data_6JO3 # _entry.id 6JO3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6JO3 pdb_00006jo3 10.2210/pdb6jo3/pdb WWPDB D_1300011449 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2019-04-03 _pdbx_database_PDB_obs_spr.pdb_id 6JO3 _pdbx_database_PDB_obs_spr.replace_pdb_id 5B69 _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 4mm1 unspecified PDB . 2f6x unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6JO3 _pdbx_database_status.recvd_initial_deposition_date 2019-03-20 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nemoto, N.' 1 0000-0003-0230-254X 'Miyazono, K.' 2 0000-0002-9354-2604 'Tanokura, M.' 3 0000-0001-5072-2480 'Yamagishi, A.' 4 0000-0001-5162-3927 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 75 _citation.language ? _citation.page_first 470 _citation.page_last 479 _citation.title ;Crystal structure of (S)-3-O-geranylgeranylglyceryl phosphate synthase from Thermoplasma acidophilum in complex with the substrate sn-glycerol 1-phosphate. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X19007453 _citation.pdbx_database_id_PubMed 31282866 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nemoto, N.' 1 ? primary 'Miyazono, K.I.' 2 ? primary 'Tanokura, M.' 3 ? primary 'Yamagishi, A.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6JO3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 105.595 _cell.length_a_esd ? _cell.length_b 105.595 _cell.length_b_esd ? _cell.length_c 142.498 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6JO3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Geranylgeranylglyceryl phosphate synthase' 27283.766 1 2.5.1.41 ? ? ? 2 non-polymer syn SN-GLYCEROL-1-PHOSPHATE 172.074 1 ? ? ? ? 3 water nat water 18.015 40 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '(S)-3-O-geranylgeranylglyceryl phosphate synthase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MMTVLEDMLRKTRNGKVHMTLIDPGAKPPQECARIAEEAEMAGTDFIMVGGSTDIDSRAMDEAISAIKAKTDLKVIIFPG SSLMISPKADAIFFMSLLNSGSLEYVVGHQVKAAIPLSAMKIEKIPMAYLVFDPGMTVGRVGKAHLIPRDDEKTALSYAL AAQYFGFRLVYFEAGSGSPYHVGENVVRRVKQELDIPVIVGGGIRTPEAAKALAQAGADMIVTGTIAERSVNVYEALHPI VESIKEVGISKIQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MMTVLEDMLRKTRNGKVHMTLIDPGAKPPQECARIAEEAEMAGTDFIMVGGSTDIDSRAMDEAISAIKAKTDLKVIIFPG SSLMISPKADAIFFMSLLNSGSLEYVVGHQVKAAIPLSAMKIEKIPMAYLVFDPGMTVGRVGKAHLIPRDDEKTALSYAL AAQYFGFRLVYFEAGSGSPYHVGENVVRRVKQELDIPVIVGGGIRTPEAAKALAQAGADMIVTGTIAERSVNVYEALHPI VESIKEVGISKIQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 MET n 1 3 THR n 1 4 VAL n 1 5 LEU n 1 6 GLU n 1 7 ASP n 1 8 MET n 1 9 LEU n 1 10 ARG n 1 11 LYS n 1 12 THR n 1 13 ARG n 1 14 ASN n 1 15 GLY n 1 16 LYS n 1 17 VAL n 1 18 HIS n 1 19 MET n 1 20 THR n 1 21 LEU n 1 22 ILE n 1 23 ASP n 1 24 PRO n 1 25 GLY n 1 26 ALA n 1 27 LYS n 1 28 PRO n 1 29 PRO n 1 30 GLN n 1 31 GLU n 1 32 CYS n 1 33 ALA n 1 34 ARG n 1 35 ILE n 1 36 ALA n 1 37 GLU n 1 38 GLU n 1 39 ALA n 1 40 GLU n 1 41 MET n 1 42 ALA n 1 43 GLY n 1 44 THR n 1 45 ASP n 1 46 PHE n 1 47 ILE n 1 48 MET n 1 49 VAL n 1 50 GLY n 1 51 GLY n 1 52 SER n 1 53 THR n 1 54 ASP n 1 55 ILE n 1 56 ASP n 1 57 SER n 1 58 ARG n 1 59 ALA n 1 60 MET n 1 61 ASP n 1 62 GLU n 1 63 ALA n 1 64 ILE n 1 65 SER n 1 66 ALA n 1 67 ILE n 1 68 LYS n 1 69 ALA n 1 70 LYS n 1 71 THR n 1 72 ASP n 1 73 LEU n 1 74 LYS n 1 75 VAL n 1 76 ILE n 1 77 ILE n 1 78 PHE n 1 79 PRO n 1 80 GLY n 1 81 SER n 1 82 SER n 1 83 LEU n 1 84 MET n 1 85 ILE n 1 86 SER n 1 87 PRO n 1 88 LYS n 1 89 ALA n 1 90 ASP n 1 91 ALA n 1 92 ILE n 1 93 PHE n 1 94 PHE n 1 95 MET n 1 96 SER n 1 97 LEU n 1 98 LEU n 1 99 ASN n 1 100 SER n 1 101 GLY n 1 102 SER n 1 103 LEU n 1 104 GLU n 1 105 TYR n 1 106 VAL n 1 107 VAL n 1 108 GLY n 1 109 HIS n 1 110 GLN n 1 111 VAL n 1 112 LYS n 1 113 ALA n 1 114 ALA n 1 115 ILE n 1 116 PRO n 1 117 LEU n 1 118 SER n 1 119 ALA n 1 120 MET n 1 121 LYS n 1 122 ILE n 1 123 GLU n 1 124 LYS n 1 125 ILE n 1 126 PRO n 1 127 MET n 1 128 ALA n 1 129 TYR n 1 130 LEU n 1 131 VAL n 1 132 PHE n 1 133 ASP n 1 134 PRO n 1 135 GLY n 1 136 MET n 1 137 THR n 1 138 VAL n 1 139 GLY n 1 140 ARG n 1 141 VAL n 1 142 GLY n 1 143 LYS n 1 144 ALA n 1 145 HIS n 1 146 LEU n 1 147 ILE n 1 148 PRO n 1 149 ARG n 1 150 ASP n 1 151 ASP n 1 152 GLU n 1 153 LYS n 1 154 THR n 1 155 ALA n 1 156 LEU n 1 157 SER n 1 158 TYR n 1 159 ALA n 1 160 LEU n 1 161 ALA n 1 162 ALA n 1 163 GLN n 1 164 TYR n 1 165 PHE n 1 166 GLY n 1 167 PHE n 1 168 ARG n 1 169 LEU n 1 170 VAL n 1 171 TYR n 1 172 PHE n 1 173 GLU n 1 174 ALA n 1 175 GLY n 1 176 SER n 1 177 GLY n 1 178 SER n 1 179 PRO n 1 180 TYR n 1 181 HIS n 1 182 VAL n 1 183 GLY n 1 184 GLU n 1 185 ASN n 1 186 VAL n 1 187 VAL n 1 188 ARG n 1 189 ARG n 1 190 VAL n 1 191 LYS n 1 192 GLN n 1 193 GLU n 1 194 LEU n 1 195 ASP n 1 196 ILE n 1 197 PRO n 1 198 VAL n 1 199 ILE n 1 200 VAL n 1 201 GLY n 1 202 GLY n 1 203 GLY n 1 204 ILE n 1 205 ARG n 1 206 THR n 1 207 PRO n 1 208 GLU n 1 209 ALA n 1 210 ALA n 1 211 LYS n 1 212 ALA n 1 213 LEU n 1 214 ALA n 1 215 GLN n 1 216 ALA n 1 217 GLY n 1 218 ALA n 1 219 ASP n 1 220 MET n 1 221 ILE n 1 222 VAL n 1 223 THR n 1 224 GLY n 1 225 THR n 1 226 ILE n 1 227 ALA n 1 228 GLU n 1 229 ARG n 1 230 SER n 1 231 VAL n 1 232 ASN n 1 233 VAL n 1 234 TYR n 1 235 GLU n 1 236 ALA n 1 237 LEU n 1 238 HIS n 1 239 PRO n 1 240 ILE n 1 241 VAL n 1 242 GLU n 1 243 SER n 1 244 ILE n 1 245 LYS n 1 246 GLU n 1 247 VAL n 1 248 GLY n 1 249 ILE n 1 250 SER n 1 251 LYS n 1 252 ILE n 1 253 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 253 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Ta0995 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 1728' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermoplasma acidophilum DSM 1728' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 273075 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GGGPS_THEAC _struct_ref.pdbx_db_accession Q9HJH3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MMTVLEDMLRKTRNGKVHMTLIDPGAKPPQECARIAEEAEMAGTDFIMVGGSTDIDSRAMDEAISAIKAKTDLKVIIFPG SSLMISPKADAIFFMSLLNSGSLEYVVGHQVKAAIPLSAMKIEKIPMAYLVFDPGMTVGRVGKAHLIPRDDEKTALSYAL AAQYFGFRLVYFEAGSGSPYHVGENVVRRVKQELDIPVIVGGGIRTPEAAKALAQAGADMIVTGTIAERSVNVYEALHPI VESIKEVGISKIQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6JO3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 253 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HJH3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 253 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 253 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1GP non-polymer . SN-GLYCEROL-1-PHOSPHATE ? 'C3 H9 O6 P' 172.074 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6JO3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 70.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M sodium acetate pH 4.8 10% (w/v) polyethylene glycol 4000 10 mM rac-G1P 100 mM cesium chloride ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2006-06-19 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW12A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline AR-NW12A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6JO3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.35 _reflns.d_resolution_low 47.50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20203 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.988 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.35 _reflns_shell.d_res_low 2.43 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1945 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 10.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.942 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6JO3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.350 _refine.ls_d_res_low 43.538 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20163 _refine.ls_number_reflns_R_free 982 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.93 _refine.ls_percent_reflns_R_free 4.87 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1997 _refine.ls_R_factor_R_free 0.2228 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1985 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4mm1 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.59 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.29 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1863 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 1913 _refine_hist.d_res_high 2.350 _refine_hist.d_res_low 43.538 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1904 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.522 ? 2573 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 2.497 ? 1166 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.044 ? 299 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 329 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3503 2.4742 . . 117 2691 100.00 . . . 0.3012 . 0.2765 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4742 2.6292 . . 152 2659 100.00 . . . 0.3230 . 0.2628 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6292 2.8322 . . 140 2686 100.00 . . . 0.2556 . 0.2336 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8322 3.1171 . . 144 2709 100.00 . . . 0.3054 . 0.2341 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1171 3.5680 . . 139 2734 100.00 . . . 0.2415 . 0.2291 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5680 4.4945 . . 142 2755 100.00 . . . 0.2020 . 0.1826 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4945 43.5450 . . 148 2947 100.00 . . . 0.1833 . 0.1647 . . . . . . . . . . # _struct.entry_id 6JO3 _struct.title ;Crystal structure of (S)-3-O-geranylgeranylglyceryl phosphate synthase from Thermoplasma acidophilum in complex with substrate sn-glycerol-1-phosphate ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6JO3 _struct_keywords.text 'ARCHAEA, ETHER LIPID, THERMOPLASMA, TRANSFERASE, Structural Genomics' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 3 ? ASN A 14 ? THR A 3 ASN A 14 1 ? 12 HELX_P HELX_P2 AA2 PRO A 28 ? GLY A 43 ? PRO A 28 GLY A 43 1 ? 16 HELX_P HELX_P3 AA3 ASP A 56 ? THR A 71 ? ASP A 56 THR A 71 1 ? 16 HELX_P HELX_P4 AA4 SER A 102 ? VAL A 107 ? SER A 102 VAL A 107 1 ? 6 HELX_P HELX_P5 AA5 VAL A 107 ? ALA A 119 ? VAL A 107 ALA A 119 1 ? 13 HELX_P HELX_P6 AA6 GLY A 135 ? GLY A 142 ? GLY A 135 GLY A 142 1 ? 8 HELX_P HELX_P7 AA7 ASP A 151 ? GLY A 166 ? ASP A 151 GLY A 166 1 ? 16 HELX_P HELX_P8 AA8 GLY A 183 ? LEU A 194 ? GLY A 183 LEU A 194 1 ? 12 HELX_P HELX_P9 AA9 THR A 206 ? GLY A 217 ? THR A 206 GLY A 217 1 ? 12 HELX_P HELX_P10 AB1 GLY A 224 ? ARG A 229 ? GLY A 224 ARG A 229 1 ? 6 HELX_P HELX_P11 AB2 ASN A 232 ? GLU A 246 ? ASN A 232 GLU A 246 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 133 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 133 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 134 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 134 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.38 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 17 ? ILE A 22 ? VAL A 17 ILE A 22 AA1 2 PHE A 46 ? VAL A 49 ? PHE A 46 VAL A 49 AA1 3 VAL A 75 ? ILE A 77 ? VAL A 75 ILE A 77 AA1 4 ALA A 91 ? LEU A 97 ? ALA A 91 LEU A 97 AA1 5 GLU A 123 ? VAL A 131 ? GLU A 123 VAL A 131 AA1 6 LEU A 169 ? GLU A 173 ? LEU A 169 GLU A 173 AA1 7 VAL A 198 ? GLY A 201 ? VAL A 198 GLY A 201 AA1 8 MET A 220 ? THR A 223 ? MET A 220 THR A 223 AA1 9 VAL A 17 ? ILE A 22 ? VAL A 17 ILE A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 20 ? N THR A 20 O MET A 48 ? O MET A 48 AA1 2 3 N ILE A 47 ? N ILE A 47 O ILE A 76 ? O ILE A 76 AA1 3 4 N ILE A 77 ? N ILE A 77 O ALA A 91 ? O ALA A 91 AA1 4 5 N SER A 96 ? N SER A 96 O TYR A 129 ? O TYR A 129 AA1 5 6 N LEU A 130 ? N LEU A 130 O GLU A 173 ? O GLU A 173 AA1 6 7 N PHE A 172 ? N PHE A 172 O ILE A 199 ? O ILE A 199 AA1 7 8 N VAL A 200 ? N VAL A 200 O VAL A 222 ? O VAL A 222 AA1 8 9 O ILE A 221 ? O ILE A 221 N VAL A 17 ? N VAL A 17 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 1GP _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'binding site for residue 1GP A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 LEU A 21 ? LEU A 21 . ? 1_555 ? 2 AC1 16 PHE A 78 ? PHE A 78 . ? 1_555 ? 3 AC1 16 TYR A 171 ? TYR A 171 . ? 1_555 ? 4 AC1 16 GLU A 173 ? GLU A 173 . ? 1_555 ? 5 AC1 16 SER A 176 ? SER A 176 . ? 1_555 ? 6 AC1 16 GLY A 177 ? GLY A 177 . ? 1_555 ? 7 AC1 16 GLY A 201 ? GLY A 201 . ? 1_555 ? 8 AC1 16 GLY A 202 ? GLY A 202 . ? 1_555 ? 9 AC1 16 GLY A 203 ? GLY A 203 . ? 1_555 ? 10 AC1 16 THR A 223 ? THR A 223 . ? 1_555 ? 11 AC1 16 GLY A 224 ? GLY A 224 . ? 1_555 ? 12 AC1 16 THR A 225 ? THR A 225 . ? 1_555 ? 13 AC1 16 HOH C . ? HOH A 601 . ? 1_555 ? 14 AC1 16 HOH C . ? HOH A 604 . ? 1_555 ? 15 AC1 16 HOH C . ? HOH A 611 . ? 1_555 ? 16 AC1 16 HOH C . ? HOH A 621 . ? 1_555 ? # _atom_sites.entry_id 6JO3 _atom_sites.fract_transf_matrix[1][1] 0.009470 _atom_sites.fract_transf_matrix[1][2] 0.005468 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010935 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007018 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 MET 127 127 127 MET MET A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 TYR 171 171 171 TYR TYR A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 HIS 181 181 181 HIS HIS A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 PRO 197 197 197 PRO PRO A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 ILE 204 204 204 ILE ILE A . n A 1 205 ARG 205 205 205 ARG ARG A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 PRO 207 207 207 PRO PRO A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 GLN 215 215 215 GLN GLN A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 MET 220 220 220 MET MET A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 THR 223 223 223 THR THR A . n A 1 224 GLY 224 224 224 GLY GLY A . n A 1 225 THR 225 225 225 THR THR A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 ALA 227 227 227 ALA ALA A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 ARG 229 229 229 ARG ARG A . n A 1 230 SER 230 230 230 SER SER A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 ASN 232 232 232 ASN ASN A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 TYR 234 234 234 TYR TYR A . n A 1 235 GLU 235 235 235 GLU GLU A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 HIS 238 238 238 HIS HIS A . n A 1 239 PRO 239 239 239 PRO PRO A . n A 1 240 ILE 240 240 240 ILE ILE A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 GLY 248 248 ? ? ? A . n A 1 249 ILE 249 249 ? ? ? A . n A 1 250 SER 250 250 ? ? ? A . n A 1 251 LYS 251 251 ? ? ? A . n A 1 252 ILE 252 252 ? ? ? A . n A 1 253 GLN 253 253 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center ? _pdbx_SG_project.initial_of_center ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 1GP 1 501 501 1GP 1GP A . C 3 HOH 1 601 28 HOH HOH A . C 3 HOH 2 602 17 HOH HOH A . C 3 HOH 3 603 4 HOH HOH A . C 3 HOH 4 604 1 HOH HOH A . C 3 HOH 5 605 7 HOH HOH A . C 3 HOH 6 606 8 HOH HOH A . C 3 HOH 7 607 12 HOH HOH A . C 3 HOH 8 608 9 HOH HOH A . C 3 HOH 9 609 25 HOH HOH A . C 3 HOH 10 610 3 HOH HOH A . C 3 HOH 11 611 2 HOH HOH A . C 3 HOH 12 612 13 HOH HOH A . C 3 HOH 13 613 36 HOH HOH A . C 3 HOH 14 614 31 HOH HOH A . C 3 HOH 15 615 20 HOH HOH A . C 3 HOH 16 616 18 HOH HOH A . C 3 HOH 17 617 5 HOH HOH A . C 3 HOH 18 618 6 HOH HOH A . C 3 HOH 19 619 19 HOH HOH A . C 3 HOH 20 620 27 HOH HOH A . C 3 HOH 21 621 29 HOH HOH A . C 3 HOH 22 622 15 HOH HOH A . C 3 HOH 23 623 22 HOH HOH A . C 3 HOH 24 624 10 HOH HOH A . C 3 HOH 25 625 30 HOH HOH A . C 3 HOH 26 626 11 HOH HOH A . C 3 HOH 27 627 23 HOH HOH A . C 3 HOH 28 628 24 HOH HOH A . C 3 HOH 29 629 38 HOH HOH A . C 3 HOH 30 630 21 HOH HOH A . C 3 HOH 31 631 33 HOH HOH A . C 3 HOH 32 632 35 HOH HOH A . C 3 HOH 33 633 39 HOH HOH A . C 3 HOH 34 634 14 HOH HOH A . C 3 HOH 35 635 32 HOH HOH A . C 3 HOH 36 636 40 HOH HOH A . C 3 HOH 37 637 37 HOH HOH A . C 3 HOH 38 638 16 HOH HOH A . C 3 HOH 39 639 26 HOH HOH A . C 3 HOH 40 640 34 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3260 ? 1 MORE -38 ? 1 'SSA (A^2)' 18740 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_445 -y-1,-x-1,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 -52.7975000000 -0.8660254038 -0.5000000000 0.0000000000 -91.4479525126 0.0000000000 0.0000000000 -1.0000000000 23.7496666667 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 607 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-04-03 2 'Structure model' 1 1 2019-05-15 3 'Structure model' 1 2 2019-07-17 4 'Structure model' 1 3 2019-11-20 5 'Structure model' 1 4 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Database references' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' struct 2 3 'Structure model' citation 3 4 'Structure model' citation 4 4 'Structure model' citation_author 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct.title' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_ASTM' 5 3 'Structure model' '_citation.journal_id_CSD' 6 3 'Structure model' '_citation.journal_id_ISSN' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.page_first' 9 3 'Structure model' '_citation.page_last' 10 3 'Structure model' '_citation.pdbx_database_id_DOI' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation.year' 13 4 'Structure model' '_citation.pdbx_database_id_PubMed' 14 4 'Structure model' '_citation.title' 15 4 'Structure model' '_citation_author.name' 16 5 'Structure model' '_database_2.pdbx_DOI' 17 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -30.6759 -40.7584 -11.0198 0.5836 0.6875 0.5833 0.1805 0.0736 -0.0234 0.4179 1.9313 1.6063 0.5240 -0.2442 -0.1016 -0.0058 0.2558 -0.1922 -0.5564 -0.2985 -0.1732 0.6142 0.0388 -0.0077 'X-RAY DIFFRACTION' 2 ? refined -31.0014 -30.4955 0.3459 0.5160 0.5545 0.5490 0.1015 -0.0383 0.0165 0.8809 0.9518 3.6641 -0.1490 -0.7944 -0.6588 0.0020 0.0389 -0.0339 0.0223 -0.2630 -0.1957 -0.3870 0.0982 0.0006 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1 through 90 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 91 through 247 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.12_2829: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 84 ? ? -75.44 42.41 2 1 VAL A 107 ? ? -147.33 -28.68 3 1 MET A 136 ? ? 55.05 -136.69 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 248 ? A GLY 248 2 1 Y 1 A ILE 249 ? A ILE 249 3 1 Y 1 A SER 250 ? A SER 250 4 1 Y 1 A LYS 251 ? A LYS 251 5 1 Y 1 A ILE 252 ? A ILE 252 6 1 Y 1 A GLN 253 ? A GLN 253 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 1GP C3 C N N 1 1GP O3 O N N 2 1GP C2 C N S 3 1GP O2 O N N 4 1GP C1 C N N 5 1GP O1P O N N 6 1GP O2P O N N 7 1GP O3P O N N 8 1GP O4P O N N 9 1GP P P N N 10 1GP H31 H N N 11 1GP H32 H N N 12 1GP HO3 H N N 13 1GP H2 H N N 14 1GP HO2 H N N 15 1GP H11 H N N 16 1GP H12 H N N 17 1GP HO3P H N N 18 1GP HO4P H N N 19 ALA N N N N 20 ALA CA C N S 21 ALA C C N N 22 ALA O O N N 23 ALA CB C N N 24 ALA OXT O N N 25 ALA H H N N 26 ALA H2 H N N 27 ALA HA H N N 28 ALA HB1 H N N 29 ALA HB2 H N N 30 ALA HB3 H N N 31 ALA HXT H N N 32 ARG N N N N 33 ARG CA C N S 34 ARG C C N N 35 ARG O O N N 36 ARG CB C N N 37 ARG CG C N N 38 ARG CD C N N 39 ARG NE N N N 40 ARG CZ C N N 41 ARG NH1 N N N 42 ARG NH2 N N N 43 ARG OXT O N N 44 ARG H H N N 45 ARG H2 H N N 46 ARG HA H N N 47 ARG HB2 H N N 48 ARG HB3 H N N 49 ARG HG2 H N N 50 ARG HG3 H N N 51 ARG HD2 H N N 52 ARG HD3 H N N 53 ARG HE H N N 54 ARG HH11 H N N 55 ARG HH12 H N N 56 ARG HH21 H N N 57 ARG HH22 H N N 58 ARG HXT H N N 59 ASN N N N N 60 ASN CA C N S 61 ASN C C N N 62 ASN O O N N 63 ASN CB C N N 64 ASN CG C N N 65 ASN OD1 O N N 66 ASN ND2 N N N 67 ASN OXT O N N 68 ASN H H N N 69 ASN H2 H N N 70 ASN HA H N N 71 ASN HB2 H N N 72 ASN HB3 H N N 73 ASN HD21 H N N 74 ASN HD22 H N N 75 ASN HXT H N N 76 ASP N N N N 77 ASP CA C N S 78 ASP C C N N 79 ASP O O N N 80 ASP CB C N N 81 ASP CG C N N 82 ASP OD1 O N N 83 ASP OD2 O N N 84 ASP OXT O N N 85 ASP H H N N 86 ASP H2 H N N 87 ASP HA H N N 88 ASP HB2 H N N 89 ASP HB3 H N N 90 ASP HD2 H N N 91 ASP HXT H N N 92 CYS N N N N 93 CYS CA C N R 94 CYS C C N N 95 CYS O O N N 96 CYS CB C N N 97 CYS SG S N N 98 CYS OXT O N N 99 CYS H H N N 100 CYS H2 H N N 101 CYS HA H N N 102 CYS HB2 H N N 103 CYS HB3 H N N 104 CYS HG H N N 105 CYS HXT H N N 106 GLN N N N N 107 GLN CA C N S 108 GLN C C N N 109 GLN O O N N 110 GLN CB C N N 111 GLN CG C N N 112 GLN CD C N N 113 GLN OE1 O N N 114 GLN NE2 N N N 115 GLN OXT O N N 116 GLN H H N N 117 GLN H2 H N N 118 GLN HA H N N 119 GLN HB2 H N N 120 GLN HB3 H N N 121 GLN HG2 H N N 122 GLN HG3 H N N 123 GLN HE21 H N N 124 GLN HE22 H N N 125 GLN HXT H N N 126 GLU N N N N 127 GLU CA C N S 128 GLU C C N N 129 GLU O O N N 130 GLU CB C N N 131 GLU CG C N N 132 GLU CD C N N 133 GLU OE1 O N N 134 GLU OE2 O N N 135 GLU OXT O N N 136 GLU H H N N 137 GLU H2 H N N 138 GLU HA H N N 139 GLU HB2 H N N 140 GLU HB3 H N N 141 GLU HG2 H N N 142 GLU HG3 H N N 143 GLU HE2 H N N 144 GLU HXT H N N 145 GLY N N N N 146 GLY CA C N N 147 GLY C C N N 148 GLY O O N N 149 GLY OXT O N N 150 GLY H H N N 151 GLY H2 H N N 152 GLY HA2 H N N 153 GLY HA3 H N N 154 GLY HXT H N N 155 HIS N N N N 156 HIS CA C N S 157 HIS C C N N 158 HIS O O N N 159 HIS CB C N N 160 HIS CG C Y N 161 HIS ND1 N Y N 162 HIS CD2 C Y N 163 HIS CE1 C Y N 164 HIS NE2 N Y N 165 HIS OXT O N N 166 HIS H H N N 167 HIS H2 H N N 168 HIS HA H N N 169 HIS HB2 H N N 170 HIS HB3 H N N 171 HIS HD1 H N N 172 HIS HD2 H N N 173 HIS HE1 H N N 174 HIS HE2 H N N 175 HIS HXT H N N 176 HOH O O N N 177 HOH H1 H N N 178 HOH H2 H N N 179 ILE N N N N 180 ILE CA C N S 181 ILE C C N N 182 ILE O O N N 183 ILE CB C N S 184 ILE CG1 C N N 185 ILE CG2 C N N 186 ILE CD1 C N N 187 ILE OXT O N N 188 ILE H H N N 189 ILE H2 H N N 190 ILE HA H N N 191 ILE HB H N N 192 ILE HG12 H N N 193 ILE HG13 H N N 194 ILE HG21 H N N 195 ILE HG22 H N N 196 ILE HG23 H N N 197 ILE HD11 H N N 198 ILE HD12 H N N 199 ILE HD13 H N N 200 ILE HXT H N N 201 LEU N N N N 202 LEU CA C N S 203 LEU C C N N 204 LEU O O N N 205 LEU CB C N N 206 LEU CG C N N 207 LEU CD1 C N N 208 LEU CD2 C N N 209 LEU OXT O N N 210 LEU H H N N 211 LEU H2 H N N 212 LEU HA H N N 213 LEU HB2 H N N 214 LEU HB3 H N N 215 LEU HG H N N 216 LEU HD11 H N N 217 LEU HD12 H N N 218 LEU HD13 H N N 219 LEU HD21 H N N 220 LEU HD22 H N N 221 LEU HD23 H N N 222 LEU HXT H N N 223 LYS N N N N 224 LYS CA C N S 225 LYS C C N N 226 LYS O O N N 227 LYS CB C N N 228 LYS CG C N N 229 LYS CD C N N 230 LYS CE C N N 231 LYS NZ N N N 232 LYS OXT O N N 233 LYS H H N N 234 LYS H2 H N N 235 LYS HA H N N 236 LYS HB2 H N N 237 LYS HB3 H N N 238 LYS HG2 H N N 239 LYS HG3 H N N 240 LYS HD2 H N N 241 LYS HD3 H N N 242 LYS HE2 H N N 243 LYS HE3 H N N 244 LYS HZ1 H N N 245 LYS HZ2 H N N 246 LYS HZ3 H N N 247 LYS HXT H N N 248 MET N N N N 249 MET CA C N S 250 MET C C N N 251 MET O O N N 252 MET CB C N N 253 MET CG C N N 254 MET SD S N N 255 MET CE C N N 256 MET OXT O N N 257 MET H H N N 258 MET H2 H N N 259 MET HA H N N 260 MET HB2 H N N 261 MET HB3 H N N 262 MET HG2 H N N 263 MET HG3 H N N 264 MET HE1 H N N 265 MET HE2 H N N 266 MET HE3 H N N 267 MET HXT H N N 268 PHE N N N N 269 PHE CA C N S 270 PHE C C N N 271 PHE O O N N 272 PHE CB C N N 273 PHE CG C Y N 274 PHE CD1 C Y N 275 PHE CD2 C Y N 276 PHE CE1 C Y N 277 PHE CE2 C Y N 278 PHE CZ C Y N 279 PHE OXT O N N 280 PHE H H N N 281 PHE H2 H N N 282 PHE HA H N N 283 PHE HB2 H N N 284 PHE HB3 H N N 285 PHE HD1 H N N 286 PHE HD2 H N N 287 PHE HE1 H N N 288 PHE HE2 H N N 289 PHE HZ H N N 290 PHE HXT H N N 291 PRO N N N N 292 PRO CA C N S 293 PRO C C N N 294 PRO O O N N 295 PRO CB C N N 296 PRO CG C N N 297 PRO CD C N N 298 PRO OXT O N N 299 PRO H H N N 300 PRO HA H N N 301 PRO HB2 H N N 302 PRO HB3 H N N 303 PRO HG2 H N N 304 PRO HG3 H N N 305 PRO HD2 H N N 306 PRO HD3 H N N 307 PRO HXT H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TYR N N N N 340 TYR CA C N S 341 TYR C C N N 342 TYR O O N N 343 TYR CB C N N 344 TYR CG C Y N 345 TYR CD1 C Y N 346 TYR CD2 C Y N 347 TYR CE1 C Y N 348 TYR CE2 C Y N 349 TYR CZ C Y N 350 TYR OH O N N 351 TYR OXT O N N 352 TYR H H N N 353 TYR H2 H N N 354 TYR HA H N N 355 TYR HB2 H N N 356 TYR HB3 H N N 357 TYR HD1 H N N 358 TYR HD2 H N N 359 TYR HE1 H N N 360 TYR HE2 H N N 361 TYR HH H N N 362 TYR HXT H N N 363 VAL N N N N 364 VAL CA C N S 365 VAL C C N N 366 VAL O O N N 367 VAL CB C N N 368 VAL CG1 C N N 369 VAL CG2 C N N 370 VAL OXT O N N 371 VAL H H N N 372 VAL H2 H N N 373 VAL HA H N N 374 VAL HB H N N 375 VAL HG11 H N N 376 VAL HG12 H N N 377 VAL HG13 H N N 378 VAL HG21 H N N 379 VAL HG22 H N N 380 VAL HG23 H N N 381 VAL HXT H N N 382 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 1GP C3 C2 sing N N 1 1GP C3 O2 sing N N 2 1GP C3 H31 sing N N 3 1GP C3 H32 sing N N 4 1GP O3 C2 sing N N 5 1GP O3 HO3 sing N N 6 1GP C2 C1 sing N N 7 1GP C2 H2 sing N N 8 1GP O2 HO2 sing N N 9 1GP C1 O1P sing N N 10 1GP C1 H11 sing N N 11 1GP C1 H12 sing N N 12 1GP O1P P sing N N 13 1GP O2P P doub N N 14 1GP O3P P sing N N 15 1GP O3P HO3P sing N N 16 1GP O4P P sing N N 17 1GP O4P HO4P sing N N 18 ALA N CA sing N N 19 ALA N H sing N N 20 ALA N H2 sing N N 21 ALA CA C sing N N 22 ALA CA CB sing N N 23 ALA CA HA sing N N 24 ALA C O doub N N 25 ALA C OXT sing N N 26 ALA CB HB1 sing N N 27 ALA CB HB2 sing N N 28 ALA CB HB3 sing N N 29 ALA OXT HXT sing N N 30 ARG N CA sing N N 31 ARG N H sing N N 32 ARG N H2 sing N N 33 ARG CA C sing N N 34 ARG CA CB sing N N 35 ARG CA HA sing N N 36 ARG C O doub N N 37 ARG C OXT sing N N 38 ARG CB CG sing N N 39 ARG CB HB2 sing N N 40 ARG CB HB3 sing N N 41 ARG CG CD sing N N 42 ARG CG HG2 sing N N 43 ARG CG HG3 sing N N 44 ARG CD NE sing N N 45 ARG CD HD2 sing N N 46 ARG CD HD3 sing N N 47 ARG NE CZ sing N N 48 ARG NE HE sing N N 49 ARG CZ NH1 sing N N 50 ARG CZ NH2 doub N N 51 ARG NH1 HH11 sing N N 52 ARG NH1 HH12 sing N N 53 ARG NH2 HH21 sing N N 54 ARG NH2 HH22 sing N N 55 ARG OXT HXT sing N N 56 ASN N CA sing N N 57 ASN N H sing N N 58 ASN N H2 sing N N 59 ASN CA C sing N N 60 ASN CA CB sing N N 61 ASN CA HA sing N N 62 ASN C O doub N N 63 ASN C OXT sing N N 64 ASN CB CG sing N N 65 ASN CB HB2 sing N N 66 ASN CB HB3 sing N N 67 ASN CG OD1 doub N N 68 ASN CG ND2 sing N N 69 ASN ND2 HD21 sing N N 70 ASN ND2 HD22 sing N N 71 ASN OXT HXT sing N N 72 ASP N CA sing N N 73 ASP N H sing N N 74 ASP N H2 sing N N 75 ASP CA C sing N N 76 ASP CA CB sing N N 77 ASP CA HA sing N N 78 ASP C O doub N N 79 ASP C OXT sing N N 80 ASP CB CG sing N N 81 ASP CB HB2 sing N N 82 ASP CB HB3 sing N N 83 ASP CG OD1 doub N N 84 ASP CG OD2 sing N N 85 ASP OD2 HD2 sing N N 86 ASP OXT HXT sing N N 87 CYS N CA sing N N 88 CYS N H sing N N 89 CYS N H2 sing N N 90 CYS CA C sing N N 91 CYS CA CB sing N N 92 CYS CA HA sing N N 93 CYS C O doub N N 94 CYS C OXT sing N N 95 CYS CB SG sing N N 96 CYS CB HB2 sing N N 97 CYS CB HB3 sing N N 98 CYS SG HG sing N N 99 CYS OXT HXT sing N N 100 GLN N CA sing N N 101 GLN N H sing N N 102 GLN N H2 sing N N 103 GLN CA C sing N N 104 GLN CA CB sing N N 105 GLN CA HA sing N N 106 GLN C O doub N N 107 GLN C OXT sing N N 108 GLN CB CG sing N N 109 GLN CB HB2 sing N N 110 GLN CB HB3 sing N N 111 GLN CG CD sing N N 112 GLN CG HG2 sing N N 113 GLN CG HG3 sing N N 114 GLN CD OE1 doub N N 115 GLN CD NE2 sing N N 116 GLN NE2 HE21 sing N N 117 GLN NE2 HE22 sing N N 118 GLN OXT HXT sing N N 119 GLU N CA sing N N 120 GLU N H sing N N 121 GLU N H2 sing N N 122 GLU CA C sing N N 123 GLU CA CB sing N N 124 GLU CA HA sing N N 125 GLU C O doub N N 126 GLU C OXT sing N N 127 GLU CB CG sing N N 128 GLU CB HB2 sing N N 129 GLU CB HB3 sing N N 130 GLU CG CD sing N N 131 GLU CG HG2 sing N N 132 GLU CG HG3 sing N N 133 GLU CD OE1 doub N N 134 GLU CD OE2 sing N N 135 GLU OE2 HE2 sing N N 136 GLU OXT HXT sing N N 137 GLY N CA sing N N 138 GLY N H sing N N 139 GLY N H2 sing N N 140 GLY CA C sing N N 141 GLY CA HA2 sing N N 142 GLY CA HA3 sing N N 143 GLY C O doub N N 144 GLY C OXT sing N N 145 GLY OXT HXT sing N N 146 HIS N CA sing N N 147 HIS N H sing N N 148 HIS N H2 sing N N 149 HIS CA C sing N N 150 HIS CA CB sing N N 151 HIS CA HA sing N N 152 HIS C O doub N N 153 HIS C OXT sing N N 154 HIS CB CG sing N N 155 HIS CB HB2 sing N N 156 HIS CB HB3 sing N N 157 HIS CG ND1 sing Y N 158 HIS CG CD2 doub Y N 159 HIS ND1 CE1 doub Y N 160 HIS ND1 HD1 sing N N 161 HIS CD2 NE2 sing Y N 162 HIS CD2 HD2 sing N N 163 HIS CE1 NE2 sing Y N 164 HIS CE1 HE1 sing N N 165 HIS NE2 HE2 sing N N 166 HIS OXT HXT sing N N 167 HOH O H1 sing N N 168 HOH O H2 sing N N 169 ILE N CA sing N N 170 ILE N H sing N N 171 ILE N H2 sing N N 172 ILE CA C sing N N 173 ILE CA CB sing N N 174 ILE CA HA sing N N 175 ILE C O doub N N 176 ILE C OXT sing N N 177 ILE CB CG1 sing N N 178 ILE CB CG2 sing N N 179 ILE CB HB sing N N 180 ILE CG1 CD1 sing N N 181 ILE CG1 HG12 sing N N 182 ILE CG1 HG13 sing N N 183 ILE CG2 HG21 sing N N 184 ILE CG2 HG22 sing N N 185 ILE CG2 HG23 sing N N 186 ILE CD1 HD11 sing N N 187 ILE CD1 HD12 sing N N 188 ILE CD1 HD13 sing N N 189 ILE OXT HXT sing N N 190 LEU N CA sing N N 191 LEU N H sing N N 192 LEU N H2 sing N N 193 LEU CA C sing N N 194 LEU CA CB sing N N 195 LEU CA HA sing N N 196 LEU C O doub N N 197 LEU C OXT sing N N 198 LEU CB CG sing N N 199 LEU CB HB2 sing N N 200 LEU CB HB3 sing N N 201 LEU CG CD1 sing N N 202 LEU CG CD2 sing N N 203 LEU CG HG sing N N 204 LEU CD1 HD11 sing N N 205 LEU CD1 HD12 sing N N 206 LEU CD1 HD13 sing N N 207 LEU CD2 HD21 sing N N 208 LEU CD2 HD22 sing N N 209 LEU CD2 HD23 sing N N 210 LEU OXT HXT sing N N 211 LYS N CA sing N N 212 LYS N H sing N N 213 LYS N H2 sing N N 214 LYS CA C sing N N 215 LYS CA CB sing N N 216 LYS CA HA sing N N 217 LYS C O doub N N 218 LYS C OXT sing N N 219 LYS CB CG sing N N 220 LYS CB HB2 sing N N 221 LYS CB HB3 sing N N 222 LYS CG CD sing N N 223 LYS CG HG2 sing N N 224 LYS CG HG3 sing N N 225 LYS CD CE sing N N 226 LYS CD HD2 sing N N 227 LYS CD HD3 sing N N 228 LYS CE NZ sing N N 229 LYS CE HE2 sing N N 230 LYS CE HE3 sing N N 231 LYS NZ HZ1 sing N N 232 LYS NZ HZ2 sing N N 233 LYS NZ HZ3 sing N N 234 LYS OXT HXT sing N N 235 MET N CA sing N N 236 MET N H sing N N 237 MET N H2 sing N N 238 MET CA C sing N N 239 MET CA CB sing N N 240 MET CA HA sing N N 241 MET C O doub N N 242 MET C OXT sing N N 243 MET CB CG sing N N 244 MET CB HB2 sing N N 245 MET CB HB3 sing N N 246 MET CG SD sing N N 247 MET CG HG2 sing N N 248 MET CG HG3 sing N N 249 MET SD CE sing N N 250 MET CE HE1 sing N N 251 MET CE HE2 sing N N 252 MET CE HE3 sing N N 253 MET OXT HXT sing N N 254 PHE N CA sing N N 255 PHE N H sing N N 256 PHE N H2 sing N N 257 PHE CA C sing N N 258 PHE CA CB sing N N 259 PHE CA HA sing N N 260 PHE C O doub N N 261 PHE C OXT sing N N 262 PHE CB CG sing N N 263 PHE CB HB2 sing N N 264 PHE CB HB3 sing N N 265 PHE CG CD1 doub Y N 266 PHE CG CD2 sing Y N 267 PHE CD1 CE1 sing Y N 268 PHE CD1 HD1 sing N N 269 PHE CD2 CE2 doub Y N 270 PHE CD2 HD2 sing N N 271 PHE CE1 CZ doub Y N 272 PHE CE1 HE1 sing N N 273 PHE CE2 CZ sing Y N 274 PHE CE2 HE2 sing N N 275 PHE CZ HZ sing N N 276 PHE OXT HXT sing N N 277 PRO N CA sing N N 278 PRO N CD sing N N 279 PRO N H sing N N 280 PRO CA C sing N N 281 PRO CA CB sing N N 282 PRO CA HA sing N N 283 PRO C O doub N N 284 PRO C OXT sing N N 285 PRO CB CG sing N N 286 PRO CB HB2 sing N N 287 PRO CB HB3 sing N N 288 PRO CG CD sing N N 289 PRO CG HG2 sing N N 290 PRO CG HG3 sing N N 291 PRO CD HD2 sing N N 292 PRO CD HD3 sing N N 293 PRO OXT HXT sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TYR N CA sing N N 324 TYR N H sing N N 325 TYR N H2 sing N N 326 TYR CA C sing N N 327 TYR CA CB sing N N 328 TYR CA HA sing N N 329 TYR C O doub N N 330 TYR C OXT sing N N 331 TYR CB CG sing N N 332 TYR CB HB2 sing N N 333 TYR CB HB3 sing N N 334 TYR CG CD1 doub Y N 335 TYR CG CD2 sing Y N 336 TYR CD1 CE1 sing Y N 337 TYR CD1 HD1 sing N N 338 TYR CD2 CE2 doub Y N 339 TYR CD2 HD2 sing N N 340 TYR CE1 CZ doub Y N 341 TYR CE1 HE1 sing N N 342 TYR CE2 CZ sing Y N 343 TYR CE2 HE2 sing N N 344 TYR CZ OH sing N N 345 TYR OH HH sing N N 346 TYR OXT HXT sing N N 347 VAL N CA sing N N 348 VAL N H sing N N 349 VAL N H2 sing N N 350 VAL CA C sing N N 351 VAL CA CB sing N N 352 VAL CA HA sing N N 353 VAL C O doub N N 354 VAL C OXT sing N N 355 VAL CB CG1 sing N N 356 VAL CB CG2 sing N N 357 VAL CB HB sing N N 358 VAL CG1 HG11 sing N N 359 VAL CG1 HG12 sing N N 360 VAL CG1 HG13 sing N N 361 VAL CG2 HG21 sing N N 362 VAL CG2 HG22 sing N N 363 VAL CG2 HG23 sing N N 364 VAL OXT HXT sing N N 365 # _pdbx_audit_support.funding_organization 'Ministry of Education, Culture, Sports, Science and Technology (Japan)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 1GP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 1GP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 SN-GLYCEROL-1-PHOSPHATE 1GP 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4MM1 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #