data_6K59 # _entry.id 6K59 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.324 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6K59 WWPDB D_1300011668 BMRB 36258 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'GLARGINE INSULIN' _pdbx_database_related.db_id 36258 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6K59 _pdbx_database_status.recvd_initial_deposition_date 2019-05-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ratha, B.N.' 1 ? 'Kar, R.K.' 2 ? 'Bhunia, A.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Phys.Chem.B _citation.journal_id_ASTM JPCBFK _citation.journal_id_CSD 1278 _citation.journal_id_ISSN 1089-5647 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 124 _citation.language ? _citation.page_first 1125 _citation.page_last 1136 _citation.title 'Molecular Details of a Salt Bridge and Its Role in Insulin Fibrillation by NMR and Raman Spectroscopic Analysis.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jpcb.9b10349 _citation.pdbx_database_id_PubMed 31958230 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ratha, B.N.' 1 ? primary 'Kar, R.K.' 2 0000-0003-4629-5863 primary 'Bednarikova, Z.' 3 ? primary 'Gazova, Z.' 4 0000-0002-0670-3431 primary 'Kotler, S.A.' 5 ? primary 'Raha, S.' 6 ? primary 'De, S.' 7 0000-0002-4347-3137 primary 'Maiti, N.C.' 8 0000-0002-8498-6502 primary 'Bhunia, A.' 9 0000-0002-8752-2842 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Glargine Insulin Chain-A' 2326.647 1 ? ? ? ? 2 polymer syn 'Glargine insulin Chain-B' 3748.340 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCG GIVEQCCTSICSLYQLENYCG A ? 2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 GLN n 1 6 CYS n 1 7 CYS n 1 8 THR n 1 9 SER n 1 10 ILE n 1 11 CYS n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 ASN n 1 19 TYR n 1 20 CYS n 1 21 GLY n 2 1 PHE n 2 2 VAL n 2 3 ASN n 2 4 GLN n 2 5 HIS n 2 6 LEU n 2 7 CYS n 2 8 GLY n 2 9 SER n 2 10 HIS n 2 11 LEU n 2 12 VAL n 2 13 GLU n 2 14 ALA n 2 15 LEU n 2 16 TYR n 2 17 LEU n 2 18 VAL n 2 19 CYS n 2 20 GLY n 2 21 GLU n 2 22 ARG n 2 23 GLY n 2 24 PHE n 2 25 PHE n 2 26 TYR n 2 27 THR n 2 28 PRO n 2 29 LYS n 2 30 THR n 2 31 ARG n 2 32 ARG n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample 1 21 'synthetic construct' ? 32630 ? 2 1 sample 1 32 'synthetic construct' ? 32630 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 6K59 6K59 ? 1 ? 1 2 PDB 6K59 6K59 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6K59 A 1 ? 21 ? 6K59 1 ? 21 ? 1 21 2 2 6K59 B 1 ? 32 ? 6K59 1 ? 32 ? 1 32 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 1.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details '2mg/ml Zn free glargine insulin in 20% acetic acid/d4 at pH 1.9' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label GI_20% _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pD _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '350 uM UNLABELLED PEPTIDE CHAIN A, 350 uM UNLABELLED PEPTIDE CHAIN B, 20% acetic acid/d4' _pdbx_nmr_sample_details.solvent_system '20% acetic acid/d4' _pdbx_nmr_sample_details.label GI _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '2mg/ml Zn free glargine insulin in 20% acetic acid/d4 at pH 1.9' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details 'IIT KGP' # _pdbx_nmr_refine.entry_id 6K59 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # _pdbx_nmr_ensemble.entry_id 6K59 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6K59 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' Sparky 12.1 https://www.cgl.ucsf.edu/home/sparky/ 6 collection TopSpin ? 'Bruker Biospin' 2 'structure calculation' Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 4 'peak picking' Sparky ? https://www.cgl.ucsf.edu/home/sparky/ 5 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6K59 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6K59 _struct.title 'Structure of Glargine insulin in 20% acetic acid-d4 (pH 1.9)' _struct.pdbx_descriptor 'Glargine Insulin Chain-A, Glargine insulin Chain-B' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6K59 _struct_keywords.text 'diabetes, insulin, HORMONE' _struct_keywords.pdbx_keywords HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? SER A 9 ? GLY A 1 SER A 9 1 ? 9 HELX_P HELX_P2 AA2 SER A 12 ? ASN A 18 ? SER A 12 ASN A 18 1 ? 7 HELX_P HELX_P3 AA3 GLY B 8 ? CYS B 19 ? GLY B 8 CYS B 19 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6 A CYS 11 1_555 ? ? ? ? ? ? ? 2.041 ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 B CYS 7 SG ? ? A CYS 7 B CYS 7 1_555 ? ? ? ? ? ? ? 2.038 ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.045 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 6K59 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 GLY 21 21 21 GLY GLY A . n B 2 1 PHE 1 1 1 PHE PHE B . n B 2 2 VAL 2 2 2 VAL VAL B . n B 2 3 ASN 3 3 3 ASN ASN B . n B 2 4 GLN 4 4 4 GLN GLN B . n B 2 5 HIS 5 5 5 HIS HIS B . n B 2 6 LEU 6 6 6 LEU LEU B . n B 2 7 CYS 7 7 7 CYS CYS B . n B 2 8 GLY 8 8 8 GLY GLY B . n B 2 9 SER 9 9 9 SER SER B . n B 2 10 HIS 10 10 10 HIS HIS B . n B 2 11 LEU 11 11 11 LEU LEU B . n B 2 12 VAL 12 12 12 VAL VAL B . n B 2 13 GLU 13 13 13 GLU GLU B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 LEU 15 15 15 LEU LEU B . n B 2 16 TYR 16 16 16 TYR TYR B . n B 2 17 LEU 17 17 17 LEU LEU B . n B 2 18 VAL 18 18 18 VAL VAL B . n B 2 19 CYS 19 19 19 CYS CYS B . n B 2 20 GLY 20 20 20 GLY GLY B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 ARG 22 22 22 ARG ARG B . n B 2 23 GLY 23 23 23 GLY GLY B . n B 2 24 PHE 24 24 24 PHE PHE B . n B 2 25 PHE 25 25 25 PHE PHE B . n B 2 26 TYR 26 26 26 TYR TYR B . n B 2 27 THR 27 27 27 THR THR B . n B 2 28 PRO 28 28 28 PRO PRO B . n B 2 29 LYS 29 29 29 LYS LYS B . n B 2 30 THR 30 30 30 THR THR B . n B 2 31 ARG 31 31 31 ARG ARG B . n B 2 32 ARG 32 32 32 ARG ARG B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1600 ? 1 MORE -16 ? 1 'SSA (A^2)' 3500 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2020-05-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'PEPTIDE CHAIN A' 350 ? uM UNLABELLED 1 'PEPTIDE CHAIN B' 350 ? uM UNLABELLED # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 123.74 120.30 3.44 0.50 N 2 2 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 123.67 120.30 3.37 0.50 N 3 3 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 123.75 120.30 3.45 0.50 N 4 3 NE B ARG 31 ? ? CZ B ARG 31 ? ? NH1 B ARG 31 ? ? 123.68 120.30 3.38 0.50 N 5 4 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 123.47 120.30 3.17 0.50 N 6 4 NE B ARG 31 ? ? CZ B ARG 31 ? ? NH1 B ARG 31 ? ? 123.61 120.30 3.31 0.50 N 7 5 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 123.56 120.30 3.26 0.50 N 8 6 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 123.42 120.30 3.12 0.50 N 9 6 NE B ARG 31 ? ? CZ B ARG 31 ? ? NH1 B ARG 31 ? ? 123.45 120.30 3.15 0.50 N 10 7 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 123.51 120.30 3.21 0.50 N 11 8 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 123.40 120.30 3.10 0.50 N 12 9 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 123.36 120.30 3.06 0.50 N 13 10 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 123.33 120.30 3.03 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 19 ? ? -135.97 -31.96 2 1 HIS B 5 ? ? -93.99 30.76 3 1 TYR B 26 ? ? 43.78 80.02 4 1 LYS B 29 ? ? 54.57 -157.95 5 2 TYR A 19 ? ? -137.25 -35.04 6 2 PHE B 25 ? ? -74.75 33.56 7 2 THR B 27 ? ? -150.75 -9.77 8 2 LYS B 29 ? ? 54.67 -159.97 9 3 TYR A 19 ? ? -135.13 -30.76 10 3 ASN B 3 ? ? 59.09 -23.91 11 3 HIS B 5 ? ? -93.88 32.94 12 3 LYS B 29 ? ? 52.87 -154.01 13 4 TYR A 19 ? ? -133.59 -33.79 14 4 ASN B 3 ? ? 59.83 -20.02 15 4 HIS B 5 ? ? -83.81 41.87 16 4 TYR B 26 ? ? 39.36 65.34 17 4 LYS B 29 ? ? 57.11 178.67 18 5 TYR A 19 ? ? -130.57 -32.82 19 5 ASN B 3 ? ? 59.99 -12.83 20 5 HIS B 5 ? ? -83.94 39.65 21 5 PHE B 25 ? ? -84.79 42.35 22 5 THR B 27 ? ? -141.85 -28.76 23 5 LYS B 29 ? ? 54.39 -159.10 24 6 HIS B 5 ? ? -84.89 42.98 25 6 PHE B 25 ? ? -92.89 38.86 26 6 THR B 27 ? ? -145.52 -30.57 27 6 LYS B 29 ? ? 56.56 -176.61 28 7 PHE B 25 ? ? -84.15 47.86 29 7 THR B 27 ? ? -149.88 -33.73 30 7 LYS B 29 ? ? 63.68 127.52 31 8 HIS B 5 ? ? -85.39 33.35 32 8 TYR B 16 ? ? -65.88 0.02 33 8 TYR B 26 ? ? 38.47 47.88 34 8 LYS B 29 ? ? 60.10 104.70 35 9 ASN B 3 ? ? 58.31 14.62 36 9 LYS B 29 ? ? 64.44 134.53 37 10 LYS B 29 ? ? 64.97 124.62 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLY B 23 ? ? PHE B 24 ? ? -144.83 2 2 GLY B 23 ? ? PHE B 24 ? ? -142.44 3 3 GLY B 23 ? ? PHE B 24 ? ? -145.24 4 4 GLY B 23 ? ? PHE B 24 ? ? -147.64 5 5 GLY B 23 ? ? PHE B 24 ? ? -146.20 6 6 GLY B 23 ? ? PHE B 24 ? ? -147.57 7 7 GLY B 23 ? ? PHE B 24 ? ? -149.29 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 7 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id B _pdbx_validate_planes.auth_seq_id 31 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.085 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_audit_support.funding_organization 'Council of Scientific & Industrial Research' _pdbx_audit_support.country India _pdbx_audit_support.grant_number '02(0292)/17/EMR-II' _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'THE ZINC FREE FORM IS PREDOMINANTLY MONOMER IN 20% ACETIC ACID PH 1.9' #