data_6JN1 # _entry.id 6JN1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6JN1 pdb_00006jn1 10.2210/pdb6jn1/pdb WWPDB D_1300011412 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6JN1 _pdbx_database_status.recvd_initial_deposition_date 2019-03-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Min, K.J.' 1 0000-0002-9864-2022 'An, D.R.' 2 ? 'Yoon, H.J.' 3 ? 'Suh, S.W.' 4 ? 'Lee, H.H.' 5 0000-0003-1168-2484 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 458 _citation.page_last 458 _citation.title 'Peptidoglycan reshaping by a noncanonical peptidase for helical cell shape in Campylobacter jejuni.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-019-13934-4 _citation.pdbx_database_id_PubMed 31974386 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Min, K.' 1 0000-0002-9864-2022 primary 'An, D.R.' 2 ? primary 'Yoon, H.J.' 3 ? primary 'Rana, N.' 4 ? primary 'Park, J.S.' 5 ? primary 'Kim, J.' 6 ? primary 'Lee, M.' 7 0000-0001-7432-0427 primary 'Hesek, D.' 8 ? primary 'Ryu, S.' 9 0000-0001-5812-3394 primary 'Kim, B.M.' 10 ? primary 'Mobashery, S.' 11 ? primary 'Suh, S.W.' 12 ? primary 'Lee, H.H.' 13 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6JN1 _cell.details ? _cell.formula_units_Z ? _cell.length_a 114.256 _cell.length_a_esd ? _cell.length_b 114.256 _cell.length_b_esd ? _cell.length_c 55.880 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6JN1 _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidase M23' 28350.596 1 ? H247A ? ? 2 polymer syn C0O-DAL-DAL 330.337 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 water nat water 18.015 99 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MELIKGQALFLELDKKDFLSLKNNDKNIPTFAHPKNQEKILAIFSLPYKNPPQNTKLIAFYKDKKEEIFIKTLEGNYKSE KLQVENKKIFPPKTIQERIAKELKEANAIYSSYTPKALFNGAFNIPLNSFITSDFGKARTFNEKVASYHSGTDFRAATGT PIYAANSGVVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKIDVKVGQKIKKGELIGLSGASGRVSGPALHFGILAGGKQV DPLDFVSKFNAIFQ ; ;MELIKGQALFLELDKKDFLSLKNNDKNIPTFAHPKNQEKILAIFSLPYKNPPQNTKLIAFYKDKKEEIFIKTLEGNYKSE KLQVENKKIFPPKTIQERIAKELKEANAIYSSYTPKALFNGAFNIPLNSFITSDFGKARTFNEKVASYHSGTDFRAATGT PIYAANSGVVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKIDVKVGQKIKKGELIGLSGASGRVSGPALHFGILAGGKQV DPLDFVSKFNAIFQ ; A ? 2 'polypeptide(D)' no yes '(C0O)(DAL)(DAL)' XAA B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LEU n 1 4 ILE n 1 5 LYS n 1 6 GLY n 1 7 GLN n 1 8 ALA n 1 9 LEU n 1 10 PHE n 1 11 LEU n 1 12 GLU n 1 13 LEU n 1 14 ASP n 1 15 LYS n 1 16 LYS n 1 17 ASP n 1 18 PHE n 1 19 LEU n 1 20 SER n 1 21 LEU n 1 22 LYS n 1 23 ASN n 1 24 ASN n 1 25 ASP n 1 26 LYS n 1 27 ASN n 1 28 ILE n 1 29 PRO n 1 30 THR n 1 31 PHE n 1 32 ALA n 1 33 HIS n 1 34 PRO n 1 35 LYS n 1 36 ASN n 1 37 GLN n 1 38 GLU n 1 39 LYS n 1 40 ILE n 1 41 LEU n 1 42 ALA n 1 43 ILE n 1 44 PHE n 1 45 SER n 1 46 LEU n 1 47 PRO n 1 48 TYR n 1 49 LYS n 1 50 ASN n 1 51 PRO n 1 52 PRO n 1 53 GLN n 1 54 ASN n 1 55 THR n 1 56 LYS n 1 57 LEU n 1 58 ILE n 1 59 ALA n 1 60 PHE n 1 61 TYR n 1 62 LYS n 1 63 ASP n 1 64 LYS n 1 65 LYS n 1 66 GLU n 1 67 GLU n 1 68 ILE n 1 69 PHE n 1 70 ILE n 1 71 LYS n 1 72 THR n 1 73 LEU n 1 74 GLU n 1 75 GLY n 1 76 ASN n 1 77 TYR n 1 78 LYS n 1 79 SER n 1 80 GLU n 1 81 LYS n 1 82 LEU n 1 83 GLN n 1 84 VAL n 1 85 GLU n 1 86 ASN n 1 87 LYS n 1 88 LYS n 1 89 ILE n 1 90 PHE n 1 91 PRO n 1 92 PRO n 1 93 LYS n 1 94 THR n 1 95 ILE n 1 96 GLN n 1 97 GLU n 1 98 ARG n 1 99 ILE n 1 100 ALA n 1 101 LYS n 1 102 GLU n 1 103 LEU n 1 104 LYS n 1 105 GLU n 1 106 ALA n 1 107 ASN n 1 108 ALA n 1 109 ILE n 1 110 TYR n 1 111 SER n 1 112 SER n 1 113 TYR n 1 114 THR n 1 115 PRO n 1 116 LYS n 1 117 ALA n 1 118 LEU n 1 119 PHE n 1 120 ASN n 1 121 GLY n 1 122 ALA n 1 123 PHE n 1 124 ASN n 1 125 ILE n 1 126 PRO n 1 127 LEU n 1 128 ASN n 1 129 SER n 1 130 PHE n 1 131 ILE n 1 132 THR n 1 133 SER n 1 134 ASP n 1 135 PHE n 1 136 GLY n 1 137 LYS n 1 138 ALA n 1 139 ARG n 1 140 THR n 1 141 PHE n 1 142 ASN n 1 143 GLU n 1 144 LYS n 1 145 VAL n 1 146 ALA n 1 147 SER n 1 148 TYR n 1 149 HIS n 1 150 SER n 1 151 GLY n 1 152 THR n 1 153 ASP n 1 154 PHE n 1 155 ARG n 1 156 ALA n 1 157 ALA n 1 158 THR n 1 159 GLY n 1 160 THR n 1 161 PRO n 1 162 ILE n 1 163 TYR n 1 164 ALA n 1 165 ALA n 1 166 ASN n 1 167 SER n 1 168 GLY n 1 169 VAL n 1 170 VAL n 1 171 LYS n 1 172 ILE n 1 173 ALA n 1 174 LYS n 1 175 ASP n 1 176 ARG n 1 177 TYR n 1 178 PHE n 1 179 ALA n 1 180 GLY n 1 181 ASN n 1 182 SER n 1 183 VAL n 1 184 VAL n 1 185 ILE n 1 186 ASP n 1 187 HIS n 1 188 GLY n 1 189 PHE n 1 190 GLY n 1 191 ILE n 1 192 TYR n 1 193 SER n 1 194 GLN n 1 195 TYR n 1 196 TYR n 1 197 HIS n 1 198 LEU n 1 199 SER n 1 200 LYS n 1 201 ILE n 1 202 ASP n 1 203 VAL n 1 204 LYS n 1 205 VAL n 1 206 GLY n 1 207 GLN n 1 208 LYS n 1 209 ILE n 1 210 LYS n 1 211 LYS n 1 212 GLY n 1 213 GLU n 1 214 LEU n 1 215 ILE n 1 216 GLY n 1 217 LEU n 1 218 SER n 1 219 GLY n 1 220 ALA n 1 221 SER n 1 222 GLY n 1 223 ARG n 1 224 VAL n 1 225 SER n 1 226 GLY n 1 227 PRO n 1 228 ALA n 1 229 LEU n 1 230 HIS n 1 231 PHE n 1 232 GLY n 1 233 ILE n 1 234 LEU n 1 235 ALA n 1 236 GLY n 1 237 GLY n 1 238 LYS n 1 239 GLN n 1 240 VAL n 1 241 ASP n 1 242 PRO n 1 243 LEU n 1 244 ASP n 1 245 PHE n 1 246 VAL n 1 247 SER n 1 248 LYS n 1 249 PHE n 1 250 ASN n 1 251 ALA n 1 252 ILE n 1 253 PHE n 1 254 GLN n 2 1 C0O n 2 2 DAL n 2 3 DAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 254 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene A8118_01115 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Campylobacter jejuni' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 197 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP A0A1J6PWI8_CAMJU A0A1J6PWI8 ? 1 ;ELIKGQALFLELDKKDFLSLKNNDKNIPTFAHPKNQEKILAIFSLPYKNPPQNTKLIAFYKDKKEEIFIKTLEGNYKSEK LQVENKKIFPPKTIQERIAKELKEANAIYSSYTPKALFNGAFNIPLNSFITSDFGKARTFNEKVASYHSGTDFRAATGTP IYAANSGVVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKIDVKVGQKIKKGELIGLSGASGRVSGPHLHFGILAGGKQVD PLDFVSKFNAIFQ ; 21 2 PDB 6JN1 6JN1 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6JN1 A 2 ? 254 ? A0A1J6PWI8 21 ? 273 ? 21 273 2 2 6JN1 B 1 ? 3 ? 6JN1 1 ? 3 ? 1 3 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6JN1 MET A 1 ? UNP A0A1J6PWI8 ? ? 'initiating methionine' 20 1 1 6JN1 ALA A 228 ? UNP A0A1J6PWI8 HIS 247 'engineered mutation' 247 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C0O 'L-peptide linking' . '(~{Z},2~{R},6~{S})-2,6-bis(azanyl)hept-3-enedioic acid' ? 'C7 H12 N2 O4' 188.181 DAL 'D-peptide linking' . D-ALANINE ? 'C3 H7 N O2' 89.093 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6JN1 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.72 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.90 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.8 M ammonium citrate tribasic at pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-12-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6JN1 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.38 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20960 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.500 _reflns.pdbx_Rmerge_I_obs 0.173 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 4.661 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.204 _reflns.pdbx_Rpim_I_all 0.108 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.750 2.800 ? ? ? ? ? ? 1069 99.900 ? ? ? ? 0.821 ? ? ? ? ? ? ? ? 3.900 ? 2.055 ? ? 0.952 0.476 ? 1 1 0.640 ? ? 2.800 2.850 ? ? ? ? ? ? 1039 99.800 ? ? ? ? 0.708 ? ? ? ? ? ? ? ? 3.800 ? 2.082 ? ? 0.825 0.418 ? 2 1 0.738 ? ? 2.850 2.900 ? ? ? ? ? ? 1071 100.000 ? ? ? ? 0.733 ? ? ? ? ? ? ? ? 3.800 ? 2.120 ? ? 0.852 0.430 ? 3 1 0.744 ? ? 2.900 2.960 ? ? ? ? ? ? 1099 99.900 ? ? ? ? 0.588 ? ? ? ? ? ? ? ? 3.800 ? 2.344 ? ? 0.684 0.344 ? 4 1 0.809 ? ? 2.960 3.030 ? ? ? ? ? ? 1035 99.700 ? ? ? ? 0.535 ? ? ? ? ? ? ? ? 3.800 ? 2.904 ? ? 0.624 0.318 ? 5 1 0.767 ? ? 3.030 3.100 ? ? ? ? ? ? 1059 100.000 ? ? ? ? 0.467 ? ? ? ? ? ? ? ? 3.800 ? 2.748 ? ? 0.543 0.274 ? 6 1 0.846 ? ? 3.100 3.170 ? ? ? ? ? ? 1064 99.900 ? ? ? ? 0.401 ? ? ? ? ? ? ? ? 3.700 ? 2.642 ? ? 0.468 0.239 ? 7 1 0.878 ? ? 3.170 3.260 ? ? ? ? ? ? 1077 99.700 ? ? ? ? 0.361 ? ? ? ? ? ? ? ? 3.700 ? 2.896 ? ? 0.423 0.217 ? 8 1 0.919 ? ? 3.260 3.360 ? ? ? ? ? ? 1053 99.300 ? ? ? ? 0.271 ? ? ? ? ? ? ? ? 3.600 ? 3.347 ? ? 0.317 0.163 ? 9 1 0.940 ? ? 3.360 3.460 ? ? ? ? ? ? 1067 99.300 ? ? ? ? 0.228 ? ? ? ? ? ? ? ? 3.500 ? 3.722 ? ? 0.269 0.140 ? 10 1 0.959 ? ? 3.460 3.590 ? ? ? ? ? ? 1027 98.500 ? ? ? ? 0.195 ? ? ? ? ? ? ? ? 3.300 ? 4.151 ? ? 0.232 0.124 ? 11 1 0.953 ? ? 3.590 3.730 ? ? ? ? ? ? 1062 98.300 ? ? ? ? 0.184 ? ? ? ? ? ? ? ? 3.200 ? 5.655 ? ? 0.220 0.119 ? 12 1 0.953 ? ? 3.730 3.900 ? ? ? ? ? ? 1026 97.200 ? ? ? ? 0.175 ? ? ? ? ? ? ? ? 3.100 ? 10.211 ? ? 0.210 0.114 ? 13 1 0.940 ? ? 3.900 4.110 ? ? ? ? ? ? 1055 98.000 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? 3.100 ? 6.028 ? ? 0.163 0.089 ? 14 1 0.970 ? ? 4.110 4.360 ? ? ? ? ? ? 1019 96.800 ? ? ? ? 0.114 ? ? ? ? ? ? ? ? 3.100 ? 7.930 ? ? 0.138 0.075 ? 15 1 0.975 ? ? 4.360 4.700 ? ? ? ? ? ? 1031 95.200 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 2.900 ? 9.116 ? ? 0.115 0.065 ? 16 1 0.983 ? ? 4.700 5.170 ? ? ? ? ? ? 1024 98.100 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 3.200 ? 6.648 ? ? 0.115 0.063 ? 17 1 0.985 ? ? 5.170 5.920 ? ? ? ? ? ? 1036 97.700 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 3.400 ? 6.693 ? ? 0.112 0.060 ? 18 1 0.980 ? ? 5.920 7.460 ? ? ? ? ? ? 1047 97.900 ? ? ? ? 0.090 ? ? ? ? ? ? ? ? 3.500 ? 6.181 ? ? 0.107 0.057 ? 19 1 0.981 ? ? 7.460 50.000 ? ? ? ? ? ? 1000 92.900 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 3.200 ? 10.462 ? ? 0.103 0.056 ? 20 1 0.977 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 198.940 _refine.B_iso_mean 60.7734 _refine.B_iso_min 28.510 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6JN1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.382 _refine.ls_d_res_low 28.5640 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16604 _refine.ls_number_reflns_R_free 876 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.5000 _refine.ls_percent_reflns_R_free 5.2800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1807 _refine.ls_R_factor_R_free 0.2255 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1783 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.4200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.382 _refine_hist.d_res_low 28.5640 _refine_hist.number_atoms_solvent 99 _refine_hist.number_atoms_total 2129 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 254 _refine_hist.pdbx_B_iso_mean_ligand 84.91 _refine_hist.pdbx_B_iso_mean_solvent 60.77 _refine_hist.pdbx_number_atoms_protein 2006 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3810 2.5300 . . 155 2519 96.0000 . . . 0.3039 0.0000 0.2410 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5300 2.7252 . . 156 2608 100.0000 . . . 0.2818 0.0000 0.2215 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7252 2.9991 . . 169 2618 100.0000 . . . 0.2509 0.0000 0.2021 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9991 3.4325 . . 113 2678 99.0000 . . . 0.2303 0.0000 0.1848 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4325 4.3222 . . 144 2637 99.0000 . . . 0.2241 0.0000 0.1490 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3222 28.5640 . . 139 2668 98.0000 . . . 0.1892 0.0000 0.1728 . . . . . . . . . . . # _struct.entry_id 6JN1 _struct.title 'Structure of H247A mutant peptidoglycan peptidase complex with penta peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6JN1 _struct_keywords.text 'Peptidoglycan, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 92 ? SER A 112 ? PRO A 111 SER A 131 1 ? 21 HELX_P HELX_P2 AA2 ASP A 241 ? GLN A 254 ? ASP A 260 GLN A 273 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B C0O 1 C ? ? ? 1_555 B DAL 2 N ? ? B C0O 1 B DAL 2 1_555 ? ? ? ? ? ? ? 1.486 ? ? covale2 covale both ? B DAL 2 C ? ? ? 1_555 B DAL 3 N ? ? B DAL 2 B DAL 3 1_555 ? ? ? ? ? ? ? 1.459 ? ? metalc1 metalc ? ? A HIS 149 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 168 A ZN 300 1_555 ? ? ? ? ? ? ? 2.047 ? ? metalc2 metalc ? ? A ASP 153 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 172 A ZN 300 1_555 ? ? ? ? ? ? ? 2.077 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 142 A . ? ASN 161 A GLU 143 A ? GLU 162 A 1 11.77 2 DAL 2 B . ? DAL 2 B DAL 3 B ? DAL 3 B 1 0.43 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 3 ? AA4 ? 7 ? AA5 ? 4 ? AA6 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel AA4 6 7 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 2 ? ILE A 4 ? GLU A 21 ILE A 23 AA1 2 LYS A 65 ? LEU A 73 ? LYS A 84 LEU A 92 AA1 3 ASN A 54 ? TYR A 61 ? ASN A 73 TYR A 80 AA1 4 PHE A 18 ? ASN A 23 ? PHE A 37 ASN A 42 AA1 5 LYS A 26 ? ASN A 27 ? LYS A 45 ASN A 46 AA2 1 ALA A 8 ? ASP A 14 ? ALA A 27 ASP A 33 AA2 2 LYS A 39 ? SER A 45 ? LYS A 58 SER A 64 AA2 3 PHE A 31 ? ALA A 32 ? PHE A 50 ALA A 51 AA3 1 SER A 79 ? LYS A 81 ? SER A 98 LYS A 100 AA3 2 ALA A 138 ? THR A 140 ? ALA A 157 THR A 159 AA3 3 SER A 147 ? TYR A 148 ? SER A 166 TYR A 167 AA4 1 ILE A 131 ? SER A 133 ? ILE A 150 SER A 152 AA4 2 THR A 152 ? PHE A 154 ? THR A 171 PHE A 173 AA4 3 LEU A 229 ? ALA A 235 ? LEU A 248 ALA A 254 AA4 4 ILE A 191 ? LEU A 198 ? ILE A 210 LEU A 217 AA4 5 GLY A 180 ? GLY A 188 ? GLY A 199 GLY A 207 AA4 6 GLY A 168 ? ARG A 176 ? GLY A 187 ARG A 195 AA4 7 LYS A 208 ? ILE A 209 ? LYS A 227 ILE A 228 AA5 1 ILE A 131 ? SER A 133 ? ILE A 150 SER A 152 AA5 2 THR A 152 ? PHE A 154 ? THR A 171 PHE A 173 AA5 3 LEU A 229 ? ALA A 235 ? LEU A 248 ALA A 254 AA5 4 LYS A 238 ? VAL A 240 ? LYS A 257 VAL A 259 AA6 1 PRO A 161 ? TYR A 163 ? PRO A 180 TYR A 182 AA6 2 LEU A 214 ? LEU A 217 ? LEU A 233 LEU A 236 AA6 3 LYS A 200 ? ILE A 201 ? LYS A 219 ILE A 220 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 3 ? N LEU A 22 O LEU A 73 ? O LEU A 92 AA1 2 3 O ILE A 68 ? O ILE A 87 N LEU A 57 ? N LEU A 76 AA1 3 4 O PHE A 60 ? O PHE A 79 N SER A 20 ? N SER A 39 AA1 4 5 N ASN A 23 ? N ASN A 42 O LYS A 26 ? O LYS A 45 AA2 1 2 N LEU A 9 ? N LEU A 28 O PHE A 44 ? O PHE A 63 AA2 2 3 O LEU A 41 ? O LEU A 60 N PHE A 31 ? N PHE A 50 AA3 1 2 N GLU A 80 ? N GLU A 99 O THR A 140 ? O THR A 159 AA3 2 3 N ARG A 139 ? N ARG A 158 O SER A 147 ? O SER A 166 AA4 1 2 N SER A 133 ? N SER A 152 O ASP A 153 ? O ASP A 172 AA4 2 3 N THR A 152 ? N THR A 171 O PHE A 231 ? O PHE A 250 AA4 3 4 O LEU A 234 ? O LEU A 253 N TYR A 192 ? N TYR A 211 AA4 4 5 O ILE A 191 ? O ILE A 210 N HIS A 187 ? N HIS A 206 AA4 5 6 O VAL A 184 ? O VAL A 203 N LYS A 171 ? N LYS A 190 AA4 6 7 N GLY A 168 ? N GLY A 187 O ILE A 209 ? O ILE A 228 AA5 1 2 N SER A 133 ? N SER A 152 O ASP A 153 ? O ASP A 172 AA5 2 3 N THR A 152 ? N THR A 171 O PHE A 231 ? O PHE A 250 AA5 3 4 N ALA A 235 ? N ALA A 254 O LYS A 238 ? O LYS A 257 AA6 1 2 N ILE A 162 ? N ILE A 181 O ILE A 215 ? O ILE A 234 AA6 2 3 O LEU A 217 ? O LEU A 236 N LYS A 200 ? N LYS A 219 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 300 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue ZN A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 149 ? HIS A 168 . ? 1_555 ? 2 AC1 4 ASP A 153 ? ASP A 172 . ? 1_555 ? 3 AC1 4 HIS A 230 ? HIS A 249 . ? 1_555 ? 4 AC1 4 HOH E . ? HOH B 102 . ? 1_555 ? # _atom_sites.entry_id 6JN1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008752 _atom_sites.fract_transf_matrix[1][2] 0.005053 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010106 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017895 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 20 20 MET MET A . n A 1 2 GLU 2 21 21 GLU GLU A . n A 1 3 LEU 3 22 22 LEU LEU A . n A 1 4 ILE 4 23 23 ILE ILE A . n A 1 5 LYS 5 24 24 LYS LYS A . n A 1 6 GLY 6 25 25 GLY GLY A . n A 1 7 GLN 7 26 26 GLN GLN A . n A 1 8 ALA 8 27 27 ALA ALA A . n A 1 9 LEU 9 28 28 LEU LEU A . n A 1 10 PHE 10 29 29 PHE PHE A . n A 1 11 LEU 11 30 30 LEU LEU A . n A 1 12 GLU 12 31 31 GLU GLU A . n A 1 13 LEU 13 32 32 LEU LEU A . n A 1 14 ASP 14 33 33 ASP ASP A . n A 1 15 LYS 15 34 34 LYS LYS A . n A 1 16 LYS 16 35 35 LYS LYS A . n A 1 17 ASP 17 36 36 ASP ASP A . n A 1 18 PHE 18 37 37 PHE PHE A . n A 1 19 LEU 19 38 38 LEU LEU A . n A 1 20 SER 20 39 39 SER SER A . n A 1 21 LEU 21 40 40 LEU LEU A . n A 1 22 LYS 22 41 41 LYS LYS A . n A 1 23 ASN 23 42 42 ASN ASN A . n A 1 24 ASN 24 43 43 ASN ASN A . n A 1 25 ASP 25 44 44 ASP ASP A . n A 1 26 LYS 26 45 45 LYS LYS A . n A 1 27 ASN 27 46 46 ASN ASN A . n A 1 28 ILE 28 47 47 ILE ILE A . n A 1 29 PRO 29 48 48 PRO PRO A . n A 1 30 THR 30 49 49 THR THR A . n A 1 31 PHE 31 50 50 PHE PHE A . n A 1 32 ALA 32 51 51 ALA ALA A . n A 1 33 HIS 33 52 52 HIS HIS A . n A 1 34 PRO 34 53 53 PRO PRO A . n A 1 35 LYS 35 54 54 LYS LYS A . n A 1 36 ASN 36 55 55 ASN ASN A . n A 1 37 GLN 37 56 56 GLN GLN A . n A 1 38 GLU 38 57 57 GLU GLU A . n A 1 39 LYS 39 58 58 LYS LYS A . n A 1 40 ILE 40 59 59 ILE ILE A . n A 1 41 LEU 41 60 60 LEU LEU A . n A 1 42 ALA 42 61 61 ALA ALA A . n A 1 43 ILE 43 62 62 ILE ILE A . n A 1 44 PHE 44 63 63 PHE PHE A . n A 1 45 SER 45 64 64 SER SER A . n A 1 46 LEU 46 65 65 LEU LEU A . n A 1 47 PRO 47 66 66 PRO PRO A . n A 1 48 TYR 48 67 67 TYR TYR A . n A 1 49 LYS 49 68 68 LYS LYS A . n A 1 50 ASN 50 69 69 ASN ASN A . n A 1 51 PRO 51 70 70 PRO PRO A . n A 1 52 PRO 52 71 71 PRO PRO A . n A 1 53 GLN 53 72 72 GLN GLN A . n A 1 54 ASN 54 73 73 ASN ASN A . n A 1 55 THR 55 74 74 THR THR A . n A 1 56 LYS 56 75 75 LYS LYS A . n A 1 57 LEU 57 76 76 LEU LEU A . n A 1 58 ILE 58 77 77 ILE ILE A . n A 1 59 ALA 59 78 78 ALA ALA A . n A 1 60 PHE 60 79 79 PHE PHE A . n A 1 61 TYR 61 80 80 TYR TYR A . n A 1 62 LYS 62 81 81 LYS LYS A . n A 1 63 ASP 63 82 82 ASP ASP A . n A 1 64 LYS 64 83 83 LYS LYS A . n A 1 65 LYS 65 84 84 LYS LYS A . n A 1 66 GLU 66 85 85 GLU GLU A . n A 1 67 GLU 67 86 86 GLU GLU A . n A 1 68 ILE 68 87 87 ILE ILE A . n A 1 69 PHE 69 88 88 PHE PHE A . n A 1 70 ILE 70 89 89 ILE ILE A . n A 1 71 LYS 71 90 90 LYS LYS A . n A 1 72 THR 72 91 91 THR THR A . n A 1 73 LEU 73 92 92 LEU LEU A . n A 1 74 GLU 74 93 93 GLU GLU A . n A 1 75 GLY 75 94 94 GLY GLY A . n A 1 76 ASN 76 95 95 ASN ASN A . n A 1 77 TYR 77 96 96 TYR TYR A . n A 1 78 LYS 78 97 97 LYS LYS A . n A 1 79 SER 79 98 98 SER SER A . n A 1 80 GLU 80 99 99 GLU GLU A . n A 1 81 LYS 81 100 100 LYS LYS A . n A 1 82 LEU 82 101 101 LEU LEU A . n A 1 83 GLN 83 102 102 GLN GLN A . n A 1 84 VAL 84 103 103 VAL VAL A . n A 1 85 GLU 85 104 104 GLU GLU A . n A 1 86 ASN 86 105 105 ASN ASN A . n A 1 87 LYS 87 106 106 LYS LYS A . n A 1 88 LYS 88 107 107 LYS LYS A . n A 1 89 ILE 89 108 108 ILE ILE A . n A 1 90 PHE 90 109 109 PHE PHE A . n A 1 91 PRO 91 110 110 PRO PRO A . n A 1 92 PRO 92 111 111 PRO PRO A . n A 1 93 LYS 93 112 112 LYS LYS A . n A 1 94 THR 94 113 113 THR THR A . n A 1 95 ILE 95 114 114 ILE ILE A . n A 1 96 GLN 96 115 115 GLN GLN A . n A 1 97 GLU 97 116 116 GLU GLU A . n A 1 98 ARG 98 117 117 ARG ARG A . n A 1 99 ILE 99 118 118 ILE ILE A . n A 1 100 ALA 100 119 119 ALA ALA A . n A 1 101 LYS 101 120 120 LYS LYS A . n A 1 102 GLU 102 121 121 GLU GLU A . n A 1 103 LEU 103 122 122 LEU LEU A . n A 1 104 LYS 104 123 123 LYS LYS A . n A 1 105 GLU 105 124 124 GLU GLU A . n A 1 106 ALA 106 125 125 ALA ALA A . n A 1 107 ASN 107 126 126 ASN ASN A . n A 1 108 ALA 108 127 127 ALA ALA A . n A 1 109 ILE 109 128 128 ILE ILE A . n A 1 110 TYR 110 129 129 TYR TYR A . n A 1 111 SER 111 130 130 SER SER A . n A 1 112 SER 112 131 131 SER SER A . n A 1 113 TYR 113 132 132 TYR TYR A . n A 1 114 THR 114 133 133 THR THR A . n A 1 115 PRO 115 134 134 PRO PRO A . n A 1 116 LYS 116 135 135 LYS LYS A . n A 1 117 ALA 117 136 136 ALA ALA A . n A 1 118 LEU 118 137 137 LEU LEU A . n A 1 119 PHE 119 138 138 PHE PHE A . n A 1 120 ASN 120 139 139 ASN ASN A . n A 1 121 GLY 121 140 140 GLY GLY A . n A 1 122 ALA 122 141 141 ALA ALA A . n A 1 123 PHE 123 142 142 PHE PHE A . n A 1 124 ASN 124 143 143 ASN ASN A . n A 1 125 ILE 125 144 144 ILE ILE A . n A 1 126 PRO 126 145 145 PRO PRO A . n A 1 127 LEU 127 146 146 LEU LEU A . n A 1 128 ASN 128 147 147 ASN ASN A . n A 1 129 SER 129 148 148 SER SER A . n A 1 130 PHE 130 149 149 PHE PHE A . n A 1 131 ILE 131 150 150 ILE ILE A . n A 1 132 THR 132 151 151 THR THR A . n A 1 133 SER 133 152 152 SER SER A . n A 1 134 ASP 134 153 153 ASP ASP A . n A 1 135 PHE 135 154 154 PHE PHE A . n A 1 136 GLY 136 155 155 GLY GLY A . n A 1 137 LYS 137 156 156 LYS LYS A . n A 1 138 ALA 138 157 157 ALA ALA A . n A 1 139 ARG 139 158 158 ARG ARG A . n A 1 140 THR 140 159 159 THR THR A . n A 1 141 PHE 141 160 160 PHE PHE A . n A 1 142 ASN 142 161 161 ASN ASN A . n A 1 143 GLU 143 162 162 GLU GLU A . n A 1 144 LYS 144 163 163 LYS LYS A . n A 1 145 VAL 145 164 164 VAL VAL A . n A 1 146 ALA 146 165 165 ALA ALA A . n A 1 147 SER 147 166 166 SER SER A . n A 1 148 TYR 148 167 167 TYR TYR A . n A 1 149 HIS 149 168 168 HIS HIS A . n A 1 150 SER 150 169 169 SER SER A . n A 1 151 GLY 151 170 170 GLY GLY A . n A 1 152 THR 152 171 171 THR THR A . n A 1 153 ASP 153 172 172 ASP ASP A . n A 1 154 PHE 154 173 173 PHE PHE A . n A 1 155 ARG 155 174 174 ARG ARG A . n A 1 156 ALA 156 175 175 ALA ALA A . n A 1 157 ALA 157 176 176 ALA ALA A . n A 1 158 THR 158 177 177 THR THR A . n A 1 159 GLY 159 178 178 GLY GLY A . n A 1 160 THR 160 179 179 THR THR A . n A 1 161 PRO 161 180 180 PRO PRO A . n A 1 162 ILE 162 181 181 ILE ILE A . n A 1 163 TYR 163 182 182 TYR TYR A . n A 1 164 ALA 164 183 183 ALA ALA A . n A 1 165 ALA 165 184 184 ALA ALA A . n A 1 166 ASN 166 185 185 ASN ASN A . n A 1 167 SER 167 186 186 SER SER A . n A 1 168 GLY 168 187 187 GLY GLY A . n A 1 169 VAL 169 188 188 VAL VAL A . n A 1 170 VAL 170 189 189 VAL VAL A . n A 1 171 LYS 171 190 190 LYS LYS A . n A 1 172 ILE 172 191 191 ILE ILE A . n A 1 173 ALA 173 192 192 ALA ALA A . n A 1 174 LYS 174 193 193 LYS LYS A . n A 1 175 ASP 175 194 194 ASP ASP A . n A 1 176 ARG 176 195 195 ARG ARG A . n A 1 177 TYR 177 196 196 TYR TYR A . n A 1 178 PHE 178 197 197 PHE PHE A . n A 1 179 ALA 179 198 198 ALA ALA A . n A 1 180 GLY 180 199 199 GLY GLY A . n A 1 181 ASN 181 200 200 ASN ASN A . n A 1 182 SER 182 201 201 SER SER A . n A 1 183 VAL 183 202 202 VAL VAL A . n A 1 184 VAL 184 203 203 VAL VAL A . n A 1 185 ILE 185 204 204 ILE ILE A . n A 1 186 ASP 186 205 205 ASP ASP A . n A 1 187 HIS 187 206 206 HIS HIS A . n A 1 188 GLY 188 207 207 GLY GLY A . n A 1 189 PHE 189 208 208 PHE PHE A . n A 1 190 GLY 190 209 209 GLY GLY A . n A 1 191 ILE 191 210 210 ILE ILE A . n A 1 192 TYR 192 211 211 TYR TYR A . n A 1 193 SER 193 212 212 SER SER A . n A 1 194 GLN 194 213 213 GLN GLN A . n A 1 195 TYR 195 214 214 TYR TYR A . n A 1 196 TYR 196 215 215 TYR TYR A . n A 1 197 HIS 197 216 216 HIS HIS A . n A 1 198 LEU 198 217 217 LEU LEU A . n A 1 199 SER 199 218 218 SER SER A . n A 1 200 LYS 200 219 219 LYS LYS A . n A 1 201 ILE 201 220 220 ILE ILE A . n A 1 202 ASP 202 221 221 ASP ASP A . n A 1 203 VAL 203 222 222 VAL VAL A . n A 1 204 LYS 204 223 223 LYS LYS A . n A 1 205 VAL 205 224 224 VAL VAL A . n A 1 206 GLY 206 225 225 GLY GLY A . n A 1 207 GLN 207 226 226 GLN GLN A . n A 1 208 LYS 208 227 227 LYS LYS A . n A 1 209 ILE 209 228 228 ILE ILE A . n A 1 210 LYS 210 229 229 LYS LYS A . n A 1 211 LYS 211 230 230 LYS LYS A . n A 1 212 GLY 212 231 231 GLY GLY A . n A 1 213 GLU 213 232 232 GLU GLU A . n A 1 214 LEU 214 233 233 LEU LEU A . n A 1 215 ILE 215 234 234 ILE ILE A . n A 1 216 GLY 216 235 235 GLY GLY A . n A 1 217 LEU 217 236 236 LEU LEU A . n A 1 218 SER 218 237 237 SER SER A . n A 1 219 GLY 219 238 238 GLY GLY A . n A 1 220 ALA 220 239 239 ALA ALA A . n A 1 221 SER 221 240 240 SER SER A . n A 1 222 GLY 222 241 241 GLY GLY A . n A 1 223 ARG 223 242 242 ARG ARG A . n A 1 224 VAL 224 243 243 VAL VAL A . n A 1 225 SER 225 244 244 SER SER A . n A 1 226 GLY 226 245 245 GLY GLY A . n A 1 227 PRO 227 246 246 PRO PRO A . n A 1 228 ALA 228 247 247 ALA ALA A . n A 1 229 LEU 229 248 248 LEU LEU A . n A 1 230 HIS 230 249 249 HIS HIS A . n A 1 231 PHE 231 250 250 PHE PHE A . n A 1 232 GLY 232 251 251 GLY GLY A . n A 1 233 ILE 233 252 252 ILE ILE A . n A 1 234 LEU 234 253 253 LEU LEU A . n A 1 235 ALA 235 254 254 ALA ALA A . n A 1 236 GLY 236 255 255 GLY GLY A . n A 1 237 GLY 237 256 256 GLY GLY A . n A 1 238 LYS 238 257 257 LYS LYS A . n A 1 239 GLN 239 258 258 GLN GLN A . n A 1 240 VAL 240 259 259 VAL VAL A . n A 1 241 ASP 241 260 260 ASP ASP A . n A 1 242 PRO 242 261 261 PRO PRO A . n A 1 243 LEU 243 262 262 LEU LEU A . n A 1 244 ASP 244 263 263 ASP ASP A . n A 1 245 PHE 245 264 264 PHE PHE A . n A 1 246 VAL 246 265 265 VAL VAL A . n A 1 247 SER 247 266 266 SER SER A . n A 1 248 LYS 248 267 267 LYS LYS A . n A 1 249 PHE 249 268 268 PHE PHE A . n A 1 250 ASN 250 269 269 ASN ASN A . n A 1 251 ALA 251 270 270 ALA ALA A . n A 1 252 ILE 252 271 271 ILE ILE A . n A 1 253 PHE 253 272 272 PHE PHE A . n A 1 254 GLN 254 273 273 GLN GLN A . n B 2 1 C0O 1 1 301 C0O DRG B . n B 2 2 DAL 2 2 301 DAL DRG B . n B 2 3 DAL 3 3 301 DAL DRG B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 300 300 ZN ZN A . D 4 HOH 1 401 81 HOH HOH A . D 4 HOH 2 402 88 HOH HOH A . D 4 HOH 3 403 55 HOH HOH A . D 4 HOH 4 404 16 HOH HOH A . D 4 HOH 5 405 11 HOH HOH A . D 4 HOH 6 406 59 HOH HOH A . D 4 HOH 7 407 42 HOH HOH A . D 4 HOH 8 408 14 HOH HOH A . D 4 HOH 9 409 2 HOH HOH A . D 4 HOH 10 410 1 HOH HOH A . D 4 HOH 11 411 44 HOH HOH A . D 4 HOH 12 412 23 HOH HOH A . D 4 HOH 13 413 83 HOH HOH A . D 4 HOH 14 414 47 HOH HOH A . D 4 HOH 15 415 8 HOH HOH A . D 4 HOH 16 416 7 HOH HOH A . D 4 HOH 17 417 4 HOH HOH A . D 4 HOH 18 418 27 HOH HOH A . D 4 HOH 19 419 75 HOH HOH A . D 4 HOH 20 420 57 HOH HOH A . D 4 HOH 21 421 17 HOH HOH A . D 4 HOH 22 422 36 HOH HOH A . D 4 HOH 23 423 6 HOH HOH A . D 4 HOH 24 424 26 HOH HOH A . D 4 HOH 25 425 61 HOH HOH A . D 4 HOH 26 426 53 HOH HOH A . D 4 HOH 27 427 69 HOH HOH A . D 4 HOH 28 428 41 HOH HOH A . D 4 HOH 29 429 49 HOH HOH A . D 4 HOH 30 430 25 HOH HOH A . D 4 HOH 31 431 94 HOH HOH A . D 4 HOH 32 432 9 HOH HOH A . D 4 HOH 33 433 35 HOH HOH A . D 4 HOH 34 434 37 HOH HOH A . D 4 HOH 35 435 3 HOH HOH A . D 4 HOH 36 436 15 HOH HOH A . D 4 HOH 37 437 22 HOH HOH A . D 4 HOH 38 438 20 HOH HOH A . D 4 HOH 39 439 71 HOH HOH A . D 4 HOH 40 440 91 HOH HOH A . D 4 HOH 41 441 54 HOH HOH A . D 4 HOH 42 442 38 HOH HOH A . D 4 HOH 43 443 92 HOH HOH A . D 4 HOH 44 444 98 HOH HOH A . D 4 HOH 45 445 96 HOH HOH A . D 4 HOH 46 446 5 HOH HOH A . D 4 HOH 47 447 70 HOH HOH A . D 4 HOH 48 448 19 HOH HOH A . D 4 HOH 49 449 13 HOH HOH A . D 4 HOH 50 450 78 HOH HOH A . D 4 HOH 51 451 21 HOH HOH A . D 4 HOH 52 452 10 HOH HOH A . D 4 HOH 53 453 24 HOH HOH A . D 4 HOH 54 454 32 HOH HOH A . D 4 HOH 55 455 56 HOH HOH A . D 4 HOH 56 456 101 HOH HOH A . D 4 HOH 57 457 12 HOH HOH A . D 4 HOH 58 458 58 HOH HOH A . D 4 HOH 59 459 62 HOH HOH A . D 4 HOH 60 460 51 HOH HOH A . D 4 HOH 61 461 50 HOH HOH A . D 4 HOH 62 462 85 HOH HOH A . D 4 HOH 63 463 80 HOH HOH A . D 4 HOH 64 464 40 HOH HOH A . D 4 HOH 65 465 67 HOH HOH A . D 4 HOH 66 466 107 HOH HOH A . D 4 HOH 67 467 46 HOH HOH A . D 4 HOH 68 468 63 HOH HOH A . D 4 HOH 69 469 52 HOH HOH A . D 4 HOH 70 470 79 HOH HOH A . D 4 HOH 71 471 28 HOH HOH A . D 4 HOH 72 472 102 HOH HOH A . D 4 HOH 73 473 66 HOH HOH A . D 4 HOH 74 474 76 HOH HOH A . D 4 HOH 75 475 68 HOH HOH A . D 4 HOH 76 476 95 HOH HOH A . D 4 HOH 77 477 34 HOH HOH A . D 4 HOH 78 478 87 HOH HOH A . D 4 HOH 79 479 73 HOH HOH A . D 4 HOH 80 480 90 HOH HOH A . D 4 HOH 81 481 93 HOH HOH A . D 4 HOH 82 482 84 HOH HOH A . D 4 HOH 83 483 103 HOH HOH A . D 4 HOH 84 484 105 HOH HOH A . D 4 HOH 85 485 72 HOH HOH A . D 4 HOH 86 486 39 HOH HOH A . D 4 HOH 87 487 64 HOH HOH A . D 4 HOH 88 488 77 HOH HOH A . D 4 HOH 89 489 60 HOH HOH A . D 4 HOH 90 490 74 HOH HOH A . D 4 HOH 91 491 108 HOH HOH A . D 4 HOH 92 492 48 HOH HOH A . D 4 HOH 93 493 109 HOH HOH A . D 4 HOH 94 494 86 HOH HOH A . D 4 HOH 95 495 106 HOH HOH A . D 4 HOH 96 496 33 HOH HOH A . D 4 HOH 97 497 65 HOH HOH A . E 4 HOH 1 101 30 HOH HOH B . E 4 HOH 2 102 29 HOH HOH B . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,D 2 1 B,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 80 ? 1 MORE -29 ? 1 'SSA (A^2)' 12910 ? 2 'ABSA (A^2)' 0 ? 2 MORE 0 ? 2 'SSA (A^2)' 560 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id NE2 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id HIS _pdbx_struct_conn_angle.ptnr1_label_seq_id 149 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id HIS _pdbx_struct_conn_angle.ptnr1_auth_seq_id 168 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id ZN _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id C _pdbx_struct_conn_angle.ptnr2_label_comp_id ZN _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id ZN _pdbx_struct_conn_angle.ptnr2_auth_seq_id 300 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id OD1 _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id ASP _pdbx_struct_conn_angle.ptnr3_label_seq_id 153 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id ASP _pdbx_struct_conn_angle.ptnr3_auth_seq_id 172 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 97.7 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-01-15 2 'Structure model' 1 1 2020-02-05 3 'Structure model' 1 2 2022-03-23 4 'Structure model' 2 0 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Atomic model' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_audit_support 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_conn_type 7 4 'Structure model' atom_site 8 4 'Structure model' atom_site_anisotrop 9 4 'Structure model' chem_comp_atom 10 4 'Structure model' chem_comp_bond 11 4 'Structure model' pdbx_validate_rmsd_angle 12 4 'Structure model' pdbx_validate_rmsd_bond 13 4 'Structure model' pdbx_validate_torsion 14 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.identifier_ORCID' 7 2 'Structure model' '_citation_author.name' 8 3 'Structure model' '_database_2.pdbx_DOI' 9 3 'Structure model' '_database_2.pdbx_database_accession' 10 3 'Structure model' '_pdbx_audit_support.funding_organization' 11 3 'Structure model' '_struct_conn.conn_type_id' 12 3 'Structure model' '_struct_conn.id' 13 3 'Structure model' '_struct_conn.pdbx_dist_value' 14 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 15 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 16 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 23 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 3 'Structure model' '_struct_conn_type.id' 30 4 'Structure model' '_atom_site.auth_atom_id' 31 4 'Structure model' '_atom_site.label_atom_id' 32 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 33 4 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 34 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 27.4422 _pdbx_refine_tls.origin_y 41.3293 _pdbx_refine_tls.origin_z 0.1346 _pdbx_refine_tls.T[1][1] 0.3042 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0490 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0342 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.3677 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0093 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.3436 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.8319 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.2556 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.6409 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.3906 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.1846 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 2.2344 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0628 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.1854 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0070 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0274 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0289 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0207 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.2442 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.2063 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0002 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 20 ? ? A 273 ? all 2 'X-RAY DIFFRACTION' 1 ? ? A 300 ? ? A 300 ? all 3 'X-RAY DIFFRACTION' 1 ? ? C 301 ? ? C 301 ? all 4 'X-RAY DIFFRACTION' 1 ? ? S 1 ? ? S 109 ? all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_entry_details.entry_id 6JN1 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 B _pdbx_validate_rmsd_bond.auth_comp_id_1 C0O _pdbx_validate_rmsd_bond.auth_seq_id_1 1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 N _pdbx_validate_rmsd_bond.auth_asym_id_2 B _pdbx_validate_rmsd_bond.auth_comp_id_2 DAL _pdbx_validate_rmsd_bond.auth_seq_id_2 2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.486 _pdbx_validate_rmsd_bond.bond_target_value 1.336 _pdbx_validate_rmsd_bond.bond_deviation 0.150 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.023 _pdbx_validate_rmsd_bond.linker_flag Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA B C0O 1 ? ? C B C0O 1 ? ? N B DAL 2 ? ? 132.34 117.20 15.14 2.20 Y 2 1 O B C0O 1 ? ? C B C0O 1 ? ? N B DAL 2 ? ? 112.54 122.70 -10.16 1.60 Y 3 1 C B C0O 1 ? ? N B DAL 2 ? ? CA B DAL 2 ? ? 139.23 121.70 17.53 2.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 103 ? ? -82.01 -73.29 2 1 LYS A 106 ? ? 61.58 -38.10 3 1 PRO A 134 ? ? -83.76 36.15 4 1 ASN A 139 ? ? -151.11 88.87 5 1 ASN A 147 ? ? -92.28 45.59 6 1 SER A 148 ? ? -113.97 -138.27 7 1 GLU A 162 ? ? -111.56 68.03 8 1 LYS A 163 ? ? -165.18 -148.33 9 1 ALA A 175 ? ? -160.89 118.67 10 1 ALA A 192 ? ? -154.93 64.12 11 1 DAL B 2 ? ? -124.30 -89.85 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 497 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.18 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 C0O C C N N 74 C0O CA C N S 75 C0O C3 C N N 76 C0O C4 C N N 77 C0O C5 C N N 78 C0O C6 C N R 79 C0O C7 C N N 80 C0O O O N N 81 C0O O3 O N N 82 C0O O4 O N N 83 C0O N N N N 84 C0O N6 N N N 85 C0O OXT O N N 86 C0O HA H N N 87 C0O H1 H N N 88 C0O H3 H N N 89 C0O H4 H N N 90 C0O H5 H N N 91 C0O H6 H N N 92 C0O H7 H N N 93 C0O H2 H N N 94 C0O H H N N 95 C0O H11 H N N 96 C0O H12 H N N 97 C0O HXT H N N 98 DAL N N N N 99 DAL CA C N R 100 DAL CB C N N 101 DAL C C N N 102 DAL O O N N 103 DAL OXT O N N 104 DAL H H N N 105 DAL H2 H N N 106 DAL HA H N N 107 DAL HB1 H N N 108 DAL HB2 H N N 109 DAL HB3 H N N 110 DAL HXT H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 PHE N N N N 274 PHE CA C N S 275 PHE C C N N 276 PHE O O N N 277 PHE CB C N N 278 PHE CG C Y N 279 PHE CD1 C Y N 280 PHE CD2 C Y N 281 PHE CE1 C Y N 282 PHE CE2 C Y N 283 PHE CZ C Y N 284 PHE OXT O N N 285 PHE H H N N 286 PHE H2 H N N 287 PHE HA H N N 288 PHE HB2 H N N 289 PHE HB3 H N N 290 PHE HD1 H N N 291 PHE HD2 H N N 292 PHE HE1 H N N 293 PHE HE2 H N N 294 PHE HZ H N N 295 PHE HXT H N N 296 PRO N N N N 297 PRO CA C N S 298 PRO C C N N 299 PRO O O N N 300 PRO CB C N N 301 PRO CG C N N 302 PRO CD C N N 303 PRO OXT O N N 304 PRO H H N N 305 PRO HA H N N 306 PRO HB2 H N N 307 PRO HB3 H N N 308 PRO HG2 H N N 309 PRO HG3 H N N 310 PRO HD2 H N N 311 PRO HD3 H N N 312 PRO HXT H N N 313 SER N N N N 314 SER CA C N S 315 SER C C N N 316 SER O O N N 317 SER CB C N N 318 SER OG O N N 319 SER OXT O N N 320 SER H H N N 321 SER H2 H N N 322 SER HA H N N 323 SER HB2 H N N 324 SER HB3 H N N 325 SER HG H N N 326 SER HXT H N N 327 THR N N N N 328 THR CA C N S 329 THR C C N N 330 THR O O N N 331 THR CB C N R 332 THR OG1 O N N 333 THR CG2 C N N 334 THR OXT O N N 335 THR H H N N 336 THR H2 H N N 337 THR HA H N N 338 THR HB H N N 339 THR HG1 H N N 340 THR HG21 H N N 341 THR HG22 H N N 342 THR HG23 H N N 343 THR HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 C0O O3 C7 doub N N 70 C0O N6 C6 sing N N 71 C0O C5 C6 sing N N 72 C0O C5 C4 doub N Z 73 C0O C6 C7 sing N N 74 C0O C7 O4 sing N N 75 C0O C4 C3 sing N N 76 C0O C3 CA sing N N 77 C0O O C doub N N 78 C0O CA C sing N N 79 C0O CA N sing N N 80 C0O C OXT sing N N 81 C0O CA HA sing N N 82 C0O C3 H1 sing N N 83 C0O C3 H3 sing N N 84 C0O C4 H4 sing N N 85 C0O C5 H5 sing N N 86 C0O C6 H6 sing N N 87 C0O O4 H7 sing N N 88 C0O N H2 sing N N 89 C0O N H sing N N 90 C0O N6 H11 sing N N 91 C0O N6 H12 sing N N 92 C0O OXT HXT sing N N 93 DAL N CA sing N N 94 DAL N H sing N N 95 DAL N H2 sing N N 96 DAL CA CB sing N N 97 DAL CA C sing N N 98 DAL CA HA sing N N 99 DAL CB HB1 sing N N 100 DAL CB HB2 sing N N 101 DAL CB HB3 sing N N 102 DAL C O doub N N 103 DAL C OXT sing N N 104 DAL OXT HXT sing N N 105 GLN N CA sing N N 106 GLN N H sing N N 107 GLN N H2 sing N N 108 GLN CA C sing N N 109 GLN CA CB sing N N 110 GLN CA HA sing N N 111 GLN C O doub N N 112 GLN C OXT sing N N 113 GLN CB CG sing N N 114 GLN CB HB2 sing N N 115 GLN CB HB3 sing N N 116 GLN CG CD sing N N 117 GLN CG HG2 sing N N 118 GLN CG HG3 sing N N 119 GLN CD OE1 doub N N 120 GLN CD NE2 sing N N 121 GLN NE2 HE21 sing N N 122 GLN NE2 HE22 sing N N 123 GLN OXT HXT sing N N 124 GLU N CA sing N N 125 GLU N H sing N N 126 GLU N H2 sing N N 127 GLU CA C sing N N 128 GLU CA CB sing N N 129 GLU CA HA sing N N 130 GLU C O doub N N 131 GLU C OXT sing N N 132 GLU CB CG sing N N 133 GLU CB HB2 sing N N 134 GLU CB HB3 sing N N 135 GLU CG CD sing N N 136 GLU CG HG2 sing N N 137 GLU CG HG3 sing N N 138 GLU CD OE1 doub N N 139 GLU CD OE2 sing N N 140 GLU OE2 HE2 sing N N 141 GLU OXT HXT sing N N 142 GLY N CA sing N N 143 GLY N H sing N N 144 GLY N H2 sing N N 145 GLY CA C sing N N 146 GLY CA HA2 sing N N 147 GLY CA HA3 sing N N 148 GLY C O doub N N 149 GLY C OXT sing N N 150 GLY OXT HXT sing N N 151 HIS N CA sing N N 152 HIS N H sing N N 153 HIS N H2 sing N N 154 HIS CA C sing N N 155 HIS CA CB sing N N 156 HIS CA HA sing N N 157 HIS C O doub N N 158 HIS C OXT sing N N 159 HIS CB CG sing N N 160 HIS CB HB2 sing N N 161 HIS CB HB3 sing N N 162 HIS CG ND1 sing Y N 163 HIS CG CD2 doub Y N 164 HIS ND1 CE1 doub Y N 165 HIS ND1 HD1 sing N N 166 HIS CD2 NE2 sing Y N 167 HIS CD2 HD2 sing N N 168 HIS CE1 NE2 sing Y N 169 HIS CE1 HE1 sing N N 170 HIS NE2 HE2 sing N N 171 HIS OXT HXT sing N N 172 HOH O H1 sing N N 173 HOH O H2 sing N N 174 ILE N CA sing N N 175 ILE N H sing N N 176 ILE N H2 sing N N 177 ILE CA C sing N N 178 ILE CA CB sing N N 179 ILE CA HA sing N N 180 ILE C O doub N N 181 ILE C OXT sing N N 182 ILE CB CG1 sing N N 183 ILE CB CG2 sing N N 184 ILE CB HB sing N N 185 ILE CG1 CD1 sing N N 186 ILE CG1 HG12 sing N N 187 ILE CG1 HG13 sing N N 188 ILE CG2 HG21 sing N N 189 ILE CG2 HG22 sing N N 190 ILE CG2 HG23 sing N N 191 ILE CD1 HD11 sing N N 192 ILE CD1 HD12 sing N N 193 ILE CD1 HD13 sing N N 194 ILE OXT HXT sing N N 195 LEU N CA sing N N 196 LEU N H sing N N 197 LEU N H2 sing N N 198 LEU CA C sing N N 199 LEU CA CB sing N N 200 LEU CA HA sing N N 201 LEU C O doub N N 202 LEU C OXT sing N N 203 LEU CB CG sing N N 204 LEU CB HB2 sing N N 205 LEU CB HB3 sing N N 206 LEU CG CD1 sing N N 207 LEU CG CD2 sing N N 208 LEU CG HG sing N N 209 LEU CD1 HD11 sing N N 210 LEU CD1 HD12 sing N N 211 LEU CD1 HD13 sing N N 212 LEU CD2 HD21 sing N N 213 LEU CD2 HD22 sing N N 214 LEU CD2 HD23 sing N N 215 LEU OXT HXT sing N N 216 LYS N CA sing N N 217 LYS N H sing N N 218 LYS N H2 sing N N 219 LYS CA C sing N N 220 LYS CA CB sing N N 221 LYS CA HA sing N N 222 LYS C O doub N N 223 LYS C OXT sing N N 224 LYS CB CG sing N N 225 LYS CB HB2 sing N N 226 LYS CB HB3 sing N N 227 LYS CG CD sing N N 228 LYS CG HG2 sing N N 229 LYS CG HG3 sing N N 230 LYS CD CE sing N N 231 LYS CD HD2 sing N N 232 LYS CD HD3 sing N N 233 LYS CE NZ sing N N 234 LYS CE HE2 sing N N 235 LYS CE HE3 sing N N 236 LYS NZ HZ1 sing N N 237 LYS NZ HZ2 sing N N 238 LYS NZ HZ3 sing N N 239 LYS OXT HXT sing N N 240 MET N CA sing N N 241 MET N H sing N N 242 MET N H2 sing N N 243 MET CA C sing N N 244 MET CA CB sing N N 245 MET CA HA sing N N 246 MET C O doub N N 247 MET C OXT sing N N 248 MET CB CG sing N N 249 MET CB HB2 sing N N 250 MET CB HB3 sing N N 251 MET CG SD sing N N 252 MET CG HG2 sing N N 253 MET CG HG3 sing N N 254 MET SD CE sing N N 255 MET CE HE1 sing N N 256 MET CE HE2 sing N N 257 MET CE HE3 sing N N 258 MET OXT HXT sing N N 259 PHE N CA sing N N 260 PHE N H sing N N 261 PHE N H2 sing N N 262 PHE CA C sing N N 263 PHE CA CB sing N N 264 PHE CA HA sing N N 265 PHE C O doub N N 266 PHE C OXT sing N N 267 PHE CB CG sing N N 268 PHE CB HB2 sing N N 269 PHE CB HB3 sing N N 270 PHE CG CD1 doub Y N 271 PHE CG CD2 sing Y N 272 PHE CD1 CE1 sing Y N 273 PHE CD1 HD1 sing N N 274 PHE CD2 CE2 doub Y N 275 PHE CD2 HD2 sing N N 276 PHE CE1 CZ doub Y N 277 PHE CE1 HE1 sing N N 278 PHE CE2 CZ sing Y N 279 PHE CE2 HE2 sing N N 280 PHE CZ HZ sing N N 281 PHE OXT HXT sing N N 282 PRO N CA sing N N 283 PRO N CD sing N N 284 PRO N H sing N N 285 PRO CA C sing N N 286 PRO CA CB sing N N 287 PRO CA HA sing N N 288 PRO C O doub N N 289 PRO C OXT sing N N 290 PRO CB CG sing N N 291 PRO CB HB2 sing N N 292 PRO CB HB3 sing N N 293 PRO CG CD sing N N 294 PRO CG HG2 sing N N 295 PRO CG HG3 sing N N 296 PRO CD HD2 sing N N 297 PRO CD HD3 sing N N 298 PRO OXT HXT sing N N 299 SER N CA sing N N 300 SER N H sing N N 301 SER N H2 sing N N 302 SER CA C sing N N 303 SER CA CB sing N N 304 SER CA HA sing N N 305 SER C O doub N N 306 SER C OXT sing N N 307 SER CB OG sing N N 308 SER CB HB2 sing N N 309 SER CB HB3 sing N N 310 SER OG HG sing N N 311 SER OXT HXT sing N N 312 THR N CA sing N N 313 THR N H sing N N 314 THR N H2 sing N N 315 THR CA C sing N N 316 THR CA CB sing N N 317 THR CA HA sing N N 318 THR C O doub N N 319 THR C OXT sing N N 320 THR CB OG1 sing N N 321 THR CB CG2 sing N N 322 THR CB HB sing N N 323 THR OG1 HG1 sing N N 324 THR CG2 HG21 sing N N 325 THR CG2 HG22 sing N N 326 THR CG2 HG23 sing N N 327 THR OXT HXT sing N N 328 TYR N CA sing N N 329 TYR N H sing N N 330 TYR N H2 sing N N 331 TYR CA C sing N N 332 TYR CA CB sing N N 333 TYR CA HA sing N N 334 TYR C O doub N N 335 TYR C OXT sing N N 336 TYR CB CG sing N N 337 TYR CB HB2 sing N N 338 TYR CB HB3 sing N N 339 TYR CG CD1 doub Y N 340 TYR CG CD2 sing Y N 341 TYR CD1 CE1 sing Y N 342 TYR CD1 HD1 sing N N 343 TYR CD2 CE2 doub Y N 344 TYR CD2 HD2 sing N N 345 TYR CE1 CZ doub Y N 346 TYR CE1 HE1 sing N N 347 TYR CE2 CZ sing Y N 348 TYR CE2 HE2 sing N N 349 TYR CZ OH sing N N 350 TYR OH HH sing N N 351 TYR OXT HXT sing N N 352 VAL N CA sing N N 353 VAL N H sing N N 354 VAL N H2 sing N N 355 VAL CA C sing N N 356 VAL CA CB sing N N 357 VAL CA HA sing N N 358 VAL C O doub N N 359 VAL C OXT sing N N 360 VAL CB CG1 sing N N 361 VAL CB CG2 sing N N 362 VAL CB HB sing N N 363 VAL CG1 HG11 sing N N 364 VAL CG1 HG12 sing N N 365 VAL CG1 HG13 sing N N 366 VAL CG2 HG21 sing N N 367 VAL CG2 HG22 sing N N 368 VAL CG2 HG23 sing N N 369 VAL OXT HXT sing N N 370 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Research Foundation (Korea)' 'Korea, Republic Of' 2015R1A5A1008958 1 'National Research Foundation (Korea)' 'Korea, Republic Of' 2015R1C1A1A01054842 2 'National Research Foundation (Korea)' 'Korea, Republic Of' 2018R1A2B2008142 3 'Ministry of Science, ICT and Future Planning' 'Korea, Republic Of' 2014M1A8A1049296 4 'Ministry of Science, ICT and Future Planning' 'Korea, Republic Of' 2013R1A2A1A05067303 5 'National Research Foundation (Korea)' 'Korea, Republic Of' 2018R1D1A1B07040808 6 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI090348 7 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM61629 8 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 water HOH #