00000 -0.50000000 -0.30901699 -0.80901699 0.00000 21 'point symmetry operation' ? ? 0.00000000 0.00000000 1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 22 'point symmetry operation' ? ? -0.50000000 0.30901699 0.80901699 0.00000 0.30901699 -0.80901699 0.50000000 0.00000 0.80901699 0.50000000 0.30901699 0.00000 23 'point symmetry operation' ? ? -0.30901699 0.80901699 0.50000000 0.00000 -0.80901699 -0.50000000 0.30901699 0.00000 0.50000000 -0.30901699 0.80901699 0.00000 24 'point symmetry operation' ? ? 0.30901699 0.80901699 0.50000000 0.00000 -0.80901699 0.50000000 -0.30901699 0.00000 -0.50000000 -0.30901699 0.80901699 0.00000 25 'point symmetry operation' ? ? 0.50000000 0.30901699 0.80901699 0.00000 0.30901699 0.80901699 -0.50000000 0.00000 -0.80901699 0.50000000 0.30901699 0.00000 26 'point symmetry operation' ? ? 0.00000000 0.00000000 1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 27 'point symmetry operation' ? ? -0.50000000 0.30901699 0.80901699 0.00000 -0.30901699 0.80901699 -0.50000000 0.00000 -0.80901699 -0.50000000 -0.30901699 0.00000 28 'point symmetry operation' ? ? -0.30901699 0.80901699 0.50000000 0.00000 0.80901699 0.50000000 -0.30901699 0.00000 -0.50000000 0.30901699 -0.80901699 0.00000 29 'point symmetry operation' ? ? 0.30901699 0.80901699 0.50000000 0.00000 0.80901699 -0.50000000 0.30901699 0.00000 0.50000000 0.30901699 -0.80901699 0.00000 30 'point symmetry operation' ? ? 0.50000000 0.30901699 0.80901699 0.00000 -0.30901699 -0.80901699 0.50000000 0.00000 0.80901699 -0.50000000 -0.30901699 0.00000 31 'point symmetry operation' ? ? 0.00000000 0.00000000 -1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 32 'point symmetry operation' ? ? 0.50000000 -0.30901699 -0.80901699 0.00000 -0.30901699 0.80901699 -0.50000000 0.00000 0.80901699 0.50000000 0.30901699 0.00000 33 'point symmetry operation' ? ? 0.30901699 -0.80901699 -0.50000000 0.00000 0.80901699 0.50000000 -0.30901699 0.00000 0.50000000 -0.30901699 0.80901699 0.00000 34 'point symmetry operation' ? ? -0.30901699 -0.80901699 -0.50000000 0.00000 0.80901699 -0.50000000 0.30901699 0.00000 -0.50000000 -0.30901699 0.80901699 0.00000 35 'point symmetry operation' ? ? -0.50000000 -0.30901699 -0.80901699 0.00000 -0.30901699 -0.80901699 0.50000000 0.00000 -0.80901699 0.50000000 0.30901699 0.00000 36 'point symmetry operation' ? ? 0.00000000 0.00000000 -1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 37 'point symmetry operation' ? ? 0.50000000 -0.30901699 -0.80901699 0.00000 0.30901699 -0.80901699 0.50000000 0.00000 -0.80901699 -0.50000000 -0.30901699 0.00000 38 'point symmetry operation' ? ? 0.30901699 -0.80901699 -0.50000000 0.00000 -0.80901699 -0.50000000 0.30901699 0.00000 -0.50000000 0.30901699 -0.80901699 0.00000 39 'point symmetry operation' ? ? -0.30901699 -0.80901699 -0.50000000 0.00000 -0.80901699 0.50000000 -0.30901699 0.00000 0.50000000 0.30901699 -0.80901699 0.00000 40 'point symmetry operation' ? ? -0.50000000 -0.30901699 -0.80901699 0.00000 0.30901699 0.80901699 -0.50000000 0.00000 0.80901699 -0.50000000 -0.30901699 0.00000 41 'point symmetry operation' ? ? 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 42 'point symmetry operation' ? ? 0.80901699 0.50000000 0.30901699 0.00000 -0.50000000 0.30901699 0.80901699 0.00000 0.30901699 -0.80901699 0.50000000 0.00000 43 'point symmetry operation' ? ? 0.50000000 -0.30901699 0.80901699 0.00000 -0.30901699 0.80901699 0.50000000 0.00000 -0.80901699 -0.50000000 0.30901699 0.00000 44 'point symmetry operation' ? ? -0.50000000 -0.30901699 0.80901699 0.00000 0.30901699 0.80901699 0.50000000 0.00000 -0.80901699 0.50000000 -0.30901699 0.00000 45 'point symmetry operation' ? ? -0.80901699 0.50000000 0.30901699 0.00000 0.50000000 0.30901699 0.80901699 0.00000 0.30901699 0.80901699 -0.50000000 0.00000 46 'point symmetry operation' ? ? 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 47 'point symmetry operation' ? ? -0.80901699 -0.50000000 -0.30901699 0.00000 -0.50000000 0.30901699 0.80901699 0.00000 -0.30901699 0.80901699 -0.50000000 0.00000 48 'point symmetry operation' ? ? -0.50000000 0.30901699 -0.80901699 0.00000 -0.30901699 0.80901699 0.50000000 0.00000 0.80901699 0.50000000 -0.30901699 0.00000 49 'point symmetry operation' ? ? 0.50000000 0.30901699 -0.80901699 0.00000 0.30901699 0.80901699 0.50000000 0.00000 0.80901699 -0.50000000 0.30901699 0.00000 50 'point symmetry operation' ? ? 0.80901699 -0.50000000 -0.30901699 0.00000 0.50000000 0.30901699 0.80901699 0.00000 -0.30901699 -0.80901699 0.50000000 0.00000 51 'point symmetry operation' ? ? 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 52 'point symmetry operation' ? ? 0.80901699 0.50000000 0.30901699 0.00000 0.50000000 -0.30901699 -0.80901699 0.00000 -0.30901699 0.80901699 -0.50000000 0.00000 53 'point symmetry operation' ? ? 0.50000000 -0.30901699 0.80901699 0.00000 0.30901699 -0.80901699 -0.50000000 0.00000 0.80901699 0.50000000 -0.30901699 0.00000 54 'point symmetry operation' ? ? -0.50000000 -0.30901699 0.80901699 0.00000 -0.30901699 -0.80901699 -0.50000000 0.00000 0.80901699 -0.50000000 0.30901699 0.00000 55 'point symmetry operation' ? ? -0.80901699 0.50000000 0.30901699 0.00000 -0.50000000 -0.30901699 -0.80901699 0.00000 -0.30901699 -0.80901699 0.50000000 0.00000 56 'point symmetry operation' ? ? 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 57 'point symmetry operation' ? ? -0.80901699 -0.50000000 -0.30901699 0.00000 0.50000000 -0.30901699 -0.80901699 0.00000 0.30901699 -0.80901699 0.50000000 0.00000 58 'point symmetry operation' ? ? -0.50000000 0.30901699 -0.80901699 0.00000 0.30901699 -0.80901699 -0.50000000 0.00000 -0.80901699 -0.50000000 0.30901699 0.00000 59 'point symmetry operation' ? ? 0.50000000 0.30901699 -0.80901699 0.00000 -0.30901699 -0.80901699 -0.50000000 0.00000 -0.80901699 0.50000000 -0.30901699 0.00000 60 'point symmetry operation' ? ? 0.80901699 -0.50000000 -0.30901699 0.00000 -0.50000000 -0.30901699 -0.80901699 0.00000 0.30901699 0.80901699 -0.50000000 0.00000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 73 ? THR A 81 ? VAL A 73 THR A 81 1 ? 9 HELX_P HELX_P2 AA2 LYS A 82 ? GLY A 84 ? LYS A 82 GLY A 84 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASN 31 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 31 A CA 202 1_555 ? ? ? ? ? ? ? 2.870 ? ? metalc2 metalc ? ? A ASP 171 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 171 A CA 201 1_555 ? ? ? ? ? ? ? 2.352 ? ? metalc3 metalc ? ? A GLU 173 O ? ? ? 1_555 B CA . CA ? ? A GLU 173 A CA 201 1_555 ? ? ? ? ? ? ? 2.340 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OD2 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id ASP _pdbx_struct_conn_angle.ptnr1_label_seq_id 171 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id ASP _pdbx_struct_conn_angle.ptnr1_auth_seq_id 171 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id CA _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id CA _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id CA _pdbx_struct_conn_angle.ptnr2_auth_seq_id 201 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id GLU _pdbx_struct_conn_angle.ptnr3_label_seq_id 173 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id GLU _pdbx_struct_conn_angle.ptnr3_auth_seq_id 173 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 92.2 _pdbx_struct_conn_angle.value_esd ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 52 ? ILE A 59 ? ARG A 52 ILE A 59 AA1 2 VAL A 162 ? ASP A 171 ? VAL A 162 ASP A 171 AA1 3 PRO A 88 ? TYR A 98 ? PRO A 88 TYR A 98 AA1 4 ALA A 128 ? LEU A 132 ? ALA A 128 LEU A 132 AA2 1 ILE A 68 ? THR A 72 ? ILE A 68 THR A 72 AA2 2 THR A 148 ? THR A 154 ? THR A 148 THR A 154 AA2 3 TYR A 104 ? ASP A 110 ? TYR A 104 ASP A 110 AA2 4 GLN A 116 ? GLY A 121 ? GLN A 116 GLY A 121 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 53 ? N LYS A 53 O TYR A 169 ? O TYR A 169 AA1 2 3 O VAL A 162 ? O VAL A 162 N TYR A 98 ? N TYR A 98 AA1 3 4 N ALA A 97 ? N ALA A 97 O ALA A 129 ? O ALA A 129 AA2 1 2 N TYR A 69 ? N TYR A 69 O ILE A 152 ? O ILE A 152 AA2 2 3 O THR A 153 ? O THR A 153 N VAL A 107 ? N VAL A 107 AA2 3 4 N LEU A 108 ? N LEU A 108 O VAL A 117 ? O VAL A 117 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 201 ? 3 'binding site for residue CA A 201' AC2 Software A CA 202 ? 1 'binding site for residue CA A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ASN A 50 ? ASN A 50 . ? 1_555 ? 2 AC1 3 ASP A 171 ? ASP A 171 . ? 1_555 ? 3 AC1 3 GLU A 173 ? GLU A 173 . ? 1_555 ? 4 AC2 1 ASN A 31 ? ASN A 31 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LYS 87 ? ? HG A SER 172 ? ? 1.57 2 1 OD1 A ASP 60 ? ? H A LEU 61 ? ? 1.58 3 1 OE2 A GLU 93 ? ? OG1 A THR 168 ? ? 1.97 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 61 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 61.62 _pdbx_validate_torsion.psi 71.58 # _pdbx_point_symmetry.entry_id 6JJA _pdbx_point_symmetry.Schoenflies_symbol I # _em_3d_fitting.entry_id 6JJA _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol 'AB INITIO MODEL' _em_3d_fitting.ref_space REAL _em_3d_fitting.target_criteria 'Correlation coefficient' _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 6JJA _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm 'BACK PROJECTION' _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 10755 _em_3d_reconstruction.resolution 2.91 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 8 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name Viruses _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type VIRUS _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_image_scans.entry_id 6JJA _em_image_scans.id 1 _em_image_scans.dimension_height 4096 _em_image_scans.dimension_width 4096 _em_image_scans.frames_per_image ? _em_image_scans.image_recording_id 1 _em_image_scans.sampling_size ? _em_image_scans.scanner_model ? _em_image_scans.used_frames_per_image ? _em_image_scans.citation_id ? _em_image_scans.number_digital_images ? _em_image_scans.od_range ? _em_image_scans.quant_bit_size ? _em_image_scans.details ? # _em_imaging.id 1 _em_imaging.entry_id 6JJA _em_imaging.accelerating_voltage 200 _em_imaging.alignment_procedure 'COMA FREE' _em_imaging.c2_aperture_diameter 50 _em_imaging.calibrated_defocus_max 3030 _em_imaging.calibrated_defocus_min 510 _em_imaging.calibrated_magnification ? _em_imaging.cryogen NITROGEN _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TALOS ARCTICA' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 2.7 _em_imaging.nominal_defocus_max ? _em_imaging.nominal_defocus_min ? _em_imaging.nominal_magnification 120000 _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.details ? _em_sample_support.grid_material COPPER _em_sample_support.grid_mesh_size 200 _em_sample_support.grid_type 'Quantifoil R1.2/1.3' _em_sample_support.method ? _em_sample_support.film_material ? # _em_virus_entity.entity_assembly_id 1 _em_virus_entity.empty NO _em_virus_entity.enveloped NO _em_virus_entity.virus_isolate STRAIN _em_virus_entity.virus_type 'VIRUS-LIKE PARTICLE' _em_virus_entity.id 1 _em_virus_entity.virus_host_category ? _em_virus_entity.details ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature 277 _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity 100 _em_vitrification.instrument 'FEI VITROBOT MARK IV' _em_vitrification.entry_id 6JJA _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 6JJA _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # _em_single_particle_entity.entry_id 6JJA _em_single_particle_entity.id 1 _em_single_particle_entity.image_processing_id 1 _em_single_particle_entity.point_symmetry I # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A ARG 4 ? A ARG 4 5 1 Y 1 A ILE 5 ? A ILE 5 6 1 Y 1 A ASN 6 ? A ASN 6 7 1 Y 1 A ASN 7 ? A ASN 7 8 1 Y 1 A ASN 8 ? A ASN 8 9 1 Y 1 A ARG 9 ? A ARG 9 10 1 Y 1 A ARG 10 ? A ARG 10 11 1 Y 1 A THR 11 ? A THR 11 12 1 Y 1 A MET 12 ? A MET 12 13 1 Y 1 A ARG 13 ? A ARG 13 14 1 Y 1 A SER 14 ? A SER 14 15 1 Y 1 A ARG 15 ? A ARG 15 16 1 Y 1 A ARG 16 ? A ARG 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A ARG 18 ? A ARG 18 19 1 Y 1 A GLY 19 ? A GLY 19 20 1 Y 1 A ARG 20 ? A ARG 20 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 PRO N N N N 257 PRO CA C N S 258 PRO C C N N 259 PRO O O N N 260 PRO CB C N N 261 PRO CG C N N 262 PRO CD C N N 263 PRO OXT O N N 264 PRO H H N N 265 PRO HA H N N 266 PRO HB2 H N N 267 PRO HB3 H N N 268 PRO HG2 H N N 269 PRO HG3 H N N 270 PRO HD2 H N N 271 PRO HD3 H N N 272 PRO HXT H N N 273 SER N N N N 274 SER CA C N S 275 SER C C N N 276 SER O O N N 277 SER CB C N N 278 SER OG O N N 279 SER OXT O N N 280 SER H H N N 281 SER H2 H N N 282 SER HA H N N 283 SER HB2 H N N 284 SER HB3 H N N 285 SER HG H N N 286 SER HXT H N N 287 THR N N N N 288 THR CA C N S 289 THR C C N N 290 THR O O N N 291 THR CB C N R 292 THR OG1 O N N 293 THR CG2 C N N 294 THR OXT O N N 295 THR H H N N 296 THR H2 H N N 297 THR HA H N N 298 THR HB H N N 299 THR HG1 H N N 300 THR HG21 H N N 301 THR HG22 H N N 302 THR HG23 H N N 303 THR HXT H N N 304 TRP N N N N 305 TRP CA C N S 306 TRP C C N N 307 TRP O O N N 308 TRP CB C N N 309 TRP CG C Y N 310 TRP CD1 C Y N 311 TRP CD2 C Y N 312 TRP NE1 N Y N 313 TRP CE2 C Y N 314 TRP CE3 C Y N 315 TRP CZ2 C Y N 316 TRP CZ3 C Y N 317 TRP CH2 C Y N 318 TRP OXT O N N 319 TRP H H N N 320 TRP H2 H N N 321 TRP HA H N N 322 TRP HB2 H N N 323 TRP HB3 H N N 324 TRP HD1 H N N 325 TRP HE1 H N N 326 TRP HE3 H N N 327 TRP HZ2 H N N 328 TRP HZ3 H N N 329 TRP HH2 H N N 330 TRP HXT H N N 331 TYR N N N N 332 TYR CA C N S 333 TYR C C N N 334 TYR O O N N 335 TYR CB C N N 336 TYR CG C Y N 337 TYR CD1 C Y N 338 TYR CD2 C Y N 339 TYR CE1 C Y N 340 TYR CE2 C Y N 341 TYR CZ C Y N 342 TYR OH O N N 343 TYR OXT O N N 344 TYR H H N N 345 TYR H2 H N N 346 TYR HA H N N 347 TYR HB2 H N N 348 TYR HB3 H N N 349 TYR HD1 H N N 350 TYR HD2 H N N 351 TYR HE1 H N N 352 TYR HE2 H N N 353 TYR HH H N N 354 TYR HXT H N N 355 VAL N N N N 356 VAL CA C N S 357 VAL C C N N 358 VAL O O N N 359 VAL CB C N N 360 VAL CG1 C N N 361 VAL CG2 C N N 362 VAL OXT O N N 363 VAL H H N N 364 VAL H2 H N N 365 VAL HA H N N 366 VAL HB H N N 367 VAL HG11 H N N 368 VAL HG12 H N N 369 VAL HG13 H N N 370 VAL HG21 H N N 371 VAL HG22 H N N 372 VAL HG23 H N N 373 VAL HXT H N N 374 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _em_buffer_component.buffer_id _em_buffer_component.id _em_buffer_component.concentration _em_buffer_component.concentration_units _em_buffer_component.formula _em_buffer_component.name 1 1 50 mM NaCl 'Sodium chloride' 1 2 50 mM Tris Tris 1 3 1 mM CaCl2 'Calcium chloride' # _em_crystal_formation.id 1 _em_crystal_formation.specimen_id 1 _em_crystal_formation.atmosphere ? _em_crystal_formation.details ? _em_crystal_formation.instrument ? _em_crystal_formation.lipid_mixture ? _em_crystal_formation.lipid_protein_ratio ? _em_crystal_formation.temperature ? _em_crystal_formation.time ? _em_crystal_formation.time_unit ? # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING ONLY' _em_ctf_correction.details ? # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.units MEGADALTONS _em_entity_assembly_molwt.value 1.062 # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 10239 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism Viruses _em_entity_assembly_naturalsource.strain 'Macrobrachium rosenbergii extra small virus (Taiwan strain)' _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.ncbi_tax_id 469008 _em_entity_assembly_recombinant.organism 'Escherichia coli BL21(DE3)' _em_entity_assembly_recombinant.plasmid pETDuet-1 _em_entity_assembly_recombinant.strain ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 100 _em_image_recording.average_exposure_time 5 _em_image_recording.details ? _em_image_recording.detector_mode INTEGRATING _em_image_recording.film_or_detector_model 'FEI FALCON III (4k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images 998 # _em_imaging_optics.id 1 _em_imaging_optics.imaging_id 1 _em_imaging_optics.chr_aberration_corrector ? _em_imaging_optics.energyfilter_lower ? _em_imaging_optics.energyfilter_name ? _em_imaging_optics.energyfilter_upper ? _em_imaging_optics.energyfilter_slit_width ? _em_imaging_optics.phase_plate ? _em_imaging_optics.sph_aberration_corrector ? # _em_particle_selection.id 1 _em_particle_selection.image_processing_id 1 _em_particle_selection.details ? _em_particle_selection.method ? _em_particle_selection.num_particles_selected 10755 _em_particle_selection.reference_model ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'CRYSTALLOGRAPHY MERGING' ? ? ? 1 1 1 2 'IMAGE ACQUISITION' ? EPU 1.11.1.50REL ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? RELION 2.0 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? 'UCSF Chimera' 1.11.2 ? 1 ? 8 OTHER ? ? ? ? ? ? 9 'INITIAL EULER ASSIGNMENT' ? RELION 2.0 1 ? ? 10 'FINAL EULER ASSIGNMENT' ? RELION 2.0 1 ? ? 11 CLASSIFICATION ? RELION 2.0 1 ? ? 12 RECONSTRUCTION ? RELION 2.0 1 ? ? 13 'MODEL REFINEMENT' ? PHENIX 3374 ? 1 ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration 10 _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _em_virus_natural_host.id 1 _em_virus_natural_host.entity_assembly_id 1 _em_virus_natural_host.ncbi_tax_id 79674 _em_virus_natural_host.organism 'Macrobrachium rosenbergii' _em_virus_natural_host.strain ? # _em_virus_shell.id 1 _em_virus_shell.entity_assembly_id 1 _em_virus_shell.diameter 188 _em_virus_shell.name 'capsid protein' _em_virus_shell.triangulation 1 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Science and Technology (Taiwan)' Taiwan 'MOST 103-2321-B-001-048' 1 'Ministry of Science and Technology (Taiwan)' Taiwan 'MOST 104-2321-B-001-019' 2 'Ministry of Science and Technology (Taiwan)' Taiwan 'MOST 105-2321-B-001-009' 3 'Ministry of Science and Technology (Taiwan)' Taiwan 'MOST 106-0210-01-15-02' 4 'Ministry of Science and Technology (Taiwan)' Taiwan 'MOST 106-0210-01-15-04' 5 'Ministry of Science and Technology (Taiwan)' Taiwan 'MOST 107-0210-01-19-01' 6 'Ministry of Science and Technology (Taiwan)' Taiwan 'MOST 107-0210-01-19-02' 7 # _atom_sites.entry_id 6JJA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_